HHsearch alignment for GI: 254780606 and conserved domain: cd03230

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.94  E-value=0.29  Score=27.69  Aligned_cols=39  Identities=26%  Similarity=0.405  Sum_probs=25.3

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             1120114846997078753447999999999985680110799
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
T Consensus        20 sl~i~~Gei~gl~G~NGaGKSTLl~~-i~Gl~---~p~~G~i~   58 (173)
T cd03230          20 SLTVEKGEIYGLLGPNGAGKTTLIKI-ILGLL---KPDSGEIK   58 (173)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEE
T ss_conf             87887993999987899799999999-97685---77878899