HHsearch alignment for GI: 254780606 and conserved domain: PRK13898

>PRK13898 type IV secretion system ATPase VirB4; Provisional.
Probab=99.06  E-value=3.9e-08  Score=74.80  Aligned_cols=212  Identities=22%  Similarity=0.355  Sum_probs=113.8

Q ss_pred             EEEEEEECCCCCEEECCHH--HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC-EEC------CCC-
Q ss_conf             6898420578873211201--148469970787534479999999999856801107999723421-000------125-
Q gi|254780606|r  392 LALCLGKTISGESVIADLA--NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML-ELS------VYD-  461 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~--~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~-~~~------~~~-  461 (744)
T Consensus       424 ~av~~~~T~~gtpy~fNfH~~d~GHtlI~G~TGsGKTtl~~fL~aq-~~ky~~---~~f~fDkd~~~~i~~~a~GG~Y~~  499 (800)
T PRK13898        424 EAVTVFDTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAQ-AMKFSP---RMFFFDKDRGAEIFIRALNGVYTV  499 (800)
T ss_pred             CCCEECCCCCCCCEEEECCCCCCCCEEEECCCCCCHHHHHHHHHHH-HHHHCC---EEEEEECCCCHHHHHHHHCCEEEE
T ss_conf             5665030389987798674598775699899999899999999999-875488---799997999869999982988874


Q ss_pred             ---CCCCEEEEE--EECHHHHHHHHHHH---HH--------H--------------H---HHHHHHHHH-CCCCCHHHHH
Q ss_conf             ---775200004--44417876899999---98--------6--------------6---769999998-0778679999
Q gi|254780606|r  462 ---GIPHLLTPV--VTNPKKAVMALKWA---VR--------E--------------M---EERYRKMSH-LSVRNIKSYN  507 (744)
Q Consensus       462 ---~~ph~~~~v--~~~~~~~~~~l~~~---~~--------e--------------m---~~r~~~~~~-~~~~~i~~~n  507 (744)
T Consensus       500 l~~g~~tg~nP~~l~dt~~n~~fl~~~l~~l~~~~g~~~t~~~~~~I~~av~~~~~l~~~~r~ls~l~~~l~~~~~~~L~  579 (800)
T PRK13898        500 IEPRLKCNFNPLQLDDTPENRTFLMEWLKVLVTSNGESLTAQDIKRINDAVEGNFKLKKEDRRLSNLVAFLGIDGPNTLA  579 (800)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCCCCHHHH
T ss_conf             37998568687779998678899999999999737999999999999999999860892113265799873548846899


Q ss_pred             HHHHHHHCCCCC----C-C------------CCC-------------------------CCCCCEEEEEHHHHHHHHHHC
Q ss_conf             988642026776----6-6------------543-------------------------233867999844568767531
Q gi|254780606|r  508 ERISTMYGEKPQ----G-C------------GDD-------------------------MRPMPYIVIIVDEMADLMMVA  545 (744)
Q Consensus       508 ~~~~~~~~~~~~----~-~------------~~~-------------------------~~~~p~ivvviDE~a~l~~~~  545 (744)
T Consensus       580 ~rL~~w~~~G~~g~~fDn~~D~l~~~~~~~~gfd~t~ll~~~~~~~pvl~Ylf~rie~~ldG~p-~ii~iDE~W~~l~--  656 (800)
T PRK13898        580 GRIAMWHGKGSHAAIFDNEEDLLDFQKARVFGFEMTELLKDPVSLAPVLLYLFHRISISLDGTP-SMIVLDEAWALID--  656 (800)
T ss_pred             HHHHHHHCCCCEEECCCCCCCCCCCCCCCEEEEECHHHCCCCHHHHHHHHHHHHHHHHHCCCCC-EEEEEECHHHHHC--
T ss_conf             9999986699805224897556686668089998467528820489999999999997528982-6999603366637--


Q ss_pred             CHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC----HHHHHHCCCCEEEEECCCHHH-CCHHCCCCCHH
Q ss_conf             0358999999999642013589998516544441----467885056305720368111-00326763168
Q gi|254780606|r  546 GKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI----TGTIKANFPIRISFQVTSKID-SRTILGEHGAE  611 (744)
Q Consensus       546 ~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi----~~~ik~n~~~ri~~~v~~~~d-sr~il~~~gae  611 (744)
T Consensus       657 ~~~f~~~i~~~lkt~RK~N~~vv~aTQs~~-d~~~s~i~~~iieq~~T~I~LPN~~A~~~y~~~f~Lt~~E  726 (800)
T PRK13898        657 NPVFAPKIKDWLKVLRKLNTFVIFATQSVE-DASKSAISDTLVQQTATQIFLPNLKATDIYRSVFMLSERE  726 (800)
T ss_pred             CHHHHHHHHHHHHHHHHCCCEEEEEECCHH-HHHCCCHHHHHHHHCCEEEECCCCCCHHHHHHHCCCCHHH
T ss_conf             999999999999999873977999808899-9862846899998688579887811009999865999999