HHsearch alignment for GI: 254780606 and conserved domain: cd03288

>cd03288 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=92.94  E-value=0.17  Score=29.23  Aligned_cols=40  Identities=20%  Similarity=0.238  Sum_probs=27.0

Q ss_pred             EECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             2057887321120----1148469970787534479999999999
Q gi|254780606|r  397 GKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       397 g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
T Consensus        28 ~Y~~~~~~vL~~inl~I~~Ge~vaIvG~sGsGKSTL~~ll~-gl~   71 (257)
T cd03288          28 RYENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFF-RMV   71 (257)
T ss_pred             EECCCCCCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHH-HCC
T ss_conf             93989957310538998799999999999981999999996-056