Query         gi|254780606|ref|YP_003065019.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 744
No_of_seqs    778 out of 3319
Neff          7.7 
Searched_HMMs 39220
Date          Mon May 30 06:14:21 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780606.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK10263 DNA translocase FtsK; 100.0       0       0 1357.9  46.9  476  263-741   861-1351(1355)
  2 COG1674 FtsK DNA segregation A 100.0       0       0  947.7  29.5  472  261-742   376-855 (858)
  3 pfam01580 FtsK_SpoIIIE FtsK/Sp 100.0       0       0  351.8  19.5  197  376-576     2-202 (202)
  4 smart00843 Ftsk_gamma This dom  99.9 3.1E-24 7.8E-29  185.2   3.9   63  679-741     1-63  (63)
  5 pfam09397 Ftsk_gamma Ftsk gamm  99.9 5.4E-24 1.4E-28  183.5   3.9   65  678-742     2-66  (67)
  6 COG1674 FtsK DNA segregation A  99.6 3.4E-16 8.6E-21  130.1   4.1  221  391-637   260-487 (858)
  7 PRK13873 conjugal transfer ATP  99.3 5.2E-08 1.3E-12   73.9  28.4  289  293-600   311-710 (815)
  8 PRK13830 conjugal transfer pro  99.3 5.1E-08 1.3E-12   74.0  24.9  338  294-651   324-793 (818)
  9 PRK13891 conjugal transfer pro  99.2 8.8E-08 2.2E-12   72.4  25.6  293  292-600   353-759 (852)
 10 PRK13853 type IV secretion sys  99.2 3.9E-08 9.9E-13   74.8  20.1  266  356-631   366-740 (789)
 11 pfam05872 DUF853 Bacterial pro  99.1 1.6E-08 4.1E-13   77.4  15.1  119  527-647   255-399 (504)
 12 PRK13898 type IV secretion sys  99.1 3.9E-08 9.9E-13   74.8  16.7  212  392-611   424-726 (800)
 13 cd01127 TrwB Bacterial conjuga  98.9 9.4E-09 2.4E-13   79.0   9.8  104  529-644   270-392 (410)
 14 COG3451 VirB4 Type IV secretor  98.9 4.3E-07 1.1E-11   67.7  16.4  219  386-611   407-719 (796)
 15 pfam10412 TrwB_AAD_bind Type I  98.8 2.4E-07   6E-12   69.4  12.2   69  530-604   244-318 (386)
 16 PRK13721 conjugal transfer ATP  98.4 4.5E-05 1.2E-09   53.8  15.3  124  530-654   685-836 (864)
 17 COG2401 ABC-type ATPase fused   98.2 1.1E-05 2.9E-10   57.9   9.1  163  394-575   387-569 (593)
 18 TIGR00929 VirB4_CagE type IV s  98.0 1.4E-05 3.7E-10   57.2   6.1  214  389-606   478-835 (931)
 19 pfam01935 DUF87 Domain of unkn  98.0   1E-05 2.6E-10   58.2   5.2   61  394-458     1-65  (218)
 20 PRK13900 type IV secretion sys  98.0 0.00093 2.4E-08   44.8  14.6  218  325-596    46-312 (332)
 21 PRK00411 cdc6 cell division co  97.9 3.6E-05 9.1E-10   54.5   6.7  268  411-730    54-358 (394)
 22 TIGR01420 pilT_fam twitching m  97.9 1.7E-05 4.3E-10   56.7   4.1  190  404-663   117-313 (350)
 23 TIGR02788 VirB11 P-type DNA tr  97.9 6.5E-05 1.7E-09   52.7   7.0  213  319-567    29-291 (328)
 24 PRK13700 conjugal transfer pro  97.8 2.1E-05 5.3E-10   56.1   4.3   71  528-604   417-493 (732)
 25 cd00984 DnaB_C DnaB helicase C  97.8 0.00013 3.3E-09   50.7   8.3  145  413-574    14-173 (242)
 26 smart00382 AAA ATPases associa  97.8 0.00014 3.7E-09   50.3   8.5  141  412-594     2-145 (148)
 27 TIGR02759 TraD_Ftype type IV c  97.8 3.3E-05 8.5E-10   54.7   4.8   55  400-458   196-250 (613)
 28 cd03243 ABC_MutS_homologs The   97.7  0.0007 1.8E-08   45.6  10.2  125  411-579    28-156 (202)
 29 COG2805 PilT Tfp pilus assembl  97.7 9.9E-05 2.5E-09   51.4   5.6  184  404-658   115-305 (353)
 30 cd01122 GP4d_helicase GP4d_hel  97.6  0.0002   5E-09   49.4   6.8  143  413-572    31-189 (271)
 31 PRK11131 ATP-dependent RNA hel  97.6 0.00088 2.2E-08   44.9   9.5   25  410-434    87-111 (1295)
 32 cd00009 AAA The AAA+ (ATPases   97.6  0.0011 2.8E-08   44.3   9.9   27  411-437    18-44  (151)
 33 cd01120 RecA-like_NTPases RecA  97.5  0.0034 8.5E-08   40.9  12.0  139  414-593     1-163 (165)
 34 TIGR03015 pepcterm_ATPase puta  97.5 0.00021 5.4E-09   49.2   5.8  143  412-596    43-188 (269)
 35 TIGR02782 TrbB_P P-type conjug  97.5 0.00012 3.1E-09   50.8   4.4  145  297-453    10-180 (315)
 36 pfam03796 DnaB_C DnaB-like hel  97.5  0.0013 3.2E-08   43.9   9.3  147  410-573    17-180 (186)
 37 pfam04665 Pox_A32 Poxvirus A32  97.4  0.0024   6E-08   42.0  10.0  150  408-597     8-159 (241)
 38 PRK13833 conjugal transfer pro  97.4 0.00016 4.2E-09   49.9   4.1  112  329-459    56-188 (323)
 39 COG0433 HerA helicase [Replica  97.4 0.00013 3.3E-09   50.6   3.5   73  531-605   393-466 (520)
 40 PRK13894 conjugal transfer ATP  97.4  0.0084 2.1E-07   38.2  12.5  140  297-454    27-190 (320)
 41 COG1643 HrpA HrpA-like helicas  97.4  0.0037 9.5E-08   40.6  10.7  191  409-650    62-281 (845)
 42 PRK11664 ATP-dependent RNA hel  97.4  0.0022 5.6E-08   42.2   9.5   76  572-649   484-570 (812)
 43 cd03280 ABC_MutS2 MutS2 homolo  97.3   0.006 1.5E-07   39.2  10.9  145  387-575     4-152 (200)
 44 PRK12402 replication factor C   97.3   0.001 2.6E-08   44.5   6.9   83  529-619   125-220 (337)
 45 smart00534 MUTSac ATPase domai  97.3   0.002 5.1E-08   42.5   8.0  121  415-575     2-123 (185)
 46 COG1205 Distinct helicase fami  97.2  0.0017 4.4E-08   43.0   7.5  113  412-564    85-230 (851)
 47 PRK04328 hypothetical protein;  97.2  0.0088 2.2E-07   38.1  10.5  138  411-575    23-175 (250)
 48 cd03286 ABC_MSH6_euk MutS6 hom  97.2  0.0095 2.4E-07   37.9  10.6  119  414-575    32-154 (218)
 49 cd01126 TraG_VirD4 The TraG/Tr  97.2 0.00048 1.2E-08   46.7   3.9   69  530-604   264-338 (384)
 50 pfam05621 TniB Bacterial TniB   97.1  0.0015 3.8E-08   43.4   6.3  222  410-735    59-296 (302)
 51 KOG0926 consensus               97.1  0.0021 5.4E-08   42.3   7.0  243  368-656   232-509 (1172)
 52 pfam00488 MutS_V MutS domain V  97.1  0.0081 2.1E-07   38.3   9.8  132  402-576    28-167 (234)
 53 PRK10436 hypothetical protein;  97.1 0.00089 2.3E-08   44.9   4.6  145  304-458    93-258 (461)
 54 PRK13851 type IV secretion sys  97.1 0.00048 1.2E-08   46.7   3.1   35  412-451   162-196 (343)
 55 cd03281 ABC_MSH5_euk MutS5 hom  97.0  0.0055 1.4E-07   39.5   8.4  121  415-576    32-156 (213)
 56 KOG2035 consensus               97.0   0.032 8.1E-07   34.3  12.7  154  410-602    32-190 (351)
 57 cd01130 VirB11-like_ATPase Typ  96.9  0.0011 2.7E-08   44.4   4.1   39  411-454    24-63  (186)
 58 CHL00081 chlI Mg-protoporyphyr  96.9  0.0021 5.4E-08   42.3   5.5  183  388-602     7-219 (347)
 59 COG1136 SalX ABC-type antimicr  96.9  0.0029 7.5E-08   41.3   6.2  152  406-576    25-205 (226)
 60 COG1474 CDC6 Cdc6-related prot  96.9  0.0012   3E-08   44.1   4.1  158  412-607    41-201 (366)
 61 cd03285 ABC_MSH2_euk MutS2 hom  96.9  0.0091 2.3E-07   38.0   8.7  119  415-576    33-155 (222)
 62 pfam02534 TraG TraG/TraD famil  96.9  0.0012   3E-08   44.1   4.0   61  530-596   303-369 (468)
 63 cd03282 ABC_MSH4_euk MutS4 hom  96.8   0.014 3.5E-07   36.7   9.1  128  414-589    31-162 (204)
 64 TIGR02746 TraC-F-type type-IV   96.8  0.0017 4.2E-08   43.0   4.2  107  529-641   734-847 (900)
 65 PRK08694 consensus              96.8   0.011 2.9E-07   37.3   8.4  151  409-574   215-380 (468)
 66 cd01131 PilT Pilus retraction   96.8  0.0031 7.8E-08   41.2   5.4   37  415-454     4-41  (198)
 67 cd03283 ABC_MutS-like MutS-lik  96.8   0.021 5.4E-07   35.5   9.5  119  414-575    27-149 (199)
 68 PRK09165 replicative DNA helic  96.7   0.015 3.8E-07   36.5   8.6  151  411-575   204-382 (484)
 69 cd03301 ABC_MalK_N The N-termi  96.7   0.014 3.6E-07   36.6   8.3  151  406-575    20-192 (213)
 70 COG5008 PilU Tfp pilus assembl  96.7  0.0058 1.5E-07   39.3   6.2  110  410-575   125-235 (375)
 71 KOG0922 consensus               96.7   0.019 4.8E-07   35.8   8.8   52  530-584   164-215 (674)
 72 cd03284 ABC_MutS1 MutS1 homolo  96.7    0.02   5E-07   35.7   8.9  123  415-577    33-156 (216)
 73 cd03299 ABC_ModC_like Archeal   96.7   0.011 2.7E-07   37.5   7.5  165  404-594    17-203 (235)
 74 PRK05595 replicative DNA helic  96.7   0.033 8.3E-07   34.2   9.9  150  408-574   197-361 (444)
 75 COG1122 CbiO ABC-type cobalt t  96.6  0.0021 5.4E-08   42.3   3.7  158  406-575    24-200 (235)
 76 PRK00440 rfc replication facto  96.6   0.006 1.5E-07   39.2   6.0  149  410-619    35-196 (318)
 77 PRK05636 replicative DNA helic  96.6   0.017 4.2E-07   36.2   8.2  150  409-575   264-428 (507)
 78 pfam06745 KaiC KaiC. This fami  96.6   0.039 9.9E-07   33.6  10.1   45  532-576   122-167 (231)
 79 cd01123 Rad51_DMC1_radA Rad51_  96.6   0.063 1.6E-06   32.2  12.5   40  415-454    22-63  (235)
 80 TIGR03608 L_ocin_972_ABC putat  96.6   0.015 3.9E-07   36.4   7.9  152  404-575    16-195 (206)
 81 TIGR02928 TIGR02928 orc1/cdc6   96.6   0.017 4.4E-07   36.1   8.2  276  413-736    44-373 (383)
 82 pfam05707 Zot Zonular occluden  96.6   0.003 7.7E-08   41.2   4.2   61  532-595    73-135 (183)
 83 COG4962 CpaF Flp pilus assembl  96.6  0.0026 6.7E-08   41.7   3.8  175  285-475    28-227 (355)
 84 cd03292 ABC_FtsE_transporter F  96.6   0.011 2.8E-07   37.4   6.9  153  405-575    20-197 (214)
 85 pfam10236 DAP3 Mitochondrial r  96.5   0.066 1.7E-06   32.1  10.7   69  414-486    25-95  (274)
 86 pfam00437 GSPII_E Type II/IV s  96.5   0.002   5E-08   42.5   2.8   40  412-455   139-179 (283)
 87 PRK08082 consensus              96.5   0.019 4.9E-07   35.7   7.9  151  408-575   199-365 (453)
 88 PRK06321 replicative DNA helic  96.5   0.038 9.7E-07   33.7   9.4  147  411-574   225-389 (472)
 89 PRK07004 replicative DNA helic  96.5   0.026 6.6E-07   34.9   8.5  150  409-574   210-374 (460)
 90 PHA00520 packaging NTPase P4    96.5    0.02 5.1E-07   35.6   7.8  124  400-575    97-234 (326)
 91 PRK11174 cysteine/glutathione   96.5   0.014 3.7E-07   36.6   7.1  156  401-575   361-545 (588)
 92 cd03258 ABC_MetN_methionine_tr  96.5   0.015 3.8E-07   36.5   7.1  164  405-594    24-214 (233)
 93 PRK08760 replicative DNA helic  96.5   0.028 7.1E-07   34.6   8.5  148  409-573   226-388 (476)
 94 TIGR03269 met_CoM_red_A2 methy  96.4   0.029 7.4E-07   34.5   8.4   33  404-437   302-334 (520)
 95 PRK13644 cbiO cobalt transport  96.4   0.022 5.5E-07   35.4   7.7  207  405-654    21-251 (274)
 96 PRK07263 consensus              96.4   0.034 8.8E-07   34.0   8.6  152  409-575   200-365 (453)
 97 smart00487 DEXDc DEAD-like hel  96.4   0.026 6.6E-07   34.9   8.0   38  413-452    25-62  (201)
 98 PRK06749 replicative DNA helic  96.4   0.039 9.9E-07   33.7   8.8  151  409-575   183-351 (428)
 99 PRK10938 putative molybdenum t  96.4   0.014 3.5E-07   36.8   6.5   30  405-435   279-308 (490)
100 PRK05748 replicative DNA helic  96.4   0.031   8E-07   34.3   8.3  150  409-574   200-365 (448)
101 cd03227 ABC_Class2 ABC-type Cl  96.4   0.013 3.4E-07   36.8   6.4   35  408-442    17-51  (162)
102 cd03287 ABC_MSH3_euk MutS3 hom  96.4   0.038 9.8E-07   33.7   8.7  134  414-591    33-167 (222)
103 PRK10875 recD exonuclease V su  96.3   0.068 1.7E-06   32.0   9.9  134  411-577   161-303 (607)
104 cd03300 ABC_PotA_N PotA is an   96.3   0.041   1E-06   33.5   8.6  165  403-594    17-204 (232)
105 pfam00004 AAA ATPase family as  96.3    0.07 1.8E-06   31.9   9.7   61  531-593    59-129 (131)
106 TIGR03600 phage_DnaB phage rep  96.3    0.03 7.8E-07   34.4   7.9  151  409-575   191-355 (421)
107 COG2804 PulE Type II secretory  96.3  0.0028 7.1E-08   41.5   2.6   86  365-458   214-301 (500)
108 COG1132 MdlB ABC-type multidru  96.3   0.048 1.2E-06   33.0   8.8   53  402-458   341-399 (567)
109 pfam05729 NACHT NACHT domain.   96.3   0.017 4.4E-07   36.0   6.6   34  414-447     2-35  (165)
110 PRK09112 DNA polymerase III su  96.3   0.031   8E-07   34.3   7.8  165  410-606    42-210 (352)
111 KOG0060 consensus               96.3   0.056 1.4E-06   32.6   9.1  155  400-577   445-630 (659)
112 PRK03992 proteasome-activating  96.2    0.11 2.8E-06   30.6  13.4  247  287-606    32-313 (390)
113 PRK11432 fbpC ferric transport  96.2    0.06 1.5E-06   32.4   8.9  165  392-575    12-198 (351)
114 COG3839 MalK ABC-type sugar tr  96.2   0.016 4.1E-07   36.2   5.9  160  405-595    22-208 (338)
115 PRK09493 glnQ glutamine ABC tr  96.2   0.038 9.8E-07   33.7   7.8   52  392-447     7-58  (240)
116 TIGR00929 VirB4_CagE type IV s  96.2    0.01 2.6E-07   37.6   4.9   31  683-713   634-670 (931)
117 TIGR01842 type_I_sec_PrtD type  96.1  0.0093 2.4E-07   37.9   4.6  150  411-575   355-527 (556)
118 TIGR03258 PhnT 2-aminoethylpho  96.1   0.013 3.2E-07   37.0   5.2  162  406-593    25-211 (362)
119 TIGR02673 FtsE cell division A  96.1   0.037 9.5E-07   33.8   7.6  164  405-592    21-209 (215)
120 COG3840 ThiQ ABC-type thiamine  96.1  0.0098 2.5E-07   37.8   4.6  176  402-598    13-207 (231)
121 PRK09361 radB DNA repair and r  96.1   0.084 2.1E-06   31.4   9.3   39  411-453    22-60  (224)
122 PRK10247 putative ABC transpor  96.1   0.046 1.2E-06   33.2   7.9  154  401-575    18-199 (225)
123 PRK13632 cbiO cobalt transport  96.1   0.058 1.5E-06   32.5   8.4  190  404-622    28-239 (273)
124 PRK09452 potA putrescine/sperm  96.1   0.063 1.6E-06   32.2   8.5  162  405-593    36-220 (378)
125 cd01393 recA_like RecA is a  b  96.1    0.13 3.2E-06   30.2  11.7   40  414-453    21-62  (226)
126 PRK08840 replicative DNA helic  96.1   0.039   1E-06   33.6   7.5  147  409-572   214-377 (464)
127 PRK13767 ATP-dependent helicas  96.1   0.048 1.2E-06   33.0   7.9   12  697-708   739-750 (878)
128 PRK13538 cytochrome c biogenes  96.0   0.091 2.3E-06   31.1   9.3   47  398-448     9-59  (204)
129 pfam07693 KAP_NTPase KAP famil  96.0   0.043 1.1E-06   33.3   7.6   88  530-648   161-248 (301)
130 cd03295 ABC_OpuCA_Osmoprotecti  96.0  0.0049 1.3E-07   39.8   2.8  163  404-594    19-209 (242)
131 PRK13897 type IV secretion sys  96.0  0.0026 6.6E-08   41.7   1.3   66  531-602   407-478 (628)
132 pfam05970 DUF889 PIF1 helicase  96.0  0.0091 2.3E-07   38.0   4.1   41  531-575    76-126 (418)
133 PRK10908 cell division protein  96.0   0.035   9E-07   33.9   7.0  155  402-575    14-198 (222)
134 COG0419 SbcC ATPase involved i  96.0   0.015 3.8E-07   36.5   5.1   39  403-441    16-54  (908)
135 PRK10789 putative multidrug tr  96.0   0.047 1.2E-06   33.0   7.6  158  401-575   326-511 (569)
136 COG1126 GlnQ ABC-type polar am  96.0    0.07 1.8E-06   31.9   8.4  161  407-594    23-209 (240)
137 PRK13407 bchI magnesium chelat  95.9  0.0046 1.2E-07   40.0   2.3   62  531-596   130-202 (334)
138 cd03289 ABCC_CFTR2 The CFTR su  95.9   0.043 1.1E-06   33.3   7.2  195  396-620    10-230 (275)
139 PRK10744 phosphate transporter  95.9    0.11 2.9E-06   30.4   9.4   44  392-436    16-59  (257)
140 COG4618 ArpD ABC-type protease  95.9   0.018 4.6E-07   35.9   5.3  158  403-575   349-533 (580)
141 PRK08506 replicative DNA helic  95.9   0.074 1.9E-06   31.7   8.3  148  409-573   190-352 (473)
142 cd03262 ABC_HisP_GlnQ_permease  95.9    0.01 2.6E-07   37.6   3.9  148  405-575    19-196 (213)
143 TIGR02533 type_II_gspE general  95.8  0.0029 7.5E-08   41.3   1.0  228  352-645   185-452 (495)
144 PRK13657 cyclic beta-1,2-gluca  95.8   0.034 8.7E-07   34.0   6.3   52  405-458   354-405 (585)
145 cd00046 DEXDc DEAD-like helica  95.8     0.1 2.6E-06   30.8   8.7   39  413-453     1-39  (144)
146 pfam00735 Septin Septin. Membe  95.8  0.0066 1.7E-07   38.9   2.6   27  414-440     6-32  (280)
147 cd03255 ABC_MJ0796_Lo1CDE_FtsE  95.8   0.028 7.1E-07   34.6   5.7  163  405-593    23-212 (218)
148 COG1223 Predicted ATPase (AAA+  95.8    0.07 1.8E-06   31.9   7.7   82  531-615   212-302 (368)
149 PTZ00301 uridine kinase; Provi  95.8   0.017 4.2E-07   36.2   4.5   38  415-452     6-43  (210)
150 TIGR03375 type_I_sec_LssB type  95.8   0.038 9.6E-07   33.8   6.3   62  396-459   471-536 (694)
151 PRK11124 artP arginine transpo  95.7   0.087 2.2E-06   31.2   8.2   54  392-449     8-61  (242)
152 PRK13633 cobalt transporter AT  95.7   0.017 4.2E-07   36.2   4.4  206  405-653    30-261 (281)
153 cd03270 ABC_UvrA_I The excisio  95.7   0.068 1.7E-06   32.0   7.5   29  405-433    14-42  (226)
154 PRK13546 teichoic acids export  95.7   0.098 2.5E-06   30.9   8.3   38  406-447    44-81  (264)
155 cd01394 radB RadB. The archaea  95.7     0.1 2.6E-06   30.8   8.4   38  412-453    19-56  (218)
156 PRK13641 cbiO cobalt transport  95.7   0.039   1E-06   33.6   6.3  206  405-653    26-261 (286)
157 PRK13647 cbiO cobalt transport  95.7    0.02 5.2E-07   35.6   4.7  154  405-575    24-199 (273)
158 PRK10418 nikD nickel transport  95.7   0.021 5.4E-07   35.5   4.8  157  402-575    15-202 (254)
159 pfam06414 Zeta_toxin Zeta toxi  95.7   0.082 2.1E-06   31.4   7.8   34  414-453    14-47  (191)
160 cd01124 KaiC KaiC is a circadi  95.7    0.18 4.6E-06   29.1  11.3   25  415-439     2-26  (187)
161 COG0470 HolB ATPase involved i  95.7   0.046 1.2E-06   33.1   6.5  170  411-621    22-195 (325)
162 cd01126 TraG_VirD4 The TraG/Tr  95.6   0.021 5.3E-07   35.5   4.6   35  414-454     1-35  (384)
163 KOG0924 consensus               95.6    0.15 3.8E-06   29.7   8.8  243  358-651   305-586 (1042)
164 PRK10419 nikE nickel transport  95.6    0.18 4.6E-06   29.0   9.3  156  405-575    31-213 (266)
165 cd01850 CDC_Septin CDC/Septin.  95.6  0.0051 1.3E-07   39.7   1.3   28  414-441     6-33  (276)
