HHsearch alignment for GI: 254780606 and conserved domain: PRK13638

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=93.45  E-value=0.069  Score=31.94  Aligned_cols=43  Identities=28%  Similarity=0.407  Sum_probs=28.5

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             112011484699707875344799999999998568011079997234
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
T Consensus        21 sl~i~~Gei~~liGpNGaGKSTLlk~-l~Gl~---~p~~G~I~-~~G~   63 (271)
T PRK13638         21 NLDFSLSPVTGLVGANGCGKSTLFMN-LSGLL---RPQKGAVL-WQGK   63 (271)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEE-ECCE
T ss_conf             87983897999999999809999999-96688---88860799-9999