>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam

Probab=96.68 E-value=0.02 Score=35.69 Aligned_cols=123 Identities=15% Similarity=0.186 Sum_probs=70.8 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHH Q ss_conf 69970787534479999999999856801107999723421000125775200004444178768999999866769999 Q gi|254780606|r 415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRK 494 (744) Q Consensus 415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~ 494 (744) T Consensus 33 ~iiTGpN~sGKSt~Lk~igl~~ilaq~G~---~v--pA~~a~i~~~d~I---~t-~i~~~d~i~~~~StF~~e~~~~~~i 103 (216) T cd03284 33 LLITGPNMAGKSTYLRQVALIALLAQIGS---FV--PASKAEIGVVDRI---FT-RIGASDDLAGGRSTFMVEMVETANI 103 (216) T ss_pred EEEECCCCCCHHHHHHHHHHHHHHHHHCC---EE--EECCEEEEECCEE---EE-EECCCCHHHCCCCHHHHHHHHHHHH T ss_conf 99989987745999999999999998687---58--7661599704469---99-5068621333726589999999999 Q ss_pred HHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHH-HHHHHHHHCCEEEEEEEECC Q ss_conf 99807786799999886420267766654323386799984456876753103589999-99999642013589998516 Q gi|254780606|r 495 MSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAI-QRLAQMARAAGIHLIMATQR 573 (744) Q Consensus 495 ~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~-~~la~~~ra~GihlilatQr 573 (744) T Consensus 104 l~~a~-----------------------------~~sLvliDEl~~--gT~~~eg~ala~aile~L~~~~~~~~i~tTH~ 152 (216) T cd03284 104 LNNAT-----------------------------ERSLVLLDEIGR--GTSTYDGLSIAWAIVEYLHEKIGAKTLFATHY 152 (216) T ss_pred HHHCC-----------------------------CCCEEEECCCCC--CCCHHHHHHHHHHHHHHHHHCCCCEEEEEECH T ss_conf 98487-----------------------------761563344568--99857889999999999997079728975050 Q ss_pred CCCC Q ss_conf 5444 Q gi|254780606|r 574 PSVD 577 (744) Q Consensus 574 p~~~ 577 (744) T Consensus 153 ~~L~ 156 (216) T cd03284 153 HELT 156 (216) T ss_pred HHHH T ss_conf 8899

HHsearch alignment for GI: 254780606 and conserved domain: cd03284