HHsearch alignment for GI: 254780606 and conserved domain: cd04153

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus. Arl5 is developmentally regulated during embryogenesis in mice. Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion. Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library. It is found in brain, heart, lung, cartilage, and kidney. No function has been assigned for Arl8 to date.
Probab=94.50  E-value=0.27  Score=27.88  Aligned_cols=32  Identities=13%  Similarity=0.379  Sum_probs=24.2

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCH
Q ss_conf             14846997078753447999999999985680
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRP  442 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p  442 (744)
T Consensus        14 k~~KililG~~~sGKTsil~~l~~~~~~~~~p   45 (174)
T cd04153          14 KEYKVIIVGLDNAGKTTILYQFLLGEVVHTSP   45 (174)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHCCCCCCCCC
T ss_conf             77999999899998899999997399277167