HHsearch alignment for GI: 254780606 and conserved domain: cd03296

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.23  E-value=0.25  Score=28.08  Aligned_cols=160  Identities=17%  Similarity=0.259  Sum_probs=79.3

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC------------CEECCCCCCCCEEEEEEE
Q ss_conf             21120114846997078753447999999999985680110799972342------------100012577520000444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM------------LELSVYDGIPHLLTPVVT  472 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~------------~~~~~~~~~ph~~~~v~~  472 (744)
T Consensus        21 is~~v~~Ge~~~iiGpSGsGKSTll~~-i~Gl---~~p~~G~I~~~g-~~i~~~~~~~r~ig~vfQ~~~Lfp~l-----t   90 (239)
T cd03296          21 VSLDIPSGELVALLGPSGSGKTTLLRL-IAGL---ERPDSGTILFGG-EDATDVPVQERNVGFVFQHYALFRHM-----T   90 (239)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHH-HHCC---CCCCCEEEEECC-EECCCCCHHHCCEEEECCCCCCCCCC-----C
T ss_conf             386988998999999999779999999-9769---999863999999-99999996567767981782106799-----6


Q ss_pred             CHHHHHHHHHH-------HHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEH
Q ss_conf             41787689999-------99866769-99999807786799---------999886420267766654323386799984
Q gi|254780606|r  473 NPKKAVMALKW-------AVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIV  535 (744)
Q Consensus       473 ~~~~~~~~l~~-------~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvvi  535 (744)
T Consensus        91 V~eNi~~~l~~~~~~~~~~~~e~~~rv~~~l~~v~l~~~~~~~p~eLSGGq~QRVaiARAl---------~~~P~-vlll  160 (239)
T cd03296          91 VFDNVAFGLRVKPRSERPPEAEIRAKVHELLKLVQLDWLADRYPAQLSGGQRQRVALARAL---------AVEPK-VLLL  160 (239)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHH---------HCCCC-EEEE
T ss_conf             9999987997335456998999999999998654997677489666999898999999987---------64999-8997


Q ss_pred             HH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             45-687675310358999999999642013589998516544441467885056305720
Q gi|254780606|r  536 DE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       536 DE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
T Consensus       161 DEP~s~LD~---~~~~~i~~~l~~l~~e~~~T~i~vTHd~~-~a~------~laDri~vm  210 (239)
T cd03296         161 DEPFGALDA---KVRKELRRWLRRLHDELHVTTVFVTHDQE-EAL------EVADRVVVM  210 (239)
T ss_pred             CCCCCCCCH---HHHHHHHHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEEE
T ss_conf             388664699---99999999999999985998999988999-999------969999999