HHsearch alignment for GI: 254780606 and conserved domain: TIGR01448

>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. .
Probab=91.02  E-value=0.98  Score=24.02  Aligned_cols=223  Identities=19%  Similarity=0.205  Sum_probs=104.5

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC--CCCCCEEEEEEECHHHHHHHHHH
Q ss_conf             1120114846997078753447999999999985680110799972342100012--57752000044441787689999
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY--DGIPHLLTPVVTNPKKAVMALKW  483 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~--~~~ph~~~~v~~~~~~~~~~l~~  483 (744)
T Consensus       359 L~~~~~~Kv~iLTGGPGTGKtT~t~~i~~~~~~~~gl~-l-----~-----~~~~vndd~~---v~LaAPTGrAAkRl~E  424 (769)
T TIGR01448       359 LKTAIQDKVVILTGGPGTGKTTITKAIIELYEELKGLD-L-----D-----KDDYVNDDLP---VVLAAPTGRAAKRLAE  424 (769)
T ss_pred             HHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCC-C-----C-----CCCCCCCCCE---EEEECCCHHHHHHCCC
T ss_conf             99986094899857788861689999999998716877-5-----5-----3124567764---8873774378885110


Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCC-CCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHC
Q ss_conf             998667699999980778679999988642026776665-4323386799984456876753103589999999996420
Q gi|254780606|r  484 AVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCG-DDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARA  562 (744)
Q Consensus       484 ~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~-~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra  562 (744)
T Consensus       425 ~TG~~a~TIH--RLl------G~~~~--------~~~~~k~~~~~~~~DL~IvDE~S--M~D---t--~L~~~lL~-a~P  480 (769)
T TIGR01448       425 VTGLEALTIH--RLL------GYGSD--------TKSENKNLEDPIDADLLIVDESS--MVD---T--WLASSLLA-AVP  480 (769)
T ss_pred             CCCCHHHHHH--HHH------CCCCC--------CCCCCHHHCCCCCCCEEEEECCC--HHH---H--HHHHHHHH-HCC
T ss_conf             0262123477--863------68988--------87321101134787769981462--188---9--99999986-179


Q ss_pred             CEEEEEE---EECCCCCC---CCHHHHHHCCCCEEEEE-C-CCHHHCCHHCCCCCH--------HHHCCCCCEEEEC-CC
Q ss_conf             1358999---85165444---41467885056305720-3-681110032676316--------8856898468646-89
Q gi|254780606|r  563 AGIHLIM---ATQRPSVD---VITGTIKANFPIRISFQ-V-TSKIDSRTILGEHGA--------EQLLGRGDMLYMS-GG  625 (744)
Q Consensus       563 ~Gihlil---atQrp~~~---vi~~~ik~n~~~ri~~~-v-~~~~dsr~il~~~ga--------e~l~g~gd~l~~~-~~  625 (744)
T Consensus       481 ~~a~lllVGD~DQLPSV~pG~VL~DLi~s~~iP~~~LT~vyRQ~~~S~Ii~~Ah~~~~G~~Pvlnss~~~~Df~~~~~~~  560 (769)
T TIGR01448       481 DHARLLLVGDADQLPSVGPGQVLKDLIQSKVIPVTRLTKVYRQAEGSSIITLAHKILQGEAPVLNSSSAKKDFKFLKLDR  560 (769)
T ss_pred             CCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCEEECCCEEEECCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             77779888376888988644089999846886612121112411366467888987317887523244676677776400


Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             8438999343898899999999984088753111124555544
Q gi|254780606|r  626 GRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDK  668 (744)
Q Consensus       626 ~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  668 (744)
T Consensus       561 s~~e~~~~~i--~~~v~~~~~~a~~~Gi~~~dIQVLaPM~kG~  601 (769)
T TIGR01448       561 SEPEEAAKHI--PLMVEKIVGAAKKKGIPGADIQVLAPMYKGE  601 (769)
T ss_pred             CCHHHHHHHH--HHHHHHHHHHHHHCCCCCCEEEECCCCCCCC
T ss_conf             1010666789--9999887789871798600001525898984