166 PRK11650 ugpC glycerol-3-phosp  95.6   0.038 9.7E-07   33.7   5.8  163  405-593    23-207 (358)
167 PRK08006 replicative DNA helic  95.6    0.14 3.7E-06   29.7   8.7  150  409-574   221-386 (471)
168 PRK06305 DNA polymerase III su  95.6    0.15 3.9E-06   29.5   8.9  145  410-600    36-184 (462)
169 COG1198 PriA Primosomal protei  95.5   0.066 1.7E-06   32.1   6.9  141  412-581   217-366 (730)
170 pfam02456 Adeno_IVa2 Adenoviru  95.5  0.0098 2.5E-07   37.7   2.7   40  409-448    83-123 (370)
171 TIGR02525 plasmid_TraJ plasmid  95.5  0.0068 1.7E-07   38.8   1.8   70  411-482   148-220 (374)
172 cd03249 ABC_MTABC3_MDL1_MDL2 M  95.5  0.0076 1.9E-07   38.5   2.1   51  402-456    15-71  (238)
173 PRK13651 cobalt transporter AT  95.5   0.015 3.7E-07   36.6   3.5  209  405-654    26-278 (304)
174 TIGR03265 PhnT2 putative 2-ami  95.5   0.032 8.3E-07   34.2   5.2  190  405-620    23-241 (353)
175 COG0433 HerA helicase [Replica  95.5   0.025 6.3E-07   35.0   4.6   63  393-459   144-211 (520)
176 cd03294 ABC_Pro_Gly_Bertaine T  95.5   0.057 1.5E-06   32.5   6.4  169  388-575    26-222 (269)
177 PRK12337 2-phosphoglycerate ki  95.5   0.055 1.4E-06   32.6   6.3  281  327-723   198-489 (492)
178 PRK10584 putative ABC transpor  95.5   0.079   2E-06   31.5   7.1   41  405-449    29-69  (228)
179 PRK09984 phosphonate/organopho  95.5    0.14 3.5E-06   29.9   8.3  159  403-575    21-214 (262)
180 PRK13635 cbiO cobalt transport  95.5   0.017 4.4E-07   36.1   3.7  212  405-655    26-258 (279)
181 PRK13637 cbiO cobalt transport  95.5   0.017 4.5E-07   36.0   3.7  208  405-653    26-261 (287)
182 cd03261 ABC_Org_Solvent_Resist  95.5   0.085 2.2E-06   31.3   7.2  152  405-575    19-198 (235)
183 cd03245 ABCC_bacteriocin_expor  95.4   0.026 6.6E-07   34.9   4.5   58  396-455    10-71  (220)
184 PRK11614 livF leucine/isoleuci  95.4    0.22 5.5E-06   28.5   9.9   53  392-448    11-63  (237)
185 KOG1514 consensus               95.4    0.12 3.1E-06   30.3   7.9  158  414-607   424-587 (767)
186 PRK13643 cbiO cobalt transport  95.4    0.12 3.1E-06   30.3   7.9  208  405-656    25-263 (288)
187 PRK11300 livG leucine/isoleuci  95.3    0.18 4.6E-06   29.0   8.6   41  405-447    24-64  (255)
188 cd04104 p47_IIGP_like p47 (47-  95.3   0.011 2.9E-07   37.3   2.4   20  414-433     3-22  (197)
189 cd03228 ABCC_MRP_Like The MRP   95.3   0.068 1.7E-06   32.0   6.3   40  406-449    22-61  (171)
190 PRK10535 macrolide transporter  95.3   0.013 3.4E-07   36.9   2.7  153  405-575    27-205 (648)
191 PRK11248 tauB taurine transpor  95.3    0.13 3.3E-06   30.0   7.8  156  401-575    12-190 (255)
192 PRK06904 replicative DNA helic  95.3    0.19 4.7E-06   29.0   8.5  148  409-572   218-382 (472)
193 cd01128 rho_factor Transcripti  95.3    0.24 6.2E-06   28.2  13.2   53  408-460    12-64  (249)
194 PRK10261 glutathione transport  95.3    0.18 4.7E-06   29.0   8.5   33  404-437   342-374 (623)
195 PRK10790 putative multidrug tr  95.3   0.052 1.3E-06   32.8   5.6   54  402-457   353-410 (593)
196 cd03296 ABC_CysA_sulfate_impor  95.2    0.25 6.4E-06   28.1  10.8  160  405-594    21-210 (239)
197 cd03246 ABCC_Protease_Secretio  95.2   0.046 1.2E-06   33.2   5.2  138  402-575    14-157 (173)
198 PRK06995 flhF flagellar biosyn  95.2    0.13 3.2E-06   30.1   7.4  145  416-606   180-328 (404)
199 cd01129 PulE-GspE PulE/GspE Th  95.2   0.034 8.6E-07   34.1   4.5   56  396-455    62-120 (264)
200 PRK09473 oppD oligopeptide tra  95.2    0.24 6.2E-06   28.2   8.9  183  405-608    35-253 (330)
201 KOG0735 consensus               95.2  0.0088 2.2E-07   38.1   1.5   55  409-466   428-482 (952)
202 PRK10619 histidine/lysine/argi  95.2    0.22 5.7E-06   28.5   8.6   41  405-449    24-64  (257)
203 cd03224 ABC_TM1139_LivF_branch  95.1    0.11 2.9E-06   30.4   7.1   45  401-449    11-59  (222)
204 PRK09751 putative ATP-dependen  95.1    0.15 3.7E-06   29.7   7.6   50  680-729   972-1021(1490)
205 TIGR03499 FlhF flagellar biosy  95.1   0.051 1.3E-06   32.8   5.3   68  415-482   197-268 (282)
206 COG5271 MDN1 AAA ATPase contai  95.1   0.047 1.2E-06   33.1   5.1   19  551-569  4511-4529(4600)
207 cd03369 ABCC_NFT1 Domain 2 of   95.1   0.074 1.9E-06   31.7   6.1   32  405-437    27-58  (207)
208 PRK11000 maltose/maltodextrin   95.1   0.038 9.8E-07   33.7   4.6  153  403-575    20-195 (369)
209 PRK13645 cbiO cobalt transport  95.1    0.22 5.5E-06   28.5   8.4  207  407-654    32-268 (289)
210 PRK05703 flhF flagellar biosyn  95.1   0.068 1.7E-06   32.0   5.8   68  415-482   213-284 (412)
211 PRK06526 transposase; Provisio  95.1    0.28 7.1E-06   27.8   9.9   27  412-438    98-124 (254)
212 cd03233 ABC_PDR_domain1 The pl  95.1    0.17 4.4E-06   29.2   7.8   45  392-437     9-57  (202)
213 PRK13636 cbiO cobalt transport  95.1   0.036 9.1E-07   33.9   4.3  207  405-651    25-256 (285)
214 COG4148 ModC ABC-type molybdat  95.1    0.11 2.7E-06   30.6   6.7  139  415-573    27-188 (352)
215 COG4167 SapF ABC-type antimicr  95.0    0.24   6E-06   28.3   8.4  155  403-574    30-210 (267)
216 COG3842 PotA ABC-type spermidi  95.0   0.031 7.8E-07   34.3   3.9  154  402-575    17-198 (352)
217 PRK10070 glycine betaine trans  95.0    0.15 3.8E-06   29.6   7.4  153  403-575    45-226 (400)
218 PRK13542 consensus              95.0    0.29 7.4E-06   27.7  10.0   49  396-448    24-76  (224)
219 PRK06067 flagellar accessory p  95.0    0.11 2.9E-06   30.5   6.7   39  411-451    31-69  (241)
220 cd03298 ABC_ThiQ_thiamine_tran  95.0   0.047 1.2E-06   33.1   4.8  146  408-575    20-190 (211)
221 PRK11629 lolD lipoprotein tran  95.0   0.084 2.1E-06   31.4   6.0   41  405-449    28-68  (233)
222 PRK13646 cbiO cobalt transport  95.0    0.13 3.3E-06   30.0   7.0  189  406-621    27-241 (286)
223 TIGR03415 ABC_choXWV_ATP choli  95.0   0.023   6E-07   35.2   3.2  163  403-594    41-238 (382)
224 TIGR00618 sbcc exonuclease Sbc  95.0   0.028 7.2E-07   34.6   3.6   42  398-440    11-57  (1063)
225 PRK13652 cbiO cobalt transport  95.0   0.026 6.7E-07   34.8   3.4  217  406-655    24-256 (277)
226 pfam00270 DEAD DEAD/DEAH box h  94.9   0.077   2E-06   31.6   5.7   43  411-453    13-55  (167)
227 cd00267 ABC_ATPase ABC (ATP-bi  94.9   0.086 2.2E-06   31.3   6.0  123  403-575    16-141 (157)
228 PRK13640 cbiO cobalt transport  94.9   0.033 8.3E-07   34.2   3.8  204  408-654    30-261 (283)
229 TIGR02324 CP_lyasePhnL phospho  94.9   0.017 4.2E-07   36.2   2.3   51  389-450    18-68  (224)
230 cd03248 ABCC_TAP TAP, the Tran  94.9   0.023 5.8E-07   35.2   3.0   30  407-437    35-64  (226)
231 TIGR01271 CFTR_protein cystic   94.9   0.018 4.7E-07   35.9   2.4  190  394-630  1264-1472(1534)
232 TIGR01447 recD exodeoxyribonuc  94.9    0.31   8E-06   27.4   9.6  126  393-539   216-359 (753)
233 PRK13342 recombination factor   94.9    0.31 7.9E-06   27.4   8.7   68  530-606    93-161 (417)
234 COG3596 Predicted GTPase [Gene  94.9   0.018 4.7E-07   35.9   2.4   24  414-437    41-64  (296)
235 PRK08233 hypothetical protein;  94.9   0.021 5.5E-07   35.4   2.7   22  415-436     6-27  (182)
236 PRK11176 lipid transporter ATP  94.9    0.11 2.8E-06   30.6   6.4   57  401-459   353-413 (581)
237 PRK11160 cysteine/glutathione   94.8   0.096 2.4E-06   31.0   6.0   62  404-469   359-429 (575)
238 TIGR02524 dot_icm_DotB Dot/Icm  94.8   0.027 6.9E-07   34.7   3.2  126  304-465    58-184 (358)
239 cd03252 ABCC_Hemolysin The ABC  94.8   0.047 1.2E-06   33.0   4.4   57  398-456    10-70  (237)
240 PRK13650 cbiO cobalt transport  94.8   0.034 8.7E-07   34.0   3.6  207  406-654    24-254 (276)
241 PRK12727 flagellar biosynthesi  94.7     0.3 7.7E-06   27.5   8.3  191  414-655   350-548 (557)
242 KOG0733 consensus               94.7    0.13 3.4E-06   30.0   6.5   13  563-575   646-658 (802)
243 pfam04157 EAP30 EAP30/Vps36 fa  94.7   0.086 2.2E-06   31.3   5.5   91  630-727   124-216 (219)
244 COG1239 ChlI Mg-chelatase subu  94.7   0.024 6.1E-07   35.1   2.7   79  530-612   145-234 (423)
245 PRK11607 potG putrescine trans  94.7    0.11 2.7E-06   30.6   5.9  187  405-620    38-256 (377)
246 PRK11247 ssuB aliphatic sulfon  94.7    0.32   8E-06   27.4   8.3  147  407-575    33-195 (257)
247 PRK05707 DNA polymerase III su  94.7    0.36 9.1E-06   27.1   9.1  155  409-606    18-175 (328)
248 pfam00308 Bac_DnaA Bacterial d  94.6    0.36 9.2E-06   27.0  11.5  111  414-581    36-146 (219)
249 cd03279 ABC_sbcCD SbcCD and ot  94.6   0.046 1.2E-06   33.1   3.9   44  399-443    12-58  (213)
250 COG1158 Rho Transcription term  94.6   0.041   1E-06   33.5   3.6  156  406-619   163-343 (422)
251 cd03291 ABCC_CFTR1 The CFTR su  94.6    0.03 7.6E-07   34.5   2.9   47  402-453    49-99  (282)
252 PRK13648 cbiO cobalt transport  94.6   0.066 1.7E-06   32.1   4.6  187  404-621    27-237 (269)
253 cd03297 ABC_ModC_molybdenum_tr  94.6   0.077   2E-06   31.6   4.9  139  415-575    26-193 (214)
254 PRK13539 cytochrome c biogenes  94.6    0.17 4.4E-06   29.2   6.7   49  398-450    10-62  (206)
255 PRK05580 primosome assembly pr  94.5    0.11 2.8E-06   30.6   5.7   20  560-579   314-333 (699)
256 cd04153 Arl5_Arl8 Arl5/Arl8 su  94.5    0.27 6.9E-06   27.9   7.6   32  411-442    14-45  (174)
257 PRK08058 DNA polymerase III su  94.4    0.29 7.5E-06   27.6   7.7  152  410-606    25-179 (329)
258 PRK13634 cbiO cobalt transport  94.4    0.04   1E-06   33.6   3.3  186  406-622    14-229 (276)
259 pfam07088 GvpD GvpD gas vesicl  94.4   0.068 1.7E-06   32.0   4.4   80  531-615   108-193 (484)
260 PRK11022 dppD dipeptide transp  94.4     0.4   1E-05   26.7   8.8  183  405-608    26-245 (327)
261 cd01125 repA Hexameric Replica  94.4    0.41 1.1E-05   26.6   9.0   45  531-575   113-160 (239)
262 PRK13639 cbiO cobalt transport  94.3   0.049 1.3E-06   32.9   3.5  205  407-653    23-253 (275)
263 PRK10851 sulfate/thiosulfate t  94.3    0.27 6.9E-06   27.9   7.3  152  405-575    21-198 (352)
264 PRK08181 transposase; Validate  94.3    0.43 1.1E-05   26.5   9.5   44  530-577   168-212 (269)
265 cd03213 ABCG_EPDR ABCG transpo  94.3   0.092 2.3E-06   31.1   4.8   36  401-437    20-59  (194)
266 PRK07399 DNA polymerase III su  94.3    0.17 4.4E-06   29.2   6.2  183  398-610     4-196 (314)
267 COG0464 SpoVK ATPases of the A  94.2    0.43 1.1E-05   26.5  10.2   74  531-606   337-420 (494)
268 cd02025 PanK Pantothenate kina  94.2   0.058 1.5E-06   32.4   3.8   36  415-451     2-38  (220)
269 cd03253 ABCC_ATM1_transporter   94.2   0.092 2.4E-06   31.1   4.8   43  401-447    12-58  (236)
270 PRK13649 cbiO cobalt transport  94.2   0.051 1.3E-06   32.9   3.4  208  405-655    26-263 (280)
271 PRK10575 iron-hydroxamate tran  94.2    0.43 1.1E-05   26.5   8.1   47  398-448    19-69  (265)
272 cd03225 ABC_cobalt_CbiO_domain  94.2    0.13 3.3E-06   30.0   5.4  153  405-575    20-195 (211)
273 TIGR02868 CydC ABC transporter  94.2    0.04   1E-06   33.6   2.8   64  404-471   379-451 (566)
274 cd01882 BMS1 Bms1.  Bms1 is an  94.1    0.36 9.1E-06   27.0   7.6   27  411-437    36-64  (225)
275 TIGR00174 miaA tRNA delta(2)-i  94.1    0.14 3.6E-06   29.8   5.5   68  415-489     2-82  (307)
276 PRK13541 cytochrome c biogenes  94.1    0.47 1.2E-05   26.3   9.1   36  410-449    24-59  (195)
277 KOG1384 consensus               94.1    0.47 1.2E-05   26.2   8.2   53  414-473     9-72  (348)
278 TIGR01073 pcrA ATP-dependent D  94.1    0.13 3.3E-06   30.0   5.3   31  410-441    16-46  (811)
279 PRK06893 DNA replication initi  94.1    0.13 3.4E-06   30.0   5.3   30  411-440    38-67  (229)
280 PRK11701 phnK phosphonates tra  94.1    0.47 1.2E-05   26.2  10.1   43  403-449    23-65  (258)
281 cd03256 ABC_PhnC_transporter A  94.0    0.19 4.9E-06   28.9   6.1  152  406-575    21-206 (241)
282 cd03220 ABC_KpsT_Wzt ABC_KpsT_  94.0    0.24 6.1E-06   28.2   6.5   44  405-453    41-84  (224)
283 COG3598 RepA RecA-family ATPas  94.0    0.49 1.2E-05   26.1  10.7  146  411-573    88-241 (402)
284 cd03293 ABC_NrtD_SsuB_transpor  94.0    0.29 7.5E-06   27.6   6.9  152  406-575    24-193 (220)
285 cd03257 ABC_NikE_OppD_transpor  94.0    0.23 5.9E-06   28.4   6.4   40  406-449    25-64  (228)
286 cd03230 ABC_DR_subfamily_A Thi  93.9    0.29 7.3E-06   27.7   6.8   39  406-448    20-58  (173)
287 cd03232 ABC_PDR_domain2 The pl  93.9    0.26 6.7E-06   28.0   6.6   32  402-433    19-54  (192)
288 cd03251 ABCC_MsbA MsbA is an e  93.9   0.087 2.2E-06   31.3   4.1   58  397-456     9-70  (234)
289 PRK11153 metN DL-methionine tr  93.9    0.19 4.8E-06   28.9   5.8  190  405-616    24-243 (343)
290 PRK00409 recombination and DNA  93.9    0.31 7.9E-06   27.5   6.9  158  414-610   327-485 (780)
291 TIGR02538 type_IV_pilB type IV  93.8    0.03 7.5E-07   34.5   1.6   99  336-443   237-354 (577)
292 PRK12608 transcription termina  93.8    0.53 1.3E-05   25.9   9.0   54  409-462   129-182 (379)
293 pfam08423 Rad51 Rad51. Rad51 i  93.8    0.53 1.4E-05   25.9   8.0   46  529-574   138-193 (261)
294 COG0444 DppD ABC-type dipeptid  93.7    0.54 1.4E-05   25.8   8.0  186  405-609    24-246 (316)
295 COG0630 VirB11 Type IV secreto  93.7    0.08 2.1E-06   31.5   3.7   40  409-453   140-179 (312)
296 COG3854 SpoIIIAA ncharacterize  93.7    0.22 5.6E-06   28.5   5.9   65  389-453   110-179 (308)
297 PRK06871 DNA polymerase III su  93.7    0.55 1.4E-05   25.8   9.2  191  410-649    20-216 (324)
298 PRK10938 putative molybdenum t  93.7    0.55 1.4E-05   25.8   8.9   45  392-437     9-53  (490)
299 KOG0951 consensus               93.7    0.03 7.5E-07   34.5   1.4   95  355-456   265-369 (1674)
300 PRK11144 modC molybdate transp  93.7    0.35   9E-06   27.1   6.9  150  407-575    19-190 (352)
301 pfam02572 CobA_CobO_BtuR ATP:c  93.6    0.56 1.4E-05   25.7   8.4  134  415-579     6-144 (172)
302 TIGR02211 LolD_lipo_ex lipopro  93.6   0.048 1.2E-06   33.0   2.4  168  385-575    11-203 (221)
303 PRK00091 miaA tRNA delta(2)-is  93.6    0.33 8.3E-06   27.3   6.6   67  410-484     2-79  (304)
304 TIGR01187 potA polyamine ABC t  93.6    0.17 4.3E-06   29.3   5.1  169  418-613     2-197 (331)
305 PRK09700 D-allose transporter   93.6    0.32 8.1E-06   27.4   6.5   33  403-436   280-312 (510)
306 TIGR01277 thiQ thiamine ABC tr  93.6    0.11 2.9E-06   30.5   4.2  162  400-579    10-193 (213)
307 TIGR01074 rep ATP-dependent DN  93.6    0.16   4E-06   29.5   4.9   66  571-651   264-335 (677)
308 cd03229 ABC_Class3 This class   93.5    0.25 6.3E-06   28.2   5.9  127  406-575    20-162 (178)
309 PRK11308 dppF dipeptide transp  93.5    0.27 6.8E-06   27.9   6.0   28  405-432    34-61  (327)
310 PRK13549 xylose transporter AT  93.5    0.59 1.5E-05   25.6   7.9   24  408-431   284-307 (513)
311 cd03226 ABC_cobalt_CbiO_domain  93.5    0.19 4.9E-06   28.9   5.3   33  404-437    18-50  (205)
312 PRK03918 chromosome segregatio  93.5   0.068 1.7E-06   32.0   2.9   21  416-436    27-47  (882)
313 PRK07270 DNA polymerase III su  93.5    0.48 1.2E-05   26.2   7.3   26  411-436    35-61  (557)
314 PRK13638 cbiO cobalt transport  93.4   0.069 1.8E-06   31.9   2.9   43  406-453    21-63  (271)
315 COG2274 SunT ABC-type bacterio  93.4    0.44 1.1E-05   26.4   7.0  164  392-575   477-669 (709)
316 KOG0345 consensus               93.4    0.62 1.6E-05   25.4   9.7  214  414-649    45-305 (567)
317 KOG0733 consensus               93.4    0.13 3.4E-06   30.0   4.3   88  531-621   284-385 (802)
318 PTZ00209 retrotransposon hot s  93.3    0.26 6.7E-06   28.0   5.8   54  411-465   172-225 (693)
319 PRK13642 cbiO cobalt transport  93.3   0.079   2E-06   31.5   3.1  208  404-653    25-256 (277)
320 cd03217 ABC_FeS_Assembly ABC-t  93.3    0.48 1.2E-05   26.1   7.1   47  401-449    11-61  (200)
321 PRK13768 GTPase; Provisional    93.3    0.47 1.2E-05   26.2   7.0   44  414-460     4-47  (253)
322 TIGR02142 modC_ABC molybdate A  93.3   0.067 1.7E-06   32.0   2.7  197  394-620    14-263 (361)
323 PRK06645 DNA polymerase III su  93.3    0.64 1.6E-05   25.3   9.3   26  411-436    41-67  (507)
324 pfam05049 IIGP Interferon-indu  93.3   0.063 1.6E-06   32.2   2.5   26  408-433    30-56  (375)
325 pfam01695 IstB IstB-like ATP b  93.3    0.64 1.6E-05   25.3  10.3   29  411-439    46-74  (178)
326 pfam05673 DUF815 Protein of un  93.2    0.12 3.1E-06   30.2   3.9   68  370-453    21-90  (248)
327 PRK02362 ski2-like helicase; P  93.2     0.6 1.5E-05   25.5   7.5   48  528-575   345-399 (736)
328 CHL00131 ycf16 sulfate ABC tra  93.2    0.57 1.5E-05   25.6   7.3   29  406-435    26-54  (252)
329 PRK09183 transposase/IS protei  93.2    0.66 1.7E-05   25.2  10.0   28  411-438   100-127 (258)
330 cd03271 ABC_UvrA_II The excisi  93.2    0.11 2.7E-06   30.6   3.6   34  405-438    14-47  (261)
331 PRK09302 circadian clock prote  93.2    0.66 1.7E-05   25.2  10.8  127  409-574   263-402 (501)
332 PRK04301 radA DNA repair and r  93.2    0.66 1.7E-05   25.2   8.6   46  529-574   199-254 (318)
333 COG4615 PvdE ABC-type sideroph  93.1   0.055 1.4E-06   32.6   2.0   42  404-449   341-382 (546)
334 pfam01637 Arch_ATPase Archaeal  93.1    0.68 1.7E-05   25.1   8.5   42  530-571   110-153 (223)
335 PRK07471 DNA polymerase III su  93.1    0.37 9.4E-06   26.9   6.2   70  529-606   139-208 (363)
336 PTZ00243 ABC transporter; Prov  93.0   0.088 2.2E-06   31.2   2.9   27  410-436   684-710 (1560)
337 COG1125 OpuBA ABC-type proline  93.0    0.37 9.5E-06   26.9   6.1  155  409-575    24-197 (309)
338 cd03240 ABC_Rad50 The catalyti  93.0    0.41   1E-05   26.7   6.3   24  412-435    22-45  (204)
339 TIGR02198 rfaE_dom_I rfaE bifu  93.0   0.059 1.5E-06   32.4   2.0  147  293-500    75-233 (321)
340 KOG0991 consensus               92.9   0.076 1.9E-06   31.7   2.5   41  398-438    27-74  (333)
341 cd03288 ABCC_SUR2 The SUR doma  92.9    0.17 4.4E-06   29.2   4.3   40  397-437    28-71  (257)
342 PRK05564 DNA polymerase III su  92.9    0.69 1.8E-05   25.1   7.4  138  410-605    23-161 (313)
343 PRK13548 hmuV hemin importer A  92.9     0.2   5E-06   28.8   4.6   50  401-452    13-66  (257)
344 pfam02562 PhoH PhoH-like prote  92.9    0.72 1.8E-05   24.9  10.0   43  409-453    16-58  (205)
345 PRK05642 DNA replication initi  92.9    0.24   6E-06   28.3   5.0   64  532-597   100-165 (234)
346 PRK10865 protein disaggregatio  92.9    0.18 4.6E-06   29.1   4.4   62  391-452   176-242 (857)
347 COG1116 TauB ABC-type nitrate/  92.9    0.71 1.8E-05   25.0   7.4  149  408-575    25-192 (248)
348 PRK09270 frcK putative fructos  92.8    0.14 3.6E-06   29.8   3.8   37  415-451    37-73  (230)
349 COG0467 RAD55 RecA-superfamily  92.8    0.74 1.9E-05   24.9  10.1  188  409-638    20-226 (260)
350 COG1204 Superfamily II helicas  92.8     0.4   1E-05   26.7   6.1   43  287-333    86-128 (766)
351 PRK07667 uridine kinase; Provi  92.7   0.091 2.3E-06   31.1   2.7   22  416-437    18-39  (190)
352 COG0714 MoxR-like ATPases [Gen  92.7    0.45 1.2E-05   26.3   6.2  199  396-651    27-250 (329)
353 pfam10443 RNA12 RNA12 protein.  92.7    0.58 1.5E-05   25.6   6.7   54  686-739   320-376 (428)
354 KOG2655 consensus               92.7   0.088 2.2E-06   31.2   2.5   27  414-440    23-49  (366)
355 PRK01172 ski2-like helicase; P  92.5    0.56 1.4E-05   25.7   6.5   33  552-584   353-389 (674)
356 COG3267 ExeA Type II secretory  92.5    0.82 2.1E-05   24.6   7.4   34  414-451    53-86  (269)
357 cd03114 ArgK-like The function  92.4    0.18 4.6E-06   29.1   3.9   37  415-453     2-38  (148)
358 cd00268 DEADc DEAD-box helicas  92.4    0.84 2.1E-05   24.5   9.6   40  414-453    38-78  (203)
359 cd03244 ABCC_MRP_domain2 Domai  92.3    0.12 3.1E-06   30.2   2.9   52  400-453    14-69  (221)
360 cd03290 ABCC_SUR1_N The SUR do  92.3    0.12 3.1E-06   30.2   2.9   36  401-437    12-51  (218)
361 cd03250 ABCC_MRP_domain1 Domai  92.3    0.12 2.9E-06   30.4   2.8   31  406-437    25-55  (204)
362 PRK11784 tRNA 2-selenouridine   92.3    0.08 2.1E-06   31.5   2.0   21  413-433   138-158 (333)
363 COG5019 CDC3 Septin family pro  92.3     0.1 2.7E-06   30.7   2.5   27  414-440    25-51  (373)
364 TIGR02982 heterocyst_DevA ABC   92.3    0.86 2.2E-05   24.4   9.9  168  391-575     6-203 (220)
365 cd03216 ABC_Carb_Monos_I This   92.3     0.5 1.3E-05   26.0   6.0   39  406-448    20-58  (163)
366 KOG0952 consensus               92.3    0.15 3.7E-06   29.7   3.2   56  531-586   240-298 (1230)
367 COG4178 ABC-type uncharacteriz  92.2    0.57 1.4E-05   25.7   6.2  153  401-579   404-579 (604)
368 PRK09435 arginine/ornithine tr  92.1    0.22 5.5E-06   28.5   4.0   37  415-453    52-88  (325)
369 pfam00580 UvrD-helicase UvrD/R  92.1    0.66 1.7E-05   25.2   6.4   14  530-543   213-226 (494)
370 PRK07429 phosphoribulokinase;   92.1    0.17 4.4E-06   29.2   3.4  213  415-654    11-280 (331)
371 TIGR01271 CFTR_protein cystic   92.1     0.1 2.6E-06   30.8   2.2  110  400-515   436-562 (1534)
372 PRK10982 galactose/methyl gala  92.1    0.78   2E-05   24.7   6.8   33  404-437   266-298 (491)
373 pfam03205 MobB Molybdopterin g  92.1    0.34 8.6E-06   27.2   4.9   46  413-459     1-46  (122)
374 cd02026 PRK Phosphoribulokinas  92.0    0.18 4.6E-06   29.1   3.5   33  415-451     2-34  (273)
375 pfam03308 ArgK ArgK protein. T  92.0    0.23 5.9E-06   28.3   4.1   38  414-453    31-68  (267)
376 TIGR01631 Trypano_RHS trypanos  92.0    0.72 1.8E-05   24.9   6.5   76  411-486   306-383 (814)
377 COG0178 UvrA Excinuclease ATPa  92.0    0.17 4.4E-06   29.2   3.3   29  413-441   628-656 (935)
378 PHA00350 putative assembly pro  92.0    0.11 2.9E-06   30.4   2.4   55  532-588    84-157 (402)
379 PRK13545 tagH teichoic acids e  92.0    0.88 2.2E-05   24.3   6.9  154  405-573    43-202 (549)
380 COG4987 CydC ABC-type transpor  91.9    0.12   3E-06   30.4   2.4   63  405-469   357-426 (573)
381 KOG0054 consensus               91.9    0.15 3.7E-06   29.7   2.9   30  407-436   542-571 (1381)
382 PRK11288 araG L-arabinose tran  91.9    0.95 2.4E-05   24.1   8.0   32  404-436   271-302 (501)
383 TIGR03167 tRNA_sel_U_synt tRNA  91.9    0.13 3.3E-06   30.1   2.6   24  412-435   127-150 (311)
384 cd03247 ABCC_cytochrome_bd The  91.9    0.14 3.7E-06   29.8   2.8   48  396-447     8-59  (178)
385 cd03254 ABCC_Glucan_exporter_l  91.9    0.15 3.7E-06   29.7   2.9   36  401-437    14-53  (229)
386 KOG0064 consensus               91.8    0.98 2.5E-05   24.0   8.6  150  399-575   491-670 (728)
387 PRK10522 multidrug transporter  91.8   0.088 2.2E-06   31.2   1.7   52  405-460   342-395 (547)
388 PRK05917 DNA polymerase III su  91.7    0.77   2E-05   24.7   6.4   35  410-444    16-51  (290)
389 PRK09580 sufC cysteine desulfu  91.7     0.2 5.1E-06   28.7   3.5   47  398-446     9-59  (248)
390 pfam03354 Terminase_1 Phage Te  91.7    0.99 2.5E-05   24.0   7.8  140  415-579    25-169 (473)
391 PRK13631 cbiO cobalt transport  91.7    0.15 3.9E-06   29.6   2.8  208  405-653    45-292 (320)
392 pfam00485 PRK Phosphoribulokin  91.7    0.17 4.4E-06   29.2   3.0   22  415-436     2-23  (196)
393 TIGR01166 cbiO cobalt ABC tran  91.7    0.36 9.1E-06   27.0   4.6  156  407-572    13-185 (190)
394 PRK07773 replicative DNA helic  91.6       1 2.6E-05   23.9   8.4   29  412-440   203-231 (868)
395 cd02024 NRK1 Nicotinamide ribo  91.6    0.15 3.7E-06   29.7   2.6   22  415-436     2-23  (187)
396 cd03231 ABC_CcmA_heme_exporter  91.6    0.21 5.5E-06   28.6   3.5   42  396-438     6-51  (201)
397 PRK01156 chromosome segregatio  91.6    0.17 4.3E-06   29.3   2.9   15  417-431    28-42  (895)
398 pfam10923 DUF2791 Protein of u  91.6    0.49 1.2E-05   26.1   5.3   97  470-571    33-138 (267)
399 pfam03266 DUF265 Protein of un  91.6       1 2.6E-05   23.9  11.0   24  414-437     1-24  (168)
400 COG0593 DnaA ATPase involved i  91.5    0.32 8.3E-06   27.3   4.3   28  412-439   113-140 (408)
401 cd03223 ABCD_peroxisomal_ALDP   91.5    0.17 4.4E-06   29.2   2.9   44  401-448    12-59  (166)
402 cd03260 ABC_PstB_phosphate_tra  91.5    0.33 8.5E-06   27.3   4.4  151  407-575    21-201 (227)
403 cd03115 SRP The signal recogni  91.5    0.54 1.4E-05   25.8   5.4   69  415-485     3-75  (173)
404 PRK13850 type IV secretion sys  91.4    0.96 2.4E-05   24.1   6.7  112  530-647   390-542 (670)
405 PRK08727 hypothetical protein;  91.4    0.59 1.5E-05   25.5   5.6   42  532-575    96-137 (233)
406 pfam09140 MipZ ATPase MipZ. Mi  91.4     0.6 1.5E-05   25.5   5.6   86  531-621   125-229 (261)
407 TIGR00630 uvra excinuclease AB  91.3    0.23 5.9E-06   28.3   3.4  122  357-508   625-759 (956)
408 cd00561 CobA_CobO_BtuR ATP:cor  91.2     1.1 2.8E-05   23.6   7.0  134  415-579     5-143 (159)
409 COG0324 MiaA tRNA delta(2)-iso  91.2    0.57 1.4E-05   25.7   5.3   73  411-490     2-87  (308)
410 PRK11264 putative amino-acid A  91.2    0.21 5.5E-06   28.6   3.1   41  405-449    20-60  (248)
411 PRK09694 hypothetical protein;  91.2     0.9 2.3E-05   24.3   6.3   76  491-575   408-483 (878)
412 PRK02224 chromosome segregatio  91.2    0.24 6.2E-06   28.2   3.4   23  414-436    25-47  (880)
413 PRK05986 cob(I)yrinic acid a,c  91.1     1.1 2.9E-05   23.6   8.7  134  414-579    24-162 (190)
414 pfam04317 DUF463 YcjX-like fam  91.1    0.19 4.8E-06   29.0   2.8   88  435-542   180-270 (443)
415 COG1201 Lhr Lhr-like helicases  91.1     1.1 2.9E-05   23.6   8.2   17  411-427    36-52  (814)
416 COG4988 CydD ABC-type transpor  91.1    0.39   1E-05   26.8   4.4   64  403-468   338-408 (559)
417 PRK10253 iron-enterobactin tra  91.1    0.22 5.7E-06   28.4   3.2   54  392-449    13-66  (265)
418 PRK11331 5-methylcytosine-spec  91.1     1.1 2.9E-05   23.6   7.1   51  403-453   185-235 (459)
419 PTZ00112 origin recognition co  91.1     0.1 2.6E-06   30.7   1.4  119  412-570   293-417 (650)
420 cd02023 UMPK Uridine monophosp  91.1    0.33 8.4E-06   27.3   4.0   22  415-436     2-23  (198)
421 PRK11819 putative ABC transpor  91.1    0.64 1.6E-05   25.3   5.5   40  405-448   343-382 (556)
422 COG4525 TauB ABC-type taurine   91.0    0.39 9.8E-06   26.8   4.3   44  405-453    24-67  (259)
423 TIGR01448 recD_rel helicase, R  91.0    0.98 2.5E-05   24.0   6.4  223  406-668   359-601 (769)
424 TIGR03185 DNA_S_dndD DNA sulfu  91.0    0.23 5.9E-06   28.3   3.2   24  413-436    29-52  (650)
425 PRK09376 rho transcription ter  91.0     1.2   3E-05   23.5   9.1  184  407-649   164-383 (416)
426 COG4598 HisP ABC-type histidin  90.9    0.14 3.6E-06   29.8   2.0   23  411-433    31-53  (256)
427 cd04154 Arl2 Arl2 subfamily.    90.9    0.69 1.8E-05   25.1   5.5   32  411-442    13-44  (173)
428 PRK09536 btuD corrinoid ABC tr  90.8     0.8   2E-05   24.6   5.8   53  392-448     8-60  (409)
429 TIGR01967 DEAH_box_HrpA ATP-de  90.7    0.13 3.2E-06   30.1   1.6   22  414-435    86-107 (1320)
430 PRK10636 putative ABC transpor  90.7    0.24 6.1E-06   28.2   3.0   40  404-447   330-369 (638)
431 cd03241 ABC_RecN RecN ATPase i  90.7    0.17 4.3E-06   29.3   2.2   32  414-445    23-54  (276)
432 PRK13543 cytochrome c biogenes  90.7     0.3 7.7E-06   27.5   3.5   49  396-448    17-69  (214)
433 pfam04851 ResIII Type III rest  90.6    0.46 1.2E-05   26.3   4.4   27  411-437    17-43  (103)
434 PRK06674 DNA polymerase III su  90.6    0.94 2.4E-05   24.2   6.0   93  336-451    52-156 (563)
435 PRK10869 recombination and rep  90.6    0.18 4.6E-06   29.1   2.3   33  618-650   413-445 (553)
436 COG4928 Predicted P-loop ATPas  90.6    0.51 1.3E-05   26.0   4.6   32  403-434    42-74  (646)
437 PRK13547 hmuV hemin importer A  90.5    0.26 6.5E-06   28.0   3.0   37  400-437    11-51  (273)
438 PRK00254 ski2-like helicase; P  90.4    0.56 1.4E-05   25.7   4.7   23  551-573   361-387 (717)
439 PRK08533 flagellar accessory p  90.4     1.3 3.4E-05   23.1   8.4   29  411-439    23-51  (230)
440 PRK12678 transcription termina  90.3     1.3 3.4E-05   23.1   9.1   53  409-461   408-460 (667)
441 cd03214 ABC_Iron-Siderophores_  90.2    0.33 8.5E-06   27.2   3.4   44  401-448    10-57  (180)
442 COG4619 ABC-type uncharacteriz  90.2    0.35 8.9E-06   27.1   3.5  144  407-575    24-195 (223)
443 PRK10733 hflB ATP-dependent me  90.2     1.4 3.5E-05   23.0   6.6   74  531-606   246-332 (644)
444 pfam00350 Dynamin_N Dynamin fa  90.1    0.21 5.4E-06   28.6   2.3   21  415-435     1-21  (168)
445 COG3638 ABC-type phosphate/pho  90.1    0.26 6.7E-06   28.0   2.8   32  403-434    21-52  (258)
446 COG1855 ATPase (PilT family) [  90.1    0.22 5.6E-06   28.5   2.4   27  411-437   262-288 (604)
447 PRK13764 ATPase; Provisional    90.1    0.36 9.3E-06   27.0   3.5   27  411-437   258-284 (605)
448 PRK11147 ABC transporter ATPas  90.1    0.29 7.3E-06   27.7   3.0   42  401-446   330-375 (632)
449 PRK09544 znuC high-affinity zi  90.0    0.33 8.3E-06   27.3   3.2   57  392-453    10-66  (251)
450 PRK11231 fecE iron-dicitrate t  90.0    0.32 8.2E-06   27.4   3.2   49  392-448     8-60  (255)
451 cd03236 ABC_RNaseL_inhibitor_d  90.0     0.6 1.5E-05   25.5   4.5   30  414-447    28-57  (255)
452 TIGR01184 ntrCD nitrate ABC tr  90.0     1.4 3.5E-05   23.0   6.4  145  410-573     9-174 (230)
453 cd03218 ABC_YhbG The ABC trans  90.0     1.4 3.6E-05   22.9   9.5   40  406-449    20-59  (232)
454 PRK13897 type IV secretion sys  89.9     0.6 1.5E-05   25.5   4.5   84  362-454   107-193 (628)
455 TIGR00972 3a0107s01c2 phosphat  89.9     0.2   5E-06   28.8   2.0   43  392-434     7-49  (248)
456 COG1660 Predicted P-loop-conta  89.8    0.26 6.6E-06   28.0   2.6   30  412-451     1-30  (286)
457 PRK05480 uridine kinase; Provi  89.8    0.49 1.3E-05   26.1   4.0   33  415-451     9-41  (209)
458 cd03268 ABC_BcrA_bacitracin_re  89.8     1.1 2.9E-05   23.6   5.8   44  407-452    21-64  (208)
459 cd03237 ABC_RNaseL_inhibitor_d  89.8     1.5 3.8E-05   22.8   8.8   37  414-455    27-63  (246)
460 CHL00095 clpC Clp protease ATP  89.8     1.1 2.8E-05   23.7   5.8   60  392-451   178-242 (823)
461 KOG0054 consensus               89.7    0.21 5.3E-06   28.7   2.0   47  412-460  1166-1212(1381)
462 COG0488 Uup ATPase components   89.7     1.4 3.7E-05   22.9   6.3   19  412-430    29-47  (530)
463 PRK11537 putative GTP-binding   89.7    0.44 1.1E-05   26.4   3.7  225  409-650     1-249 (317)
464 cd02028 UMPK_like Uridine mono  89.7    0.35 8.8E-06   27.1   3.1   23  415-437     2-24  (179)
465 KOG0057 consensus               89.7    0.37 9.5E-06   26.9   3.3   55  405-462   371-425 (591)
466 cd01133 F1-ATPase_beta F1 ATP   89.6     1.5 3.9E-05   22.7   8.5   52  407-459    64-115 (274)
467 PRK04220 2-phosphoglycerate ki  89.6    0.31   8E-06   27.4   2.8   17  412-428    91-108 (306)
468 PTZ00243 ABC transporter; Prov  89.5    0.24 6.2E-06   28.2   2.2   12  636-647  1410-1421(1560)
469 PRK08084 DNA replication initi  89.5       1 2.6E-05   24.0   5.4   64  532-597   100-166 (235)
470 COG1127 Ttg2A ABC-type transpo  89.5    0.32 8.2E-06   27.3   2.9   41  405-449    27-67  (263)
471 KOG1532 consensus               89.5    0.39   1E-05   26.7   3.3   45  411-457    18-62  (366)
472 COG0610 Type I site-specific r  89.4    0.12 3.1E-06   30.2   0.7   40  415-455   276-315 (962)
473 cd03235 ABC_Metallic_Cations A  89.4    0.43 1.1E-05   26.5   3.5   54  392-447     5-58  (213)
474 cd00878 Arf_Arl Arf (ADP-ribos  89.4    0.26 6.5E-06   28.0   2.3   23  415-437     2-24  (158)
475 TIGR03346 chaperone_ClpB ATP-d  89.4    0.62 1.6E-05   25.4   4.2   52  392-443   172-225 (852)
476 PRK06696 uridine kinase; Valid  89.4    0.54 1.4E-05   25.8   3.9   37  415-452    29-65  (227)
477 COG1703 ArgK Putative periplas  89.3    0.51 1.3E-05   26.0   3.8   37  415-453    54-90  (323)
478 TIGR03420 DnaA_homol_Hda DnaA   89.3    0.69 1.8E-05   25.1   4.4   44  532-577    93-136 (226)
479 cd03238 ABC_UvrA The excision   89.3    0.36 9.1E-06   27.0   3.0   29  405-433    14-42  (176)
480 PRK11147 ABC transporter ATPas  89.3    0.41   1E-05   26.6   3.3   18  413-430    30-47  (632)
481 TIGR00960 3a0501s02 Type II (G  89.3    0.31 7.9E-06   27.5   2.6  155  404-573    21-197 (216)
482 cd03266 ABC_NatA_sodium_export  89.3    0.54 1.4E-05   25.8   3.9   42  407-452    26-69  (218)
483 COG1123 ATPase components of v  89.3     1.6 4.1E-05   22.6  11.5  199  391-609    10-247 (539)
484 TIGR02315 ABC_phnC phosphonate  89.1    0.23 5.9E-06   28.3   1.9   35  410-445    26-60  (253)
485 pfam02492 cobW CobW/HypB/UreG,  89.0    0.72 1.8E-05   25.0   4.3   40  413-455     1-40  (174)
486 COG2874 FlaH Predicted ATPases  88.9     1.7 4.3E-05   22.4   7.4  149  414-597    30-192 (235)
487 PRK08903 hypothetical protein;  88.9     1.7 4.3E-05   22.4   6.2   24  413-436    43-66  (227)
488 PRK05563 DNA polymerase III su  88.9     1.6   4E-05   22.6   6.0  153  299-486    26-192 (541)
489 PRK10762 D-ribose transporter   88.8    0.45 1.2E-05   26.3   3.2   34  403-437   269-302 (501)
490 pfam03215 Rad17 Rad17 cell cyc  88.8     1.7 4.4E-05   22.3   6.4   30  423-452   142-171 (490)
491 PRK13540 cytochrome c biogenes  88.7    0.52 1.3E-05   25.9   3.4   48  396-447     7-58  (200)
492 TIGR02857 CydD ABC transporter  88.6    0.37 9.4E-06   26.9   2.6   35  411-449   377-411 (570)
493 COG4555 NatA ABC-type Na+ tran  88.6     1.8 4.5E-05   22.3   6.8   35  413-451    29-63  (245)
494 smart00763 AAA_PrkA PrkA AAA d  88.6     1.1 2.9E-05   23.6   5.1   39  415-453    81-119 (361)
495 PRK06217 hypothetical protein;  88.6    0.48 1.2E-05   26.2   3.2   25  412-436     1-25  (185)
496 PRK08118 topology modulation p  88.5    0.38 9.6E-06   26.9   2.6   23  412-434     1-23  (167)
497 TIGR03598 GTPase_YsxC ribosome  88.5     0.4   1E-05   26.7   2.7   24  411-434    17-40  (179)
498 COG0497 RecN ATPase involved i  88.5    0.32 8.2E-06   27.3   2.3   30  414-443    24-53  (557)
499 PRK10895 putative ABC transpor  88.4    0.55 1.4E-05   25.8   3.4   38  396-433     9-50  (241)
500 PRK10636 putative ABC transpor  88.4    0.42 1.1E-05   26.5   2.8   18  295-312   186-203 (638)

No 1  
>PRK10263 DNA translocase FtsK; Provisional
Probab=100.00  E-value=0  Score=1357.93  Aligned_cols=476  Identities=49%  Similarity=0.802  Sum_probs=444.0

Q ss_pred             CCCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             01122221134543101111110078899889999998740355138986764892589997548886399998599999
Q gi|254780606|r  263 QKQYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDI  342 (744)
Q Consensus       263 ~~~yelPp~~LL~~p~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~gp~~~~~~~~~~~g~~~~~~~~~~~d~  342 (744)
                      ++...+|+++||..++.. .+.++.+.|++++++||.+|.+|||+|+|+++++||+||||||+|++|||+|||+||++||
T Consensus       861 ~p~~~lp~l~ll~~~~~~-~~~~~~~~l~~~arl~E~~L~df~V~a~Vv~i~pGPvVTryEl~papGVKvsrI~~L~dDl  939 (1355)
T PRK10263        861 KPTTPLPSLDLLTPPPSE-VEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDL  939 (1355)
T ss_pred             CCCCCCCCHHHCCCCCCC-CCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             999999865424698413-5878899999999999998763394289998723986787654058985065531089999


Q ss_pred             HHHHCCCCCEE-EEECCCCEEEEECCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCEEEEECC
Q ss_conf             98714776327-75189834544268888870765875128121146783689842057887321120114846997078
Q gi|254780606|r  343 ARSMSSLSARV-AVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTT  421 (744)
Q Consensus       343 ~~~~~~~~~~~-~~~pg~~~~~~~~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~T  421 (744)
                      ||+|++.+||| +|||||++|||||||.+|++|+|||+|++..|++++++|+++|||||.|++++.||+|||||||||+|
T Consensus       940 A~aLsa~sVRI~apIPGK~~VGIEvPN~~r~~V~lrevl~s~~f~~~~s~L~~aLGKDI~G~pvv~DLaKMPHLLIAGtT 1019 (1355)
T PRK10263        940 ARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTT 1019 (1355)
T ss_pred             HHHHCCCCEEEEECCCCCCEEEEECCCCCCCEEEHHHHHCCHHHHCCCCCCEEEECCCCCCCEEEEEHHHCCCEEEECCC
T ss_conf             99722676069811699875568899898874755875558423227997426513666798877474219711340467


Q ss_pred             CCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             75344799999999998568011079997234210001257752000044441787689999998667699999980778
Q gi|254780606|r  422 GSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVR  501 (744)
Q Consensus       422 gsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~  501 (744)
                      |||||||||+||+||||+++|++|||+|||||++||+.|++||||+++||||+++|+.+|+|+|.||||||++|++.|||
T Consensus      1020 GSGKSV~iNsmI~SlLyk~~PdevrlImIDPKmvELs~Y~gIPHLL~PVVTDpkkA~~AL~W~V~EMErRY~l~a~~gVR 1099 (1355)
T PRK10263       1020 GSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVR 1099 (1355)
T ss_pred             CCCCHHHHHHHHHHHHHCCCHHHEEEEEECCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             88830439999999984388879479986687453146799973577673787999999999999999999999981998


Q ss_pred             CHHHHHHHHHHHHCCC-------------CCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             6799999886420267-------------766654323386799984456876753103589999999996420135899
Q gi|254780606|r  502 NIKSYNERISTMYGEK-------------PQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLI  568 (744)
Q Consensus       502 ~i~~~n~~~~~~~~~~-------------~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihli  568 (744)
                      ||.+||+|+.......             .......+++||||||||||||||||++++++|++|+||||||||+|||||
T Consensus      1100 NI~gYN~kv~~a~~~g~pi~dp~~~~~d~~~~~~p~leklPyIVViIDElADLMM~agkeVE~~I~RLAQkARAaGIHLI 1179 (1355)
T PRK10263       1100 NLAGYNEKIAEADRMMRPIPDPYWKPGDSMDAQHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLV 1179 (1355)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCHHHHCCCCHHHHHHHHHHHHHHHHHHCEEE
T ss_conf             87999999998775068777633467654334666557898699997336275362628799999999999998742378


Q ss_pred             EEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEEECC-CCCEEEEEECCCCHHHHHHHHHH
Q ss_conf             98516544441467885056305720368111003267631688568984686468-98438999343898899999999
Q gi|254780606|r  569 MATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSG-GGRIQRVHGPLVSDIEIEKVVQH  647 (744)
Q Consensus       569 latQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~~~~-~~~~~r~~~~~~~~~~~~~~~~~  647 (744)
                      |||||||+|||||+||||||+||||+|+|++|||||||+.|||+|||+|||||+++ +++++|+||+||||+||++||+|
T Consensus      1180 lATQRPSVDVITGlIKANiPtRIAF~VsSkiDSRTILD~~GAE~LLG~GDMLf~~pg~~~p~RvqGafVsD~EV~~VV~~ 1259 (1355)
T PRK10263       1180 LATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQD 1259 (1355)
T ss_pred             EECCCCCCCEECCCEECCCHHHHEECCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             72489986700462433432331000344566351078758888558976442379999841777786688999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             98408875311112455554444566777777766038999999997498623220000010078999999999987975
Q gi|254780606|r  648 LKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLV  727 (744)
Q Consensus       648 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~s~~qr~~~~g~~ra~~~~~~~e~~g~~  727 (744)
                      ||.|++|+|++.+......+.++  ++..+.++.|+||+||++||++++++|||+|||||||||||||||||+||++|||
T Consensus      1260 ~k~qg~p~Y~~~i~~~~~~~~~~--~~~~~~~e~D~L~~qAv~~V~~~~~aS~S~lQRrlrIGYnRAARiid~mE~~GIV 1337 (1355)
T PRK10263       1260 WKARGRPQYVDGITSDSESEGGA--GGFDGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEAQGIV 1337 (1355)
T ss_pred             HHHCCCCCCCHHCCCCCCCCCCC--CCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHCCCCCHHHHHHHHHHHHCCCC
T ss_conf             98628976311014554445677--7777776566799999999986294328998763134335899999999977884


Q ss_pred             CHHHCCCCCCCEEE
Q ss_conf             70216886232110
Q gi|254780606|r  728 SEADHVGKRHVFSE  741 (744)
Q Consensus       728 ~~~~~~~~r~~~~~  741 (744)
                      |+++|+|+||||+.
T Consensus      1338 s~~~~~g~REVLap 1351 (1355)
T PRK10263       1338 SEQGHNGNREVLAP 1351 (1355)
T ss_pred             CCCCCCCCCCCCCC
T ss_conf             68889988634589


No 2  
>COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning]
Probab=100.00  E-value=0  Score=947.72  Aligned_cols=472  Identities=44%  Similarity=0.606  Sum_probs=437.4

Q ss_pred             CCCCCCCCCCHHHHHHHC-CCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCHHHHHHHH
Q ss_conf             000112222113454310-1111110078899889999998740355138986764892589997548886399998599
Q gi|254780606|r  261 KGQKQYEQPCSSFLQVQS-NVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLA  339 (744)
Q Consensus       261 ~~~~~yelPp~~LL~~p~-~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~gp~~~~~~~~~~~g~~~~~~~~~~  339 (744)
                      .....|.+|.+.+|.... +......+..++..++.+|+.+|.+|+|.|+++++..||+||+||++|++|||++||++|.
T Consensus       376 ~~~~~~~lP~l~ll~~~~~~~~~~~~~~~~l~~~~~~l~~sl~~f~i~a~~~~~~~gp~vt~yei~l~~gvk~~~i~~L~  455 (858)
T COG1674         376 RGKDTPPLPHLFLIADEFAELKSEHPDFAELLVSIARLGRSLGIHLILATQKPDGVGPSNTRFEIALKVGVKVDSIEILG  455 (858)
T ss_pred             CCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHEEEEEEEECCCCCCCEEEEEEECCCCHHHHHHHCC
T ss_conf             56887889822120554322345774778899999999887886443578960567885126998645662166776047


Q ss_pred             HHHHHHHCCCCCEE-EEECCCCEEEEECCCCC-CCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCEEE
Q ss_conf             99998714776327-75189834544268888-87076587512812114678368984205788732112011484699
Q gi|254780606|r  340 DDIARSMSSLSARV-AVIPKRNAIGIELPNET-RETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILV  417 (744)
Q Consensus       340 ~d~~~~~~~~~~~~-~~~pg~~~~~~~~p~~~-~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lv  417 (744)
                      +|+|++|.+.++|+ +|||||++||||+||.. +++|+|+|++.+..|.+....|.+++|+|+.|+++++||++|||+||
T Consensus       456 ~d~A~~L~~~~~ri~~~ipgk~~igie~pn~~~~~~~~L~e~~~~~~~~~~~~~l~i~lg~~~~~~~~~~dlak~~hlli  535 (858)
T COG1674         456 NDDAAALVAKSRRYLAPIPGKSYIGFQSPNSGRPWLPPLRELLDLDEFLERFPLGVIDLPKDIRQEPIVIDLAKAGHLLI  535 (858)
T ss_pred             CHHHHHCCCCCEEEEEEECCCCEEEEECCCCCCCCCCCHHHCCCCHHHHCCCCCEEECCCHHCCCCCEEEECCCCCCEEE
T ss_conf             37788501446058987479753789746889867787121035234532465147525100368813855356888788


Q ss_pred             EECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHH-HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7078753447999999999985680110799972342100012577520000444417-876899999986676999999
Q gi|254780606|r  418 AGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPK-KAVMALKWAVREMEERYRKMS  496 (744)
Q Consensus       418 aG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~-~~~~~l~~~~~em~~r~~~~~  496 (744)
                      +|+||||||||||+||+||+|+++|++|+|+|||||+++|+.|++|||+.++|+||++ ++..+|+|++.||++||++|.
T Consensus       536 ~G~tgsGKSv~lnt~i~Sll~~~~P~ev~~~~iD~k~~~L~~~~~iPHl~~~v~td~~~k~~~al~~~~~eme~R~~l~~  615 (858)
T COG1674         536 AGATGSGKSVALNTMILSLLYTHSPEEVRFYIIDPKMLELAAYDGLPHLGDPVVTDEKEKAEKALAELVAEMERRYKLFS  615 (858)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCCHHEEEEEECCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             24888651558999999987518906849999747875433330698557723247477899999999999999999888


Q ss_pred             HCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC
Q ss_conf             80778679999988642026776665432338679998445687675310358999999999642013589998516544
Q gi|254780606|r  497 HLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV  576 (744)
Q Consensus       497 ~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~  576 (744)
                      +.++|||.+||+|+...         ....+|||||||||||+||||..++++|+.|.||||+|||+|||||||||||++
T Consensus       616 ~~~vr~i~~yn~k~~~~---------~~~~~lP~iviiiDe~adlm~~~~k~ve~~i~rLa~~ara~GIHlilatqRps~  686 (858)
T COG1674         616 EKGVRNIEGYNEKIAGA---------IPDEELPYIVIIIDEYADLMMVAGKELEELIARLAQKGRAAGIHLILATQRPSV  686 (858)
T ss_pred             HHCCCCHHHHHHHHCCC---------CCCCCCCCEEEEECCHHHHHCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCC
T ss_conf             85666277776542024---------555679808999444788861231769999999999787658269997489995


Q ss_pred             CCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEEECCC-CCEEEEEECCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             4414678850563057203681110032676316885689846864689-843899934389889999999998408875
Q gi|254780606|r  577 DVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGG-GRIQRVHGPLVSDIEIEKVVQHLKKQGCPE  655 (744)
Q Consensus       577 ~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~~~~~-~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~  655 (744)
                      ||++| ||+|||+||+|+|+|++|||+|||+.|||+|+|+|||||+.++ ++++|+||+||||+|++++|+|+|.|+.|.
T Consensus       687 dVit~-ikan~psrIaf~v~s~~dsr~il~~~gae~l~GrGd~l~~~~~~~~pvr~~~~fvsd~ev~~v~~~~k~~~~p~  765 (858)
T COG1674         687 DVITG-IKANIPTRIALRLSSKIDSRLILGQDGAEKLLGRGDMLFLGPGDAKPVRVLPAFVSDEEVEEVVEHLKSQVEPV  765 (858)
T ss_pred             CHHHH-HHHCCCCCEEEEECCCCCEEEEECCCHHHHCCCCCEEECCCCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCE
T ss_conf             04088-88538752566516876525662455063088854242157889886026654004888888630023137732


Q ss_pred             CCCCCCCCCCCCCCC-CCCC--CCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCHHHC
Q ss_conf             311112455554444-5667--7777776603899999999749862322000001007899999999998797570216
Q gi|254780606|r  656 YLNTVTTDTDTDKDG-NNFD--SEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADH  732 (744)
Q Consensus       656 ~~~~~~~~~~~~~~~-~~~~--~~~~~~~~~~~~~~~~~~~~~~~~s~s~~qr~~~~g~~ra~~~~~~~e~~g~~~~~~~  732 (744)
                      |.+..........+. ....  ....++.|+||++|++++++.+++|+|+|||+|+||||||||+||+||..||||+++|
T Consensus       766 y~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~~a~~~v~~~~~~S~s~lqr~~~iG~~raa~~~~~~e~~giv~~~~~  845 (858)
T COG1674         766 YLDLATNPHLLISGETTVLRAIDREEEAMDELFDEAKELVLPPPKASTSLLQRALDLGLNRAATLIESMELLGIVGPPNG  845 (858)
T ss_pred             EEECCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEEEECCCCCCHHHCEECCCCC
T ss_conf             44235675420135310022210110110389999998624721137898720626781776042221213134346457


Q ss_pred             CCCCCCEEEC
Q ss_conf             8862321103
Q gi|254780606|r  733 VGKRHVFSEK  742 (744)
Q Consensus       733 ~~~r~~~~~~  742 (744)
                      +|+||||+..
T Consensus       846 ~~~reil~~~  855 (858)
T COG1674         846 PKGREILVVE  855 (858)
T ss_pred             CCCCEEEECC
T ss_conf             9985276267


No 3  
>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive sequence similarity to wide variety of proteins from prokaryotes and plasmids, termed the FtsK/SpoIIIE family. This domain contains a putative ATP binding P-loop motif.  It is found in the FtsK cell division protein from E. coli and the stage III sporulation protein E SpoIIIE which has roles in regulation of prespore specific gene expression in B. subtilis. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer.
Probab=100.00  E-value=0  Score=351.82  Aligned_cols=197  Identities=48%  Similarity=0.786  Sum_probs=179.2

Q ss_pred             HHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC
Q ss_conf             58751281211467836898420578873211201148469970787534479999999999856801107999723421
Q gi|254780606|r  376 LRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML  455 (744)
Q Consensus       376 ~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~  455 (744)
                      +.+++....|....+.|++++|.|..|+|+++||.+.||+||+|+||||||+||+++|+||+++|+|++++|++||||++
T Consensus         2 ~~~~~~~~~~~~~~~~l~vp~G~~~~G~pv~~dl~~~pH~Lv~G~tGsGKS~~l~~li~sl~~~~~p~~v~l~liD~K~~   81 (202)
T pfam01580         2 LKELLDGKPFRGSRSRLTIALGKDISGNPVVADLVKMPHLLIAGATGSGKSTFLNTLILSLAARHSPEEVRLYLIDPKGG   81 (202)
T ss_pred             HHHHCCCCCCCCCCCCCEEEEEECCCCCEEEEECCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             67861692001689961487776799998998635688689965899980099999999998737962069999748961


Q ss_pred             EECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEH
Q ss_conf             00012577520000444417876899999986676999999807786799999886420267766654323386799984
Q gi|254780606|r  456 ELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIV  535 (744)
Q Consensus       456 ~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvvi  535 (744)
                      +|..|.++||+...+++|.+.+..+|+|++.||++||++|++.+++|+..||.+........    .....++|+|||||
T Consensus        82 ~~~~~~~~~h~~~~~~~d~e~~~~~l~~l~~em~rR~~ll~~~g~~~i~~~~~~~~~~~~~~----~~~~~~~p~ivvvi  157 (202)
T pfam01580        82 ELAALEDLPHLLSAVATDPEDALSALRALVAEMERRYALLKQLGVRSIEEYNGEIAEDILGG----AGWLEELPPIVVIV  157 (202)
T ss_pred             CHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC----CCCCCCCCCEEEEE
T ss_conf             26767635654433768999999999999999999999999838876899999866432124----55433478189864


Q ss_pred             HHHHHHHHHCCH----HHHHHHHHHHHHHHCCEEEEEEEECCCCC
Q ss_conf             456876753103----58999999999642013589998516544
Q gi|254780606|r  536 DEMADLMMVAGK----EIEGAIQRLAQMARAAGIHLIMATQRPSV  576 (744)
Q Consensus       536 DE~a~l~~~~~~----~~e~~~~~la~~~ra~GihlilatQrp~~  576 (744)
                      |||++|+...++    +++..+.+|||+||++|||||+|||||++
T Consensus       158 DE~~~l~~~~~~~~~~~~~~~l~~iar~GRa~GihlilatQrP~~  202 (202)
T pfam01580       158 DERAELMLAAPKDSEMRVEGALARLARMGRAAGIHLLLATQRPGV  202 (202)
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCC
T ss_conf             459999865550468999999999999887338299998189999


No 4  
>smart00843 Ftsk_gamma This domain directs oriented DNA translocation and forms a winged helix structure. Mutated proteins with substitutions in the FtsK gamma DNA-recognition helix are impaired in DNA binding.
Probab=99.89  E-value=3.1e-24  Score=185.24  Aligned_cols=63  Identities=49%  Similarity=0.808  Sum_probs=60.6

Q ss_pred             CCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCCCCCEEE
Q ss_conf             776603899999999749862322000001007899999999998797570216886232110
Q gi|254780606|r  679 KERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSE  741 (744)
Q Consensus       679 ~~~~~~~~~~~~~~~~~~~~s~s~~qr~~~~g~~ra~~~~~~~e~~g~~~~~~~~~~r~~~~~  741 (744)
                      ++.|+||++|++||++++++|+|+|||||+|||||||||||+||++|||||++|+|+||||+.
T Consensus         1 ~~~D~l~~~a~~~V~~~~~~S~S~lQR~l~IGynRAariid~lE~~GiVsp~~g~~~ReVL~~   63 (63)
T smart00843        1 EEEDELYDEAVELVIETQKASTSLLQRRLRIGYNRAARLIDQLEEEGIVGPANGSKPREVLVT   63 (63)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEECC
T ss_conf             963289999999999808624899999972050699999999999858788779999834249


No 5  
>pfam09397 Ftsk_gamma Ftsk gamma domain. This domain directs oriented DNA translocation and forms a winged helix structure. Mutated proteins with substitutions in the FtsK gamma DNA-recognition helix are impaired in DNA binding.
Probab=99.89  E-value=5.4e-24  Score=183.54  Aligned_cols=65  Identities=51%  Similarity=0.802  Sum_probs=61.9

Q ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCCCCCEEEC
Q ss_conf             77766038999999997498623220000010078999999999987975702168862321103
Q gi|254780606|r  678 KKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSEK  742 (744)
Q Consensus       678 ~~~~~~~~~~~~~~~~~~~~~s~s~~qr~~~~g~~ra~~~~~~~e~~g~~~~~~~~~~r~~~~~~  742 (744)
                      .++.|+||++|++||++++++|||+|||+|+|||||||||||+||+.|||||++|+|+|+||+..
T Consensus         2 ~~~~D~l~~~a~~~V~~~~~~S~S~lQR~~~IGynRAariid~LE~~GiVsp~~g~~~ReVL~~~   66 (67)
T pfam09397         2 DEEEDELYDEAVEFVIETQKASTSLLQRRLRIGYNRAARLIEQMEEEGIVGPANGSKPREVLVPK   66 (67)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCCEECCCC
T ss_conf             74203899999999998186348999999710506999999999998488887789885050899


No 6  
>COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning]
Probab=99.61  E-value=3.4e-16  Score=130.11  Aligned_cols=221  Identities=33%  Similarity=0.480  Sum_probs=165.5

Q ss_pred             CEEEEEEECC-CCCEEECCHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE-CCCCCCC
Q ss_conf             3689842057-88732112011----4846997078753447999999999985680110799972342100-0125775
Q gi|254780606|r  391 NLALCLGKTI-SGESVIADLAN----MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL-SVYDGIP  464 (744)
Q Consensus       391 ~l~~~~g~~~-~g~~~~~dl~~----~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~-~~~~~~p  464 (744)
                      .+.+.+|... .++....++..    .||.+++|+||+|||.++ +.+.++...++++++.++++|+|+... ..+.+. 
T Consensus       260 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~e~~-~~~~~~~~~~~~~e~~~~~~~~k~~~~~~~~~~~-  337 (858)
T COG1674         260 RLGVPIGLRGKKGELLNLDLHEKAEGGPHGLVAGTTGSGKSELL-TYILSLAINHSPEELNFLLIDYKGGSMANPFKGL-  337 (858)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-CHHCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCC-
T ss_conf             12455455567316666666643114421012467655732100-0102333358814420000120012321222221-


Q ss_pred             CEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHH
Q ss_conf             20000444417876899999986676999999807786799999886420267766654323386799984456876753
Q gi|254780606|r  465 HLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMV  544 (744)
Q Consensus       465 h~~~~v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~  544 (744)
                      |+.. .+++... .+++.....+|.+|..       .++..|....         ..+....+||.+.++.||++.+...
T Consensus       338 ~~~~-~~~~~~~-~r~~~~~~~~~~~r~~-------~~~~~~~~~~---------~~~~~~~~lP~l~ll~~~~~~~~~~  399 (858)
T COG1674         338 HVVA-VITNLAE-ERALAAIKGELARRQR-------NHINAYTKSY---------KRGKDTPPLPHLFLIADEFAELKSE  399 (858)
T ss_pred             CCCC-CCCCCCC-CCCCCCCCHHHHHHHC-------CCCCCCCHHH---------CCCCCCCCCCCHHHCCCCCCCCCCC
T ss_conf             1000-1014541-0000013103443100-------2323420110---------2568878898221205543223457


Q ss_pred             CCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEEEC-
Q ss_conf             1035899999999964201358999851654444146788505630572036811100326763168856898468646-
Q gi|254780606|r  545 AGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMS-  623 (744)
Q Consensus       545 ~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~~~-  623 (744)
                      . .+.+..++..++++|++++|+|+|+|.+....     ..|.-.+|++++..+.+|+++|+..-|-+|--.+--...+ 
T Consensus       400 ~-~~~~~l~~~~~~l~~sl~~f~i~a~~~~~~~g-----p~vt~yei~l~~gvk~~~i~~L~~d~A~~L~~~~~ri~~~i  473 (858)
T COG1674         400 H-PDFAELLVSIARLGRSLGIHLILATQKPDGVG-----PSNTRFEIALKVGVKVDSIEILGNDDAAALVAKSRRYLAPI  473 (858)
T ss_pred             C-CCHHHHHHHHHHHHHHHHHHEEEEEEEECCCC-----CCCEEEEEEECCCCHHHHHHHCCCHHHHHCCCCCEEEEEEE
T ss_conf             7-47788999999998878864435789605678-----85126998645662166776047377885014460589874


Q ss_pred             CCCCEEEEEECCCC
Q ss_conf             89843899934389
Q gi|254780606|r  624 GGGRIQRVHGPLVS  637 (744)
Q Consensus       624 ~~~~~~r~~~~~~~  637 (744)
                      +|-..+.+|-++..
T Consensus       474 pgk~~igie~pn~~  487 (858)
T COG1674         474 PGKSYIGFQSPNSG  487 (858)
T ss_pred             CCCCEEEEECCCCC
T ss_conf             79753789746889


No 7  
>PRK13873 conjugal transfer ATPase TrbE; Provisional
Probab=99.33  E-value=5.2e-08  Score=73.94  Aligned_cols=289  Identities=17%  Similarity=0.231  Sum_probs=149.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCC---E--E-------EEECCCC
Q ss_conf             89999998740355138986764892589997548886399998599999987147763---2--7-------7518983
Q gi|254780606|r  293 NAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSA---R--V-------AVIPKRN  360 (744)
Q Consensus       293 ~~~~l~~~l~~~~~~~~~~~~~~gp~~~~~~~~~~~g~~~~~~~~~~~d~~~~~~~~~~---~--~-------~~~pg~~  360 (744)
                      ++.-+...|.+-+-+....+.+. .+|+.|.=      ....+..-...+...|...+.   |  +       +-+||-.
T Consensus       311 ~a~dad~AL~eL~sg~~~~G~~~-~Tv~v~~~------~~~~l~~~~~~v~~~l~~~Gf~~~~Etlna~~A~~aqLPGn~  383 (815)
T PRK13873        311 KAADADAALQELGADQVGFAYVT-ATVTVWDA------DPRVADEKLRLVEKVIQGRDFTCMPETLNAVEAWLGSLPGHV  383 (815)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEE-EEEEEECC------CHHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHCCCCC
T ss_conf             99989999999857981258756-89999789------999999999999999985895799813121999986099986


Q ss_pred             EEEEECCCCCCCEEEHHHHHC---CHHH------CCCCCCEEEEEEECCCCCEEECCHH--HCCCEEEEECCCCCHHHHH
Q ss_conf             454426888887076587512---8121------1467836898420578873211201--1484699707875344799
Q gi|254780606|r  361 AIGIELPNETRETVYLRQIIE---SRSF------SHSKANLALCLGKTISGESVIADLA--NMPHILVAGTTGSGKSVAI  429 (744)
Q Consensus       361 ~~~~~~p~~~~~~v~~~~~~~---~~~~------~~~~~~l~~~~g~~~~g~~~~~dl~--~~PH~lvaG~TgsGKS~~l  429 (744)
                      +-     |.++..|.-+.+-.   ...|      .+.-..-++.+.++..|.|+.++|-  ...|.||.|.||+||||+|
T Consensus       384 ~~-----n~R~~~iss~N~a~l~pl~~~~~G~~~n~~~~~p~l~~~~T~g~tPf~fN~H~gdvGHtlI~GpTGsGKTvll  458 (815)
T PRK13873        384 YA-----NVRQPPVSTLNLAHMMPLSAVWAGPERNEHLDGPPLLYGRTEGSTPFRLSLHVGDVGHTLVVGPTGAGKSVLL  458 (815)
T ss_pred             CC-----CCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCEEEECCCCCCCCEEEECCCCCCHHHHH
T ss_conf             56-----6645644357777645424677899889999988058863489996687664688764389788999899999


Q ss_pred             HHHHHHHHHHCCHHHEEEEEECCCCC-EE------CCCCCC----------CCEEEEE--EECHHHHHHHHHHHHHHHHH
Q ss_conf             99999999856801107999723421-00------012577----------5200004--44417876899999986676
Q gi|254780606|r  430 NTMIMSLLYRLRPDECRMIMVDPKML-EL------SVYDGI----------PHLLTPV--VTNPKKAVMALKWAVREMEE  490 (744)
Q Consensus       430 ~~~i~sl~~~~~p~~~~~~liD~k~~-~~------~~~~~~----------ph~~~~v--~~~~~~~~~~l~~~~~em~~  490 (744)
                      +.|++. +.+|..-  +++.+|..++ +.      ..|..+          |--+.|.  +.++.+-.-+..|+..-+.+
T Consensus       459 ~~l~~q-~~ry~~~--~vf~FDkd~s~~i~~~a~GG~y~~lg~~~~~~~~~~~~f~Pl~~~d~~~~r~~~~~wi~~ll~~  535 (815)
T PRK13873        459 ALMALQ-FRRYPGS--QVFAFDFGGSIRAAALAMGGDWHDLGGGLSDGADGSVALQPLARIDDPAERAWAAEWIAAILAR  535 (815)
T ss_pred             HHHHHH-HHHCCCC--CEEEEECCCCHHHHHHHHCCEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999999-8644898--4899978987899999829987603565556789987779876889978889999999999961


Q ss_pred             ---------HHHH------HHH--CCCCCHHHHHHHH---------HHHHCCCCCC-----CCCC---------------
Q ss_conf             ---------9999------998--0778679999988---------6420267766-----6543---------------
Q gi|254780606|r  491 ---------RYRK------MSH--LSVRNIKSYNERI---------STMYGEKPQG-----CGDD---------------  524 (744)
Q Consensus       491 ---------r~~~------~~~--~~~~~i~~~n~~~---------~~~~~~~~~~-----~~~~---------------  524 (744)
                               +..+      ++.  ...|.+..+...+         .........+     ..+.               
T Consensus       536 ~g~~~tp~~~~~i~~Av~~l~~~~~~~Rtls~l~~~l~~~~L~~~L~~w~~~G~~G~lfD~~~D~l~~~~~~~Fe~~~l~  615 (815)
T PRK13873        536 EGVAVTPEVKEHIWSALTSLASAPVEERTLTGLSVLLQSNALKQALRPYCLGGPYGRLLDAEHERLGSADVQAFETEGLM  615 (815)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCHHHCCHHHHHHHHCCCHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCEEEECCCCC
T ss_conf             79888989999999999998519852173999998818814999999983789845426886567776773699873037


Q ss_pred             -------------------CCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC----HH
Q ss_conf             -------------------2338679998445687675310358999999999642013589998516544441----46
Q gi|254780606|r  525 -------------------MRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI----TG  581 (744)
Q Consensus       525 -------------------~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi----~~  581 (744)
                                         +..-| .+|+|||+-.+ +.. ..+...|...-.-.|.....+|+|||.|+ |++    ..
T Consensus       616 ~~~~~~pvl~YLf~rie~~lDGrp-tli~iDEaW~~-L~~-~~F~~~i~~wLkT~RK~N~~vv~aTQS~~-di~~S~I~~  691 (815)
T PRK13873        616 GTAAAPAVLSYLFHRIEDRFDGRP-TLLILDEGWLA-LDD-PVFAAQLREWLKTLRKKNASVIFATQSLA-DIDDSAIAP  691 (815)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCC-EEEEHHHHHHH-HCC-HHHHHHHHHHHHHHHHCCCEEEEECCCHH-HHHCCCHHH
T ss_conf             865178999999999999758996-69975865877-289-89999999999999870877999778889-986496689


Q ss_pred             HHHHCCCCEEEEECCCHHH
Q ss_conf             7885056305720368111
Q gi|254780606|r  582 TIKANFPIRISFQVTSKID  600 (744)
Q Consensus       582 ~ik~n~~~ri~~~v~~~~d  600 (744)
                      .|..|+++||-|--..+..
T Consensus       692 aiie~c~T~IfLPNp~A~~  710 (815)
T PRK13873        692 AIIESCPTRIFLPNERAIE  710 (815)
T ss_pred             HHHHHCCEEEECCCCCCCC
T ss_conf             9998688569877822277


No 8  
>PRK13830 conjugal transfer protein TrbE; Provisional
Probab=99.26  E-value=5.1e-08  Score=74.00  Aligned_cols=338  Identities=17%  Similarity=0.231  Sum_probs=170.6

Q ss_pred             HHHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEE------------EECCCCE
Q ss_conf             9999998740355138986764892589997548886399998599999987147763277------------5189834
Q gi|254780606|r  294 AGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVA------------VIPKRNA  361 (744)
Q Consensus       294 ~~~l~~~l~~~~~~~~~~~~~~gp~~~~~~~~~~~g~~~~~~~~~~~d~~~~~~~~~~~~~------------~~pg~~~  361 (744)
                      +.-++..|.+-+=.....| ..-.+|+.|      |-....+......+...+...+..+.            -+||--.
T Consensus       324 ~~e~~~Al~~l~sg~~~~G-~~~~tv~v~------~~~~~~l~~~~~~v~~~l~~~Gf~~~~E~~n~~~Af~aqLPGn~~  396 (818)
T PRK13830        324 VAETEDAIAQASSQLVAYG-YYTPVIVLF------DEDRERLQEKAEAIRRLIQAEGFGARIETLNATDAFLGSLPGNWY  396 (818)
T ss_pred             HHHHHHHHHHHHCCCEEEE-EEEEEEEEE------CCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHCCCCCC
T ss_conf             9989999988517977668-888899996------799999999999999999738946898020219999985988765


Q ss_pred             EEEECCCCCCCEEEHHHHHCCHHHCC---C----CC----CEEEEEEECCCC-CEEECCHH--HCCCEEEEECCCCCHHH
Q ss_conf             54426888887076587512812114---6----78----368984205788-73211201--14846997078753447
Q gi|254780606|r  362 IGIELPNETRETVYLRQIIESRSFSH---S----KA----NLALCLGKTISG-ESVIADLA--NMPHILVAGTTGSGKSV  427 (744)
Q Consensus       362 ~~~~~p~~~~~~v~~~~~~~~~~~~~---~----~~----~l~~~~g~~~~g-~~~~~dl~--~~PH~lvaG~TgsGKS~  427 (744)
                           -|.++..|.-+.+...-.|.+   .    ++    .-..+|-+...| .|+.+++-  ...|.||.|.|||||||
T Consensus       397 -----~~~R~~~isS~NfA~l~plh~~~~G~~~~~~~~~~~~~p~l~~t~sG~TPf~fN~H~~dvGHtlIiGpTGsGKTv  471 (818)
T PRK13830        397 -----CNIREPLINTRNLADLIPLNSVWSGNPVAPCPFYPPNSPPLMQVASGSTPFRLNLHVDDVGHTLIFGPTGSGKST  471 (818)
T ss_pred             -----CCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCEEEECCCCCCCEEEEECCCCCCHHH
T ss_conf             -----665655534677865541326678988898877788886148614899753562788986505898999998899


Q ss_pred             HHHHHHHHHHHHCCHHHEEEEEECCCCC-EEC------CCCCC---------CCEEEEE--EECHHHHHHHHHHHHHH--
Q ss_conf             9999999999856801107999723421-000------12577---------5200004--44417876899999986--
Q gi|254780606|r  428 AINTMIMSLLYRLRPDECRMIMVDPKML-ELS------VYDGI---------PHLLTPV--VTNPKKAVMALKWAVRE--  487 (744)
Q Consensus       428 ~l~~~i~sl~~~~~p~~~~~~liD~k~~-~~~------~~~~~---------ph~~~~v--~~~~~~~~~~l~~~~~e--  487 (744)
                      +++.|+.. +.++..  .+++.+|-.++ +..      .|..+         |--+.|.  +.+.....-+..|+..-  
T Consensus       472 ll~fl~aq-~~ky~~--~~vf~FDKd~s~~i~~~a~GG~y~~l~~~~~~~~~~~~f~Pl~~~~t~~~~~fl~~wl~~l~~  548 (818)
T PRK13830        472 LLALIAAQ-FRRYAG--AQIFAFDKGRSMLPLTLAAGGDHYEIGGDDAEEGRALAFCPLSELSTDADRAWAAEWIETLVA  548 (818)
T ss_pred             HHHHHHHH-HHHCCC--CEEEEECCCCCHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             99999999-864279--838997488768999998099258733677778887787988889985777999999999998


Q ss_pred             -------------HHHHHHHHHHCCCCCHHHHHHH---------HHHHHCCCCC----CCCCC-----------------
Q ss_conf             -------------6769999998077867999998---------8642026776----66543-----------------
Q gi|254780606|r  488 -------------MEERYRKMSHLSVRNIKSYNER---------ISTMYGEKPQ----GCGDD-----------------  524 (744)
Q Consensus       488 -------------m~~r~~~~~~~~~~~i~~~n~~---------~~~~~~~~~~----~~~~~-----------------  524 (744)
                                   +.+-...+.....|.+..+-..         ..........    +...|                 
T Consensus       549 ~~g~~~tp~~~~~i~~a~~~~~~~~~r~l~~~~~~~~~~~l~~~L~~w~~~G~~g~~fD~~~D~l~~~~~~~fe~~~ll~  628 (818)
T PRK13830        549 LQGVTITPDHRNAISRQIGLMASARGRSLSDFVSGVQMREIKDALHHYTVDGPMGQLLDAEEDGLTLGAFQTFEIEQLMN  628 (818)
T ss_pred             HCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCEEEECCCCCC
T ss_conf             47987899999999999985103655809888643575789999998706997250447876675756641785530044


Q ss_pred             --------------------CCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC----H
Q ss_conf             --------------------2338679998445687675310358999999999642013589998516544441----4
Q gi|254780606|r  525 --------------------MRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI----T  580 (744)
Q Consensus       525 --------------------~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi----~  580 (744)
                                          +..-| .+|++||+-.++ .. ..+.+.|...-.-.|.....+|+|||.|+ |++    .
T Consensus       629 ~~~~~~~Pvl~Ylf~rie~~lDGrp-~li~lDE~W~~L-~~-~~F~~~i~~wlkt~RK~N~~vv~aTQS~~-d~~~S~I~  704 (818)
T PRK13830        629 MGERNLVPVLTYLFRRIEKRLTGAP-SLIILDEAWLML-GH-PVFRDKIREWLKVLRKANCAVVLATQSIS-DAERSGII  704 (818)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCC-EEEEHHHHHHHH-CC-HHHHHHHHHHHHHHHHCCCEEEEECCCHH-HHHCCCHH
T ss_conf             7742079999999999997507991-799767648761-89-89999999999999863977999778889-98659648


Q ss_pred             HHHHHCCCCEEEEECCCHHH--CCHH---CCCCCHH-----HHCCCCCEEEECC-CCCEEEEE-----ECCC--CHH-HH
Q ss_conf             67885056305720368111--0032---6763168-----8568984686468-98438999-----3438--988-99
Q gi|254780606|r  581 GTIKANFPIRISFQVTSKID--SRTI---LGEHGAE-----QLLGRGDMLYMSG-GGRIQRVH-----GPLV--SDI-EI  641 (744)
Q Consensus       581 ~~ik~n~~~ri~~~v~~~~d--sr~i---l~~~gae-----~l~g~gd~l~~~~-~~~~~r~~-----~~~~--~~~-~~  641 (744)
                      ..|..|++++|-|--..+..  ++..   +|=...|     .+.-+-|++|..+ |+.+..+.     =+|+  |.. ++
T Consensus       705 ~~iveq~~T~IfLPNp~A~~~~~~~~y~~fGL~~~eieiI~~~~pkR~y~~~~~~gsrl~~L~L~~~~la~~~~Sg~~~~  784 (818)
T PRK13830        705 DVLKESCPTKICLPNGAAREPGTREFYERIGFNERQIEIVATAIPKREYYVASPEGRRLFDMSLGPVALSFVGASGKEDL  784 (818)
T ss_pred             HHHHHHCCEEEECCCCHHCCCHHHHHHHHCCCCHHHHHHHHCCCCCCEEEEECCCCCEEEECCCCCHHEEEEECCCHHHH
T ss_conf             99998688669866801055118889987599999999996258665189983899889974798401000114888899


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999999840
Q gi|254780606|r  642 EKVVQHLKKQ  651 (744)
Q Consensus       642 ~~~~~~~~~~  651 (744)
                      +++- .+...
T Consensus       785 ~~~~-~l~~~  793 (818)
T PRK13830        785 KRIR-ALKSE  793 (818)
T ss_pred             HHHH-HHHHH
T ss_conf             9999-99998


No 9  
>PRK13891 conjugal transfer protein TrbE; Provisional
Probab=99.24  E-value=8.8e-08  Score=72.38  Aligned_cols=293  Identities=18%  Similarity=0.216  Sum_probs=154.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCE--E----------EEECCC
Q ss_conf             8899999987403551389867648925899975488863999985999999871477632--7----------751898
Q gi|254780606|r  292 KNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSAR--V----------AVIPKR  359 (744)
Q Consensus       292 ~~~~~l~~~l~~~~~~~~~~~~~~gp~~~~~~~~~~~g~~~~~~~~~~~d~~~~~~~~~~~--~----------~~~pg~  359 (744)
                      ..+.-++..|.+-+=+.-..+ ....+|+.|-      -....+......+...+...+.-  +          +-+||-
T Consensus       353 ~~~~d~d~Al~el~sg~v~~G-y~t~tv~v~~------~~~~~l~~~~~~v~~~l~~~GF~~~~Et~n~~~A~lgsLPGn  425 (852)
T PRK13891        353 SMVGDAEAAIAEVNSGLVAAG-YYTSVVVLMD------EDRERLEASALLVEKAINRLAFAARIETINTMDAYLGSLPGH  425 (852)
T ss_pred             HHHHHHHHHHHHHCCCCEEEE-EEEEEEEEEC------CCHHHHHHHHHHHHHHHHHCCCEEEEEHHCCHHHHHHCCCCC
T ss_conf             999999999998608975268-8888999978------999999999999999998689679861102399998619997


Q ss_pred             CEEEEECCCCCCCEEEHHHHHCCHHHCCC----------CCCEEEEEEECCCCCEEECCHH--HCCCEEEEECCCCCHHH
Q ss_conf             34544268888870765875128121146----------7836898420578873211201--14846997078753447
Q gi|254780606|r  360 NAIGIELPNETRETVYLRQIIESRSFSHS----------KANLALCLGKTISGESVIADLA--NMPHILVAGTTGSGKSV  427 (744)
Q Consensus       360 ~~~~~~~p~~~~~~v~~~~~~~~~~~~~~----------~~~l~~~~g~~~~g~~~~~dl~--~~PH~lvaG~TgsGKS~  427 (744)
                      .+--+..|--  .+..|-+++-...|...          ...=++.+.++.+|.|+.++|-  ...|.||.|.||+||||
T Consensus       426 ~~~nvR~~~i--sT~NlA~l~pl~~vw~G~~~~p~~~~~~~~pal~~~~T~g~tPf~fN~Hv~DvGHTlIiGpTGaGKTv  503 (852)
T PRK13891        426 GVENVRRPLI--NTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDLGHTFMFGPTGAGKST  503 (852)
T ss_pred             CCCCCCCCCC--CHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEECCCCCCCCEEEECCCCCCHHH
T ss_conf             6677563666--64777756410345678667988668999874188744899844785456886640787899998899


Q ss_pred             HHHHHHHHHHHHCCHHHEEEEEECCCCC-----------------EECCC-C-CCCCEEEEE--EECHHHHHHHHHHHHH
Q ss_conf             9999999999856801107999723421-----------------00012-5-775200004--4441787689999998
Q gi|254780606|r  428 AINTMIMSLLYRLRPDECRMIMVDPKML-----------------ELSVY-D-GIPHLLTPV--VTNPKKAVMALKWAVR  486 (744)
Q Consensus       428 ~l~~~i~sl~~~~~p~~~~~~liD~k~~-----------------~~~~~-~-~~ph~~~~v--~~~~~~~~~~l~~~~~  486 (744)
                      +|+.|++.+ .+|.+-  +++.+|..+.                 .+... . +-+--+.|.  +.+.....-+..|+..
T Consensus       504 ll~fL~aQ~-~rY~~~--~vf~FDK~~S~~~~~~g~~~~~~a~GG~~~~l~~~~~~~gfnPL~~~dt~~~r~~~~~wl~~  580 (852)
T PRK13891        504 HLGIIAAQL-RRYAGM--SIYAFDKGMSMYPLAAGIRAATKGKSGLHFTVAADDDRLAFCPLQFLETKGDRAWAMEWIDT  580 (852)
T ss_pred             HHHHHHHHH-HHCCCC--CEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             999999997-441898--18987898523434412468898539817630689998786878689971457999999999


Q ss_pred             HH---------------HHHHHHHHHCCCCCHHHHHHHH---------HHHHCCCCC-----CC----------------
Q ss_conf             66---------------7699999980778679999988---------642026776-----66----------------
Q gi|254780606|r  487 EM---------------EERYRKMSHLSVRNIKSYNERI---------STMYGEKPQ-----GC----------------  521 (744)
Q Consensus       487 em---------------~~r~~~~~~~~~~~i~~~n~~~---------~~~~~~~~~-----~~----------------  521 (744)
                      -.               .+-..-++..+.|.+..+...+         .........     ..                
T Consensus       581 ll~~~g~~~tp~~~~~I~~Av~sl~~~~~rtLs~f~~~lq~~~l~~aL~~w~~~G~~G~lfDn~~D~l~~s~~~~Fe~~~  660 (852)
T PRK13891        581 ILALNGVNTTPAQRNEIGNAIMSMHASGARTLSEFSVTIQDEAIREAIKQYTVDGSMGHLLDAEEDGLSLSDFTVFEIEE  660 (852)
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCEEEECHH
T ss_conf             99728988998999999999998761646079999876398889999999846998060378876676767645882501


Q ss_pred             ----CCC----------------CCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC--
Q ss_conf             ----543----------------2338679998445687675310358999999999642013589998516544441--
Q gi|254780606|r  522 ----GDD----------------MRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI--  579 (744)
Q Consensus       522 ----~~~----------------~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi--  579 (744)
                          ++.                +..-| .+|++||+-.++ .. ..+...|...-.--|..-..+|+|||.|+ |++  
T Consensus       661 l~~~~~~~~~Pvl~YLFhRIe~~lDGrp-tli~lDEaW~~L-~d-p~F~~~i~~wLKTlRKkN~~VvfATQSl~-Di~~S  736 (852)
T PRK13891        661 LMNLGEKFALPVLLYLFRRIERALKGQP-SVIILDEAWLML-GH-PAFRAKIREWLKVLRKANCLVLMATQSLS-DAANS  736 (852)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHCCCC-EEEEEHHHHHHH-CC-HHHHHHHHHHHHHHHHCCCEEEEECCCHH-HHHCC
T ss_conf             3026815589999999999998736992-699952367761-89-99999999999999871847999768888-98538


Q ss_pred             --HHHHHHCCCCEEEEECCCHHH
Q ss_conf             --467885056305720368111
Q gi|254780606|r  580 --TGTIKANFPIRISFQVTSKID  600 (744)
Q Consensus       580 --~~~ik~n~~~ri~~~v~~~~d  600 (744)
                        ...|..++++||.|--..+..
T Consensus       737 ~I~~aiiEqc~T~IfLPNp~A~~  759 (852)
T PRK13891        737 GILDVIVESTATKIFLPNVYARD  759 (852)
T ss_pred             CHHHHHHHHCCEEEECCCCCCCC
T ss_conf             56899998588568767855577


No 10 
>PRK13853 type IV secretion system protein VirB4; Provisional
Probab=99.15  E-value=3.9e-08  Score=74.79  Aligned_cols=266  Identities=18%  Similarity=0.236  Sum_probs=141.7

Q ss_pred             ECCCCEEEEECCCCCCCEEEHHHHHC---CHHHCC----CCCCEEEEEEECCCCCEEECCHH--HCCCEEEEECCCCCHH
Q ss_conf             18983454426888887076587512---812114----67836898420578873211201--1484699707875344
Q gi|254780606|r  356 IPKRNAIGIELPNETRETVYLRQIIE---SRSFSH----SKANLALCLGKTISGESVIADLA--NMPHILVAGTTGSGKS  426 (744)
Q Consensus       356 ~pg~~~~~~~~p~~~~~~v~~~~~~~---~~~~~~----~~~~l~~~~g~~~~g~~~~~dl~--~~PH~lvaG~TgsGKS  426 (744)
                      +||--.     .|.++..|.-+.+-.   ...|..    .++.=++.+-++..|.|+.+++-  ...|.||.|.||||||
T Consensus       366 LPGn~~-----~~~R~~~iss~N~A~l~plh~~~~G~~~g~wg~al~~~~T~~gtPf~fn~H~~d~GHt~I~G~TGsGKT  440 (789)
T PRK13853        366 LPGNRK-----WRTRPGAITSRNFAGLVSFENFPEGARSGHWGNAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKT  440 (789)
T ss_pred             CCCCCC-----CCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCCCCEEEECCCCCCCCEEEECCCCCCHH
T ss_conf             998621-----345766443989986651048878888889998753425499982586378788774488789999889


Q ss_pred             HHHHHHHHHHHHHCCH-HHEEEEEECCCCCE-E------CCCC----CCCCEEEEE--EECHHHHHHH-HHHHHHHHH--
Q ss_conf             7999999999985680-11079997234210-0------0125----775200004--4441787689-999998667--
Q gi|254780606|r  427 VAINTMIMSLLYRLRP-DECRMIMVDPKMLE-L------SVYD----GIPHLLTPV--VTNPKKAVMA-LKWAVREME--  489 (744)
Q Consensus       427 ~~l~~~i~sl~~~~~p-~~~~~~liD~k~~~-~------~~~~----~~ph~~~~v--~~~~~~~~~~-l~~~~~em~--  489 (744)
                      ++++.|+..+ .++.. ..-+++.+|-.++. .      ..|.    +.+--+.|.  +.|....... ..|+..-++  
T Consensus       441 tll~fL~aq~-~ky~~~~~~~~~~fDkd~s~~i~~~a~GG~y~~i~~g~~tg~nPl~~l~~t~~~~~fl~~wl~~l~~~~  519 (789)
T PRK13853        441 TLMTFILAML-EQSMVDRAGAVVFFDKDRGGELLVRATGGTYLALRRGVPSGLAPLRGLENTAASRDFLREWIVALIESD  519 (789)
T ss_pred             HHHHHHHHHH-HHHHCCCCCEEEEEECCCCHHHHHHHHCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999-974223577089995886389999982987761269995684876568998688999999999999725


Q ss_pred             --------HHH-------HHHH-HCCCCCHHHHHH------------HHHHHHCCCC-----CCCCC-----------C-
Q ss_conf             --------699-------9999-807786799999------------8864202677-----66654-----------3-
Q gi|254780606|r  490 --------ERY-------RKMS-HLSVRNIKSYNE------------RISTMYGEKP-----QGCGD-----------D-  524 (744)
Q Consensus       490 --------~r~-------~~~~-~~~~~~i~~~n~------------~~~~~~~~~~-----~~~~~-----------~-  524 (744)
                              ++.       .+|. ....|.+.....            +.........     ....+           + 
T Consensus       520 g~~~lt~~~~~~i~~av~~~~~~~~~~r~ls~l~~~l~~~~~~~~~~rL~~w~~~g~~gwlfD~~~D~l~~~~~~~gfd~  599 (789)
T PRK13853        520 GRGGISPEENRRLVRGIHRQLSFDPDMRSLAGLREFLLHGPAEGAGARLQRWCRGNALGWAFDGEVDEVKLDPSITGFDM  599 (789)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCHHHCCHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEEEC
T ss_conf             99999999999999999998608831078989999845588216999999985499704403686546588787799861


Q ss_pred             ------------------------CCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC-
Q ss_conf             ------------------------2338679998445687675310358999999999642013589998516544441-
Q gi|254780606|r  525 ------------------------MRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI-  579 (744)
Q Consensus       525 ------------------------~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi-  579 (744)
                                              +..-| .++++||+-.++.  ...+...|...-.-.|..+..+|+|||.|+ |++ 
T Consensus       600 ~~ll~~~~~~~pvl~YLf~rie~~ldGrp-~ii~lDE~w~~l~--~~~f~~~i~~wlkt~RK~N~~vv~aTQs~~-d~~~  675 (789)
T PRK13853        600 THLLEYEEVCAPAAAYLLHRIGAMVDGRR-FVMSCDEFRAYLL--NPKFAAVVDKFLLTVRKNNGMLILATQQPE-HVLE  675 (789)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHCCCC-EEEEEHHHHHHHC--CHHHHHHHHHHHHHHHHCCCEEEEECCCHH-HHHC
T ss_conf             78527851289999999999998606996-6999456667646--999999999999999874908999648999-9863


Q ss_pred             ---HHHHHHCCCCEEEEECCCHH--HCCHHCCCCCHHH-H------CCCCCEEEECCC-CCEEEE
Q ss_conf             ---46788505630572036811--1003267631688-5------689846864689-843899
Q gi|254780606|r  580 ---TGTIKANFPIRISFQVTSKI--DSRTILGEHGAEQ-L------LGRGDMLYMSGG-GRIQRV  631 (744)
Q Consensus       580 ---~~~ik~n~~~ri~~~v~~~~--dsr~il~~~gae~-l------~g~gd~l~~~~~-~~~~r~  631 (744)
                         ...|..|++++|-|-=..+.  +.+--||-...|- +      ..+.+||++.+. +.+.++
T Consensus       676 s~i~~~i~e~~~T~I~LPNp~A~~~~y~~~~gLt~~e~~~I~~~~~~~sR~flikq~~~s~~~~l  740 (789)
T PRK13853        676 SPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKEFQAIREDMAVGSRKFLLKRESGSVICEF  740 (789)
T ss_pred             CCHHHHHHHHCCEEEECCCCCCCHHHHHHHCCCCHHHHHHHHHHCCCCCCEEEEEECCCEEEEEE
T ss_conf             82789999868867988896647788875339999999999863697562699981895089994


No 11 
>pfam05872 DUF853 Bacterial protein of unknown function (DUF853). This family consists of several bacterial proteins of unknown function. One member from Brucella melitensis is thought to be an ATPase.
Probab=99.07  E-value=1.6e-08  Score=77.44  Aligned_cols=119  Identities=24%  Similarity=0.366  Sum_probs=88.9

Q ss_pred             CCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEE--EEECCCHHHCCHH
Q ss_conf             38679998445687675310358999999999642013589998516544441467885056305--7203681110032
Q gi|254780606|r  527 PMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRI--SFQVTSKIDSRTI  604 (744)
Q Consensus       527 ~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri--~~~v~~~~dsr~i  604 (744)
                      ..|.+|.++||-.-|+..+++...+.|..+.++=|+-|+-+.++||.|. | |+..+-+++..||  |||--+.-|-+.|
T Consensus       255 dKPKLVFFFDEAHLLF~dApkall~kIEqvVRLIRSKGVGVyFvTQnP~-D-iPd~VL~QLGnRVQHALRAfTP~DqKAv  332 (504)
T pfam05872       255 DKPKLVFFFDEAHLLFNDAPKVLLEKVEQVVRLIRSKGVGVYFVTQNPL-D-LPDTVLAQLGNRVQHALRAFTPRDQKAV  332 (504)
T ss_pred             CCCEEEEEECHHHHHHCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCC-C-CCHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             8853899940166652478599999999999875306735999727876-4-7088999887788999863885469999


Q ss_pred             ------------CCCCCHHHHCCCCCEEE--ECCCCCEEEEEECC----------CCHHHHHHHHHH
Q ss_conf             ------------67631688568984686--46898438999343----------898899999999
Q gi|254780606|r  605 ------------LGEHGAEQLLGRGDMLY--MSGGGRIQRVHGPL----------VSDIEIEKVVQH  647 (744)
Q Consensus       605 ------------l~~~gae~l~g~gd~l~--~~~~~~~~r~~~~~----------~~~~~~~~~~~~  647 (744)
                                  +|...+=.=||-|.-|.  +...|.|.-++-.+          ++++|...++..
T Consensus       333 k~aa~tfr~np~~d~~~~it~LgvGEAlVS~LdekG~Pt~v~rt~i~pP~S~mGp~t~~er~~~i~~  399 (504)
T pfam05872       333 KAAADTFRPNPDFDTEEAITELGTGEALVSTLDEKGAPSIVERTLVRPPASRIGPLTDEERAALVQA  399 (504)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCCCEEEEEEECCHHHCCCCCHHHHHHHHHC
T ss_conf             9999857999766899998762765024331057999651467888786330588999999999974


No 12 
>PRK13898 type IV secretion system ATPase VirB4; Provisional
Probab=99.06  E-value=3.9e-08  Score=74.80  Aligned_cols=212  Identities=22%  Similarity=0.355  Sum_probs=113.8

Q ss_pred             EEEEEEECCCCCEEECCHH--HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC-EEC------CCC-
Q ss_conf             6898420578873211201--148469970787534479999999999856801107999723421-000------125-
Q gi|254780606|r  392 LALCLGKTISGESVIADLA--NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML-ELS------VYD-  461 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~--~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~-~~~------~~~-  461 (744)
                      =++.+=++..|.|+++++-  ...|.||.|.||||||++++.|+.. +.++.|   +++.+|-.++ +..      .|. 
T Consensus       424 ~av~~~~T~~gtpy~fNfH~~d~GHtlI~G~TGsGKTtl~~fL~aq-~~ky~~---~~f~fDkd~~~~i~~~a~GG~Y~~  499 (800)
T PRK13898        424 EAVTVFDTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAQ-AMKFSP---RMFFFDKDRGAEIFIRALNGVYTV  499 (800)
T ss_pred             CCCEECCCCCCCCEEEECCCCCCCCEEEECCCCCCHHHHHHHHHHH-HHHHCC---EEEEEECCCCHHHHHHHHCCEEEE
T ss_conf             5665030389987798674598775699899999899999999999-875488---799997999869999982988874


Q ss_pred             ---CCCCEEEEE--EECHHHHHHHHHHH---HH--------H--------------H---HHHHHHHHH-CCCCCHHHHH
Q ss_conf             ---775200004--44417876899999---98--------6--------------6---769999998-0778679999
Q gi|254780606|r  462 ---GIPHLLTPV--VTNPKKAVMALKWA---VR--------E--------------M---EERYRKMSH-LSVRNIKSYN  507 (744)
Q Consensus       462 ---~~ph~~~~v--~~~~~~~~~~l~~~---~~--------e--------------m---~~r~~~~~~-~~~~~i~~~n  507 (744)
                         +-+--+.|.  ..+.....-+..|+   +.        +              |   .||...+.. .+...-.+..
T Consensus       500 l~~g~~tg~nP~~l~dt~~n~~fl~~~l~~l~~~~g~~~t~~~~~~I~~av~~~~~l~~~~r~ls~l~~~l~~~~~~~L~  579 (800)
T PRK13898        500 IEPRLKCNFNPLQLDDTPENRTFLMEWLKVLVTSNGESLTAQDIKRINDAVEGNFKLKKEDRRLSNLVAFLGIDGPNTLA  579 (800)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCCCCHHHH
T ss_conf             37998568687779998678899999999999737999999999999999999860892113265799873548846899


Q ss_pred             HHHHHHHCCCCC----C-C------------CCC-------------------------CCCCCEEEEEHHHHHHHHHHC
Q ss_conf             988642026776----6-6------------543-------------------------233867999844568767531
Q gi|254780606|r  508 ERISTMYGEKPQ----G-C------------GDD-------------------------MRPMPYIVIIVDEMADLMMVA  545 (744)
Q Consensus       508 ~~~~~~~~~~~~----~-~------------~~~-------------------------~~~~p~ivvviDE~a~l~~~~  545 (744)
                      .+..........    + .            +.+                         +..-| .++||||+-.++.  
T Consensus       580 ~rL~~w~~~G~~g~~fDn~~D~l~~~~~~~~gfd~t~ll~~~~~~~pvl~Ylf~rie~~ldG~p-~ii~iDE~W~~l~--  656 (800)
T PRK13898        580 GRIAMWHGKGSHAAIFDNEEDLLDFQKARVFGFEMTELLKDPVSLAPVLLYLFHRISISLDGTP-SMIVLDEAWALID--  656 (800)
T ss_pred             HHHHHHHCCCCEEECCCCCCCCCCCCCCCEEEEECHHHCCCCHHHHHHHHHHHHHHHHHCCCCC-EEEEEECHHHHHC--
T ss_conf             9999986699805224897556686668089998467528820489999999999997528982-6999603366637--


Q ss_pred             CHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC----HHHHHHCCCCEEEEECCCHHH-CCHHCCCCCHH
Q ss_conf             0358999999999642013589998516544441----467885056305720368111-00326763168
Q gi|254780606|r  546 GKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI----TGTIKANFPIRISFQVTSKID-SRTILGEHGAE  611 (744)
Q Consensus       546 ~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi----~~~ik~n~~~ri~~~v~~~~d-sr~il~~~gae  611 (744)
                      ...+...|...-...|..+-.+|+|||.|+ |++    ...|..|++++|-|-=..+.+ .+-.+|-...|
T Consensus       657 ~~~f~~~i~~~lkt~RK~N~~vv~aTQs~~-d~~~s~i~~~iieq~~T~I~LPN~~A~~~y~~~f~Lt~~E  726 (800)
T PRK13898        657 NPVFAPKIKDWLKVLRKLNTFVIFATQSVE-DASKSAISDTLVQQTATQIFLPNLKATDIYRSVFMLSERE  726 (800)
T ss_pred             CHHHHHHHHHHHHHHHHCCCEEEEEECCHH-HHHCCCHHHHHHHHCCEEEECCCCCCHHHHHHHCCCCHHH
T ss_conf             999999999999999873977999808899-9862846899998688579887811009999865999999


No 13 
>cd01127 TrwB Bacterial conjugation protein TrwB,  ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.
Probab=98.94  E-value=9.4e-09  Score=79.04  Aligned_cols=104  Identities=20%  Similarity=0.251  Sum_probs=62.3

Q ss_pred             CEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC--CC----CHHHHHHCCCCEEEEECCCHHHCC
Q ss_conf             679998445687675310358999999999642013589998516544--44----146788505630572036811100
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV--DV----ITGTIKANFPIRISFQVTSKIDSR  602 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~--~v----i~~~ik~n~~~ri~~~v~~~~dsr  602 (744)
                      .++++++|||+.|-.     + ..|.+....+|+.|++++++.|-.+-  ++    ....|.+|+.++|.|++.+....+
T Consensus       270 ~rv~~~lDE~~~l~~-----l-~~~~~~l~~~R~~g~~~~~~~Q~~~Ql~~~YG~~~a~~i~~~~~~~i~~~~~d~~ta~  343 (410)
T cd01127         270 RRLWFFIDELPSLHK-----L-PDLVDALAEGRKFGGCFVLGIQSYAQLEDIYGKKGAQTLASNLRTRIVLAAPDAKTAE  343 (410)
T ss_pred             CCEEEEEECHHCCCC-----C-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCHHHHHHHHHCCCCEEEEECCCHHHHH
T ss_conf             607999887000377-----1-7799999988517978999917889999997873899998427768998279988999


Q ss_pred             HHCCCCCHHHHCCCCCEEEE------------CCCC-CEEEEEECCCCHHHHHHH
Q ss_conf             32676316885689846864------------6898-438999343898899999
Q gi|254780606|r  603 TILGEHGAEQLLGRGDMLYM------------SGGG-RIQRVHGPLVSDIEIEKV  644 (744)
Q Consensus       603 ~il~~~gae~l~g~gd~l~~------------~~~~-~~~r~~~~~~~~~~~~~~  644 (744)
                      .+=      .+||.-.....            .+.+ .-.+..-+.|..+||.++
T Consensus       344 ~~S------~~lG~~~v~~~~~s~s~g~~~~~~~~s~~~~~~~r~lv~p~Ei~~L  392 (410)
T cd01127         344 HAS------DSLGEQEVREMRENYSYGANNIRDGVSLGPQTEVQPLVTPSEIQAL  392 (410)
T ss_pred             HHH------HHCCCEEEEEEEEEECCCCCCCCCCCEECCEEEEECCCCHHHHHCC
T ss_conf             999------9609669988750044787888898554311021327699999639


No 14 
>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion]
Probab=98.88  E-value=4.3e-07  Score=67.65  Aligned_cols=219  Identities=18%  Similarity=0.259  Sum_probs=121.8

Q ss_pred             CCCCCCEEEEEEECCCCCEEECCHHH---CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC----
Q ss_conf             14678368984205788732112011---48469970787534479999999999856801107999723421000----
Q gi|254780606|r  386 SHSKANLALCLGKTISGESVIADLAN---MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS----  458 (744)
Q Consensus       386 ~~~~~~l~~~~g~~~~g~~~~~dl~~---~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~----  458 (744)
                      ....+.-++.++++.+|.|+++++-.   ..|.+|.|+||+||||+|+-++.+......   .+++++|.-.+--.    
T Consensus       407 ~~n~wg~~l~~~kt~~~sPf~~nfH~~~d~ghT~I~G~tGaGKTvLl~~lla~~~k~~~---~~iv~fDk~~g~~~~~~a  483 (796)
T COG3451         407 RGNPWGEPLTVLKTEDGSPFYFNFHVGEDVGHTLIIGPTGAGKTVLLSFLLAQALKYGN---PQIVAFDKDNGAYIFIEA  483 (796)
T ss_pred             CCCCCCCCCEEEECCCCCCEEEECCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCC---CCEEEECCCCCHHHHHHH
T ss_conf             68889975054204899962564355667697499889888789999999999987459---818998489735778887


Q ss_pred             ---CCC----CCCCEEEEE--EECHHH-HHHHHHHHHHHHHH----------H-----HHHHHHC--CCCCHHHHH----
Q ss_conf             ---125----775200004--444178-76899999986676----------9-----9999980--778679999----
Q gi|254780606|r  459 ---VYD----GIPHLLTPV--VTNPKK-AVMALKWAVREMEE----------R-----YRKMSHL--SVRNIKSYN----  507 (744)
Q Consensus       459 ---~~~----~~ph~~~~v--~~~~~~-~~~~l~~~~~em~~----------r-----~~~~~~~--~~~~i~~~n----  507 (744)
                         .|.    +.+-.+.|.  +.|..+ ..-...|+......          |     +.-+..+  .-|.+.+.-    
T Consensus       484 ~gG~y~~l~~~~~~~~NPf~~l~~t~~n~~fl~~~~~~ll~~~~~~~~~~~~~~i~~~~~~~~~~~~~~r~~~~l~~~l~  563 (796)
T COG3451         484 LGGEYLDLEPGVPSGFNPFEILEDTDENREFLAEWLVKLLAHEGISLSPAEERAISAAINNLATAPKEDRTFSDLIELLG  563 (796)
T ss_pred             HCCEEECCCCCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHC
T ss_conf             49887535678774608411037865668999999999963267666567888999999875447522474889998852


Q ss_pred             ---------HHHHHHHC---------CCCCCCC--------------------------------CCCCCCCEEEEEHHH
Q ss_conf             ---------98864202---------6776665--------------------------------432338679998445
Q gi|254780606|r  508 ---------ERISTMYG---------EKPQGCG--------------------------------DDMRPMPYIVIIVDE  537 (744)
Q Consensus       508 ---------~~~~~~~~---------~~~~~~~--------------------------------~~~~~~p~ivvviDE  537 (744)
                               .+......         +......                                ..+.-- .++++|||
T Consensus       564 ~~~~~~~l~srL~~~~~~g~~~~lfD~~~~~l~~~~~v~~fD~~~~l~~~~~~~~~~~YlFhri~~~~dgr-~~~i~iDE  642 (796)
T COG3451         564 IKERPNSLASRLAPWCEGGLFGWLFDNDDDSLKGDLSVIGFDMTELLDNPKVLAPVLLYLFHRIEERLDGR-PFLIFIDE  642 (796)
T ss_pred             CCCCCCHHHHHHHHHHCCCHHHHHHCCCCCCCCCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHHHCCC-CEEEEEHH
T ss_conf             68684228898888860442566624854112466517985135414665568999999999988872489-55998104


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCC----CHHHHHHCCCCEEEEECCCHHH--CCHHCCCCCHH
Q ss_conf             68767531035899999999964201358999851654444----1467885056305720368111--00326763168
Q gi|254780606|r  538 MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDV----ITGTIKANFPIRISFQVTSKID--SRTILGEHGAE  611 (744)
Q Consensus       538 ~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~v----i~~~ik~n~~~ri~~~v~~~~d--sr~il~~~gae  611 (744)
                      +-.+..  .+-+.+-|.+.-...|..-+-+|+|||-+. |+    |-..|..|.++||.+.-..+++  +.-+++-...|
T Consensus       643 ~w~~l~--~~~f~~~i~~~lkt~RK~Ng~vvfatQs~~-d~~~s~iA~~~ie~~~t~Iflpn~~~~~~~~~~~f~l~~~e  719 (796)
T COG3451         643 FWKLLD--NPKFADFIRDWLKTLRKLNGVVVFATQSIL-DILKSRIADAIIEQCPTKIFLPNPKAIEADYYRGFGLTERE  719 (796)
T ss_pred             HHHHCC--CHHHHHHHHHHHHHHHHHCCEEEEECCCHH-HHHCCHHHHHHHHHCCEEEECCCCCCCCHHCCCCCCCCHHH
T ss_conf             678558--888999999999998860754998526688-77436368999961871897678655530001102786567


No 15 
>pfam10412 TrwB_AAD_bind Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.
Probab=98.77  E-value=2.4e-07  Score=69.41  Aligned_cols=69  Identities=13%  Similarity=0.172  Sum_probs=44.2

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC--CC----CHHHHHHCCCCEEEEECCCHHHCCH
Q ss_conf             79998445687675310358999999999642013589998516544--44----1467885056305720368111003
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV--DV----ITGTIKANFPIRISFQVTSKIDSRT  603 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~--~v----i~~~ik~n~~~ri~~~v~~~~dsr~  603 (744)
                      ++++++|||+-|-.     +. .+..+...+|++||++++++|..+-  ++    ..-.|.+|+.++|.|++.+....+-
T Consensus       244 ~v~~~lDEf~~lg~-----i~-~l~~~l~~~Rs~gi~~~l~~Qs~~QL~~~YG~~~a~~il~n~~~~i~~~~~d~eTA~~  317 (386)
T pfam10412       244 RLWFFLDELPSLHK-----LP-SLADALAEGRKFGGCVVLGIQSFAQLEEVYGEDGAQTLLGLCNTKLILRVSDAETAEW  317 (386)
T ss_pred             CEEEEEECHHHCCC-----CH-HHHHHHHHHHCCCCEEEEEEECHHHHHHHHCHHHHHHHHHHCCCEEEEECCCHHHHHH
T ss_conf             44999987110276-----68-8999999864078499999838999999879889999996256599982799899999


Q ss_pred             H
Q ss_conf             2
Q gi|254780606|r  604 I  604 (744)
Q Consensus       604 i  604 (744)
                      |
T Consensus       318 i  318 (386)
T pfam10412       318 M  318 (386)
T ss_pred             H
T ss_conf             9


No 16 
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional
Probab=98.40  E-value=4.5e-05  Score=53.76  Aligned_cols=124  Identities=17%  Similarity=0.074  Sum_probs=70.7

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC----H---HHHHHCCCCEEEEECCCHHHCC
Q ss_conf             79998445687675310358999999999642013589998516544441----4---6788505630572036811100
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI----T---GTIKANFPIRISFQVTSKIDSR  602 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi----~---~~ik~n~~~ri~~~v~~~~dsr  602 (744)
                      ..+|||||.-.|+.-....+...|....+.+|..|=-+|++||--. |..    +   .-+-+|...+|-|+=....=-.
T Consensus       685 ~k~~iiDEAW~lL~~~n~~~~~FIe~~yRr~RKy~Gs~i~iTQ~i~-D~~~~~~s~~a~Aa~~NS~~ki~L~Q~~~~~~~  763 (864)
T PRK13721        685 KKLNVIDEGWRLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIV-DFDSDKASSAARAAWGNSSYKIILKQSAKEFAK  763 (864)
T ss_pred             EEEEEEEHHHHHHCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCHH-HHHCCCCCHHHHHHHHCCCEEEEECCCHHHHHH
T ss_conf             1799970187764589878999999999998861866999922667-753445789999999677648973489889999


Q ss_pred             ------HHCCCCCHHHHC--------CCCCEEEECCCC-CEEEEEE------CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             ------326763168856--------898468646898-4389993------438988999999999840887
Q gi|254780606|r  603 ------TILGEHGAEQLL--------GRGDMLYMSGGG-RIQRVHG------PLVSDIEIEKVVQHLKKQGCP  654 (744)
Q Consensus       603 ------~il~~~gae~l~--------g~gd~l~~~~~~-~~~r~~~------~~~~~~~~~~~~~~~~~~~~~  654 (744)
                            .-++.....-|.        +...++...+++ ...|+=-      -|-|+.+--.-++.+..||..
T Consensus       764 ~~~~~~~~~~~~~~~~i~s~~~~~~~~ySe~~i~~~~~~~~~Rl~~Dpfs~~l~St~~~d~~~ie~l~~~G~s  836 (864)
T PRK13721        764 YNQLYPDQFSPLERDMIGGFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGLS  836 (864)
T ss_pred             HHHHCCCCCCHHHHHHHHCCCCCCCCCEEEEEEECCCCEEEEEEEECHHHHHHHCCCHHHHHHHHHHHHCCCC
T ss_conf             9864843348889999854646788861599996699627899863747888856987889999999986999


No 17 
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]
Probab=98.23  E-value=1.1e-05  Score=57.92  Aligned_cols=163  Identities=26%  Similarity=0.387  Sum_probs=87.5

Q ss_pred             EEEEECCCCCEEECCHH--HCCC--EEEEECCCCCHHHHHHHHHHHHHHHC-----CHHHEEEEE-------ECCCCCEE
Q ss_conf             98420578873211201--1484--69970787534479999999999856-----801107999-------72342100
Q gi|254780606|r  394 LCLGKTISGESVIADLA--NMPH--ILVAGTTGSGKSVAINTMIMSLLYRL-----RPDECRMIM-------VDPKMLEL  457 (744)
Q Consensus       394 ~~~g~~~~g~~~~~dl~--~~PH--~lvaG~TgsGKS~~l~~~i~sl~~~~-----~p~~~~~~l-------iD~k~~~~  457 (744)
                      +.++.+..-..++-||.  --||  ..|-|+.|||||++|+ ||++-....     .||.=++-+       .=|+..|+
T Consensus       387 FGv~~r~ieryvlr~vNL~ikpGdvvaVvGqSGaGKttllR-mi~G~~~~~~ee~y~p~sg~v~~p~nt~~a~iPge~Ep  465 (593)
T COG2401         387 FGVRQRVIERYVLRNLNLEIKPGDVVAVVGQSGAGKTTLLR-MILGAQKGRGEEKYRPDSGKVEVPKNTVSALIPGEYEP  465 (593)
T ss_pred             HCCHHEEEEEEEEECEEEEECCCCEEEEEECCCCCCCHHHH-HHHHHHHCCCCCCCCCCCCCEECCCCCHHHCCCCCCCC
T ss_conf             43012145566640203686478768999248877311999-99877643562024787772103443132106765554


Q ss_pred             CCC--CCCCCEEEEEEECHHHHHHHHHHHHHHHHH-HH-HHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEE
Q ss_conf             012--577520000444417876899999986676-99-99998077867999998864202677666543233867999
Q gi|254780606|r  458 SVY--DGIPHLLTPVVTNPKKAVMALKWAVREMEE-RY-RKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVI  533 (744)
Q Consensus       458 ~~~--~~~ph~~~~v~~~~~~~~~~l~~~~~em~~-r~-~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivv  533 (744)
                      .+-  .-+-|+. ....|...|...|..+- -|+. +| +.+.++  ..-.-+|.|++....+.           | =+.
T Consensus       466 ~f~~~tilehl~-s~tGD~~~AveILnraG-lsDAvlyRr~f~EL--StGQKeR~KLAkllaer-----------p-n~~  529 (593)
T COG2401         466 EFGEVTILEHLR-SKTGDLNAAVEILNRAG-LSDAVLYRRKFSEL--STGQKERAKLAKLLAER-----------P-NVL  529 (593)
T ss_pred             CCCCHHHHHHHH-HCCCCHHHHHHHHHHHC-CCHHHHHHCCHHHC--CCCHHHHHHHHHHHHCC-----------C-CCE
T ss_conf             457311899875-23686367899997604-53054300467553--85457778999997348-----------9-817


Q ss_pred             EHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             844568767531035899999999964201358999851654
Q gi|254780606|r  534 IVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       534 viDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ++|||+.+....  -.......|..++|.+||-||++|-||+
T Consensus       530 ~iDEF~AhLD~~--TA~rVArkiselARe~giTlivvThrpE  569 (593)
T COG2401         530 LIDEFAAHLDEL--TAVRVARKISELAREAGITLIVVTHRPE  569 (593)
T ss_pred             EHHHHHHHCCHH--HHHHHHHHHHHHHHHHCCEEEEEECCHH
T ss_conf             735666431779--9999999999999970973999964877


No 18 
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family; InterPro: IPR004346   This family includes the Helicobacter pylori protein CagE (see examples), which together with other proteins from the cag pathogenicity island (PAI), encodes a type IV transporter secretion system. The precise role of CagE is not known, but studies in animal models have shown that it is essential for pathogenesis in Helicobacter pylori induced gastritis and peptic ulceration . Indeed, the expression of the cag PAI has been shown to be essential for stimulating human gastric epithelial cell apoptosis in vitro .    Similar type IV transport systems are also found in other bacteria. This family includes proteins from the trb and Vir conjugal transfer systems in Agrobacterium tumefaciens and homologues of VirB proteins from other species.; GO: 0005524 ATP binding.
Probab=98.02  E-value=1.4e-05  Score=57.19  Aligned_cols=214  Identities=22%  Similarity=0.292  Sum_probs=126.9

Q ss_pred             CCC-EEEEEEECCCCCEEECCHH--H------------CCCEEEEECCCCCHHHHHHHHHHHHHHHCCH-HHEEEEEECC
Q ss_conf             783-6898420578873211201--1------------4846997078753447999999999985680-1107999723
Q gi|254780606|r  389 KAN-LALCLGKTISGESVIADLA--N------------MPHILVAGTTGSGKSVAINTMIMSLLYRLRP-DECRMIMVDP  452 (744)
Q Consensus       389 ~~~-l~~~~g~~~~g~~~~~dl~--~------------~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p-~~~~~~liD~  452 (744)
                      .+- -+|.+=++..|.|+++++=  .            .-|.+|.|.|||||||+|+-|++.+. ++.+ +-++++.+|=
T Consensus       478 ~WG~~al~~l~t~~gtPfyfNFH~~~~~~~~A~~~~r~~GhT~IfG~~G~GKTtLl~fL~a~~~-ky~~~~a~~~~~fDk  556 (931)
T TIGR00929       478 PWGDPALTLLKTQSGTPFYFNFHVRDAKEKNADEGKRVLGHTLIFGPTGSGKTTLLNFLLAQLQ-KYKPNFALTIFAFDK  556 (931)
T ss_pred             CCCCCCEEEEEECCCCCEECCCCCCCCCCCCCCCCHHHCCCEEEECCCCCCHHHHHHHHHHHHH-CCCCCCCEEEEEEEC
T ss_conf             6668706898717898602245457212465000311038777888889846999999999974-248898706999887


Q ss_pred             CC-CEE------CCC-----------CCCCCEEEEE-------EECHHHHHHHHHHHHHHHH-------------HHH--
Q ss_conf             42-100------012-----------5775200004-------4441787689999998667-------------699--
Q gi|254780606|r  453 KM-LEL------SVY-----------DGIPHLLTPV-------VTNPKKAVMALKWAVREME-------------ERY--  492 (744)
Q Consensus       453 k~-~~~------~~~-----------~~~ph~~~~v-------~~~~~~~~~~l~~~~~em~-------------~r~--  492 (744)
                      -+ .+.      +.|           .+-+--+.|.       +.+.+.....+....+.|-             .|.  
T Consensus       557 d~g~~~~~~a~gG~Y~~i~G~~T~~~~g~~~~~NPl~~~~g~~l~~t~~n~~F~~~~~~~l~~~~~~~~~~~~~~~~~~~  636 (931)
T TIGR00929       557 DRGMEIFIRALGGKYLEIKGDATVAADGEPFGFNPLQGIDGEALEDTERNRAFLKEWLAMLVTLDGETDEEISAEDRNAL  636 (931)
T ss_pred             CCCCHHHHEEECCEEEEECCCEECCCCCCCCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHH
T ss_conf             89821041111745653033010167888665680201233677777244079999999998512766543678999999


Q ss_pred             -----HHHHHC-----CCCCHHHHHHHH------------------HHH-H----C------CCCC-CCCCC--------
Q ss_conf             -----999980-----778679999988------------------642-0----2------6776-66543--------
Q gi|254780606|r  493 -----RKMSHL-----SVRNIKSYNERI------------------STM-Y----G------EKPQ-GCGDD--------  524 (744)
Q Consensus       493 -----~~~~~~-----~~~~i~~~n~~~------------------~~~-~----~------~~~~-~~~~~--------  524 (744)
                           .++...     ..|+|..+-.-+                  ... +    +      +... ...+.        
T Consensus       637 ~~~i~~~~~~~~~~~~~~r~l~~l~~~l~~~~~~~~~~~~~l~~~L~~w~~~~~~G~~Gef~wLFD~~~~D~Ldl~~~~~  716 (931)
T TIGR00929       637 SSAIDSLYEEDQKEHPAIRSLSDLLNFLPKDSIEVVEARNSLADRLERWLKGGDYGGDGEFQWLFDGNETDSLDLSKADI  716 (931)
T ss_pred             HHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCE
T ss_conf             99988887314411255220899999725775300045023899988751789875552032110689754123789714


Q ss_pred             --------------------------------CCCC-CEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEE
Q ss_conf             --------------------------------2338-6799984456876753103589999999996420135899985
Q gi|254780606|r  525 --------------------------------MRPM-PYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMAT  571 (744)
Q Consensus       525 --------------------------------~~~~-p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlilat  571 (744)
                                                      +..- -+.+++||||-.+.  ...-++..|..+....|-..=++|+||
T Consensus       717 ~gfd~~~ll~~~e~~~~~~p~~~YLf~Ri~~~~dg~~r~~~~~~DEaw~~l--~~p~~~~~i~~~l~t~RK~NG~~v~AT  794 (931)
T TIGR00929       717 IGFDLTELLDNPELEKVATPVLLYLFHRIEEALDGSNRRFLIVIDEAWKLL--GDPVFAAKIKDWLKTLRKANGIVVLAT  794 (931)
T ss_pred             EEEEHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHH--CCHHHHHHHHHHHHHHHHHCCEEEEEC
T ss_conf             787554642476866789999999999999972413586799851305332--690789999999875766097798630


Q ss_pred             CCC-CCCC----CHHHHHHCCCCEEEEECC--CHHHCCHHCC
Q ss_conf             165-4444----146788505630572036--8111003267
Q gi|254780606|r  572 QRP-SVDV----ITGTIKANFPIRISFQVT--SKIDSRTILG  606 (744)
Q Consensus       572 Qrp-~~~v----i~~~ik~n~~~ri~~~v~--~~~dsr~il~  606 (744)
                      |-| + |.    |--.|..|+++.|+|.=.  +..|.+-.++
T Consensus       795 Q~~Y~-d~~~s~i~~~~~~~~~T~I~lPn~~a~~~dy~~~f~  835 (931)
T TIGR00929       795 QSIYN-DALESRIADTLIEQCATKIFLPNPKADREDYAEGFG  835 (931)
T ss_pred             CHHHH-HHHCCCHHHHHHHHCCCEEECCCCCCCHHHHHHHCC
T ss_conf             01477-763154246889615834324884568589998558


No 19 
>pfam01935 DUF87 Domain of unknown function DUF87. The function of this prokaryotic domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=98.01  E-value=1e-05  Score=58.19  Aligned_cols=61  Identities=30%  Similarity=0.538  Sum_probs=48.2

Q ss_pred             EEEEECC--CCCEEECCHHHC--CCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC
Q ss_conf             9842057--887321120114--8469970787534479999999999856801107999723421000
Q gi|254780606|r  394 LCLGKTI--SGESVIADLANM--PHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS  458 (744)
Q Consensus       394 ~~~g~~~--~g~~~~~dl~~~--PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~  458 (744)
                      +.+|+=+  ..-+|+.|+.++  -|+.|.|+||||||.++..|+.+|+-.   ....++++||-+ |+.
T Consensus         1 i~IG~l~~~~~v~v~ld~~~lv~rH~aIlg~TGsGKS~tv~vLl~~l~~~---~~~~vlVfDpHg-EY~   65 (218)
T pfam01935         1 IEIGRLLDGSEVPVYLDLNKLVSRHFAILGSTGSGKSNTVAVLLEELLEK---KGATVLIFDPHG-EYG   65 (218)
T ss_pred             CEECCCCCCCCCEEEEEHHHHHHHHEEEECCCCCCHHHHHHHHHHHHHHC---CCCCEEEECCCC-CCH
T ss_conf             96023168898138963899634214787269997699999999999854---799789982886-363


No 20 
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=97.97  E-value=0.00093  Score=44.75  Aligned_cols=218  Identities=21%  Similarity=0.252  Sum_probs=101.7

Q ss_pred             ECCCCCCHHHHHHHHHHHHHHHC-------------C-CCCEE-EEEC-----CCCEEEEECCCCCCCEEEHHHHHCCHH
Q ss_conf             54888639999859999998714-------------7-76327-7518-----983454426888887076587512812
Q gi|254780606|r  325 EPAPGIKSSRVIGLADDIARSMS-------------S-LSARV-AVIP-----KRNAIGIELPNETRETVYLRQIIESRS  384 (744)
Q Consensus       325 ~~~~g~~~~~~~~~~~d~~~~~~-------------~-~~~~~-~~~p-----g~~~~~~~~p~~~~~~v~~~~~~~~~~  384 (744)
                      ...+....+.+..+..-||....             - .+.|| +.+|     |.-++-|..|  ......|.|+.....
T Consensus        46 ~~~~~~~~~~l~~l~~~ia~~~~~~~~~~~P~l~a~Lp~G~Rv~~v~pp~~~~g~~~ltIRk~--~~~~~tl~dl~~~G~  123 (332)
T PRK13900         46 EQIPELDLSHLKALGRLIAQATEQKISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYSIRKP--SGMQLTLDDYEKMGA  123 (332)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCEEEEECC--CCCCCCHHHHHHCCC
T ss_conf             057759999999999999998099666789668999189846899837831599847999788--888899999986498


Q ss_pred             HCCCