HHsearch alignment for GI: 254780606 and conserved domain: cd03283

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=96.76  E-value=0.021  Score=35.45  Aligned_cols=119  Identities=17%  Similarity=0.184  Sum_probs=67.2

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100012577520000444417876899999986676999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYR  493 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~  493 (744)
T Consensus        27 ~~iiTGpN~~GKSt~Lk~i~l~~ilaq~G---~~--vpa~~~~~~-~~~---i~t~-i~~~d~~~~~~S~F~~E~~~~~~   96 (199)
T cd03283          27 GILITGSNMSGKSTFLRTIGVNVILAQAG---AP--VCASSFELP-PVK---IFTS-IRVSDDLRDGISYFYAELRRLKE   96 (199)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHC---CE--EEHHHEEEC-CCE---EEEE-EECCCHHHCCCCHHHHHHHHHHH
T ss_conf             89998999986599999999999999968---93--862447823-308---9999-83475122453579999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHH----HHHHHHHHHCCEEEEEE
Q ss_conf             99980778679999988642026776665432338679998445687675310358999----99999964201358999
Q gi|254780606|r  494 KMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGA----IQRLAQMARAAGIHLIM  569 (744)
Q Consensus       494 ~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~----~~~la~~~ra~Gihlil  569 (744)
T Consensus        97 il~~~~~---------------------------~~~sLvliDEl~~--GT~~~eg~a~a~a~le~l~~----~~~~~ii  143 (199)
T cd03283          97 IVEKAKK---------------------------GEPVLFLLDEIFK--GTNSRERQAASAAVLKFLKN----KNTIGII  143 (199)
T ss_pred             HHHHHCC---------------------------CCCEEEEECCCCC--CCCHHHHHHHHHHHHHHHHH----CCCEEEE
T ss_conf             9997248---------------------------9857996143247--99867899999999999986----7987999


Q ss_pred             EECCCC
Q ss_conf             851654
Q gi|254780606|r  570 ATQRPS  575 (744)
Q Consensus       570 atQrp~  575 (744)
T Consensus       144 tTH~~~  149 (199)
T cd03283         144 STHDLE  149 (199)
T ss_pred             ECCCHH
T ss_conf             887289