HHsearch alignment for GI: 254780606 and conserved domain: PRK13891

>PRK13891 conjugal transfer protein TrbE; Provisional.
Probab=99.24  E-value=8.8e-08  Score=72.38  Aligned_cols=293  Identities=18%  Similarity=0.216  Sum_probs=154.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCE--E----------EEECCC
Q ss_conf             8899999987403551389867648925899975488863999985999999871477632--7----------751898
Q gi|254780606|r  292 KNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSAR--V----------AVIPKR  359 (744)
Q Consensus       292 ~~~~~l~~~l~~~~~~~~~~~~~~gp~~~~~~~~~~~g~~~~~~~~~~~d~~~~~~~~~~~--~----------~~~pg~  359 (744)
T Consensus       353 ~~~~d~d~Al~el~sg~v~~G-y~t~tv~v~~------~~~~~l~~~~~~v~~~l~~~GF~~~~Et~n~~~A~lgsLPGn  425 (852)
T PRK13891        353 SMVGDAEAAIAEVNSGLVAAG-YYTSVVVLMD------EDRERLEASALLVEKAINRLAFAARIETINTMDAYLGSLPGH  425 (852)
T ss_pred             HHHHHHHHHHHHHCCCCEEEE-EEEEEEEEEC------CCHHHHHHHHHHHHHHHHHCCCEEEEEHHCCHHHHHHCCCCC
T ss_conf             999999999998608975268-8888999978------999999999999999998689679861102399998619997


Q ss_pred             CEEEEECCCCCCCEEEHHHHHCCHHHCCC----------CCCEEEEEEECCCCCEEECCHH--HCCCEEEEECCCCCHHH
Q ss_conf             34544268888870765875128121146----------7836898420578873211201--14846997078753447
Q gi|254780606|r  360 NAIGIELPNETRETVYLRQIIESRSFSHS----------KANLALCLGKTISGESVIADLA--NMPHILVAGTTGSGKSV  427 (744)
Q Consensus       360 ~~~~~~~p~~~~~~v~~~~~~~~~~~~~~----------~~~l~~~~g~~~~g~~~~~dl~--~~PH~lvaG~TgsGKS~  427 (744)
T Consensus       426 ~~~nvR~~~i--sT~NlA~l~pl~~vw~G~~~~p~~~~~~~~pal~~~~T~g~tPf~fN~Hv~DvGHTlIiGpTGaGKTv  503 (852)
T PRK13891        426 GVENVRRPLI--NTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDLGHTFMFGPTGAGKST  503 (852)
T ss_pred             CCCCCCCCCC--CHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEECCCCCCCCEEEECCCCCCHHH
T ss_conf             6677563666--64777756410345678667988668999874188744899844785456886640787899998899


Q ss_pred             HHHHHHHHHHHHCCHHHEEEEEECCCCC-----------------EECCC-C-CCCCEEEEE--EECHHHHHHHHHHHHH
Q ss_conf             9999999999856801107999723421-----------------00012-5-775200004--4441787689999998
Q gi|254780606|r  428 AINTMIMSLLYRLRPDECRMIMVDPKML-----------------ELSVY-D-GIPHLLTPV--VTNPKKAVMALKWAVR  486 (744)
Q Consensus       428 ~l~~~i~sl~~~~~p~~~~~~liD~k~~-----------------~~~~~-~-~~ph~~~~v--~~~~~~~~~~l~~~~~  486 (744)
T Consensus       504 ll~fL~aQ~-~rY~~~--~vf~FDK~~S~~~~~~g~~~~~~a~GG~~~~l~~~~~~~gfnPL~~~dt~~~r~~~~~wl~~  580 (852)
T PRK13891        504 HLGIIAAQL-RRYAGM--SIYAFDKGMSMYPLAAGIRAATKGKSGLHFTVAADDDRLAFCPLQFLETKGDRAWAMEWIDT  580 (852)
T ss_pred             HHHHHHHHH-HHCCCC--CEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             999999997-441898--18987898523434412468898539817630689998786878689971457999999999


Q ss_pred             HH---------------HHHHHHHHHCCCCCHHHHHHHH---------HHHHCCCCC-----CC----------------
Q ss_conf             66---------------7699999980778679999988---------642026776-----66----------------
Q gi|254780606|r  487 EM---------------EERYRKMSHLSVRNIKSYNERI---------STMYGEKPQ-----GC----------------  521 (744)
Q Consensus       487 em---------------~~r~~~~~~~~~~~i~~~n~~~---------~~~~~~~~~-----~~----------------  521 (744)
T Consensus       581 ll~~~g~~~tp~~~~~I~~Av~sl~~~~~rtLs~f~~~lq~~~l~~aL~~w~~~G~~G~lfDn~~D~l~~s~~~~Fe~~~  660 (852)
T PRK13891        581 ILALNGVNTTPAQRNEIGNAIMSMHASGARTLSEFSVTIQDEAIREAIKQYTVDGSMGHLLDAEEDGLSLSDFTVFEIEE  660 (852)
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCEEEECHH
T ss_conf             99728988998999999999998761646079999876398889999999846998060378876676767645882501


Q ss_pred             ----CCC----------------CCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC--
Q ss_conf             ----543----------------2338679998445687675310358999999999642013589998516544441--
Q gi|254780606|r  522 ----GDD----------------MRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI--  579 (744)
Q Consensus       522 ----~~~----------------~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi--  579 (744)
T Consensus       661 l~~~~~~~~~Pvl~YLFhRIe~~lDGrp-tli~lDEaW~~L-~d-p~F~~~i~~wLKTlRKkN~~VvfATQSl~-Di~~S  736 (852)
T PRK13891        661 LMNLGEKFALPVLLYLFRRIERALKGQP-SVIILDEAWLML-GH-PAFRAKIREWLKVLRKANCLVLMATQSLS-DAANS  736 (852)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHCCCC-EEEEEHHHHHHH-CC-HHHHHHHHHHHHHHHHCCCEEEEECCCHH-HHHCC
T ss_conf             3026815589999999999998736992-699952367761-89-99999999999999871847999768888-98538


Q ss_pred             --HHHHHHCCCCEEEEECCCHHH
Q ss_conf             --467885056305720368111
Q gi|254780606|r  580 --TGTIKANFPIRISFQVTSKID  600 (744)
Q Consensus       580 --~~~ik~n~~~ri~~~v~~~~d  600 (744)
T Consensus       737 ~I~~aiiEqc~T~IfLPNp~A~~  759 (852)
T PRK13891        737 GILDVIVESTATKIFLPNVYARD  759 (852)
T ss_pred             CHHHHHHHHCCEEEECCCCCCCC
T ss_conf             56899998588568767855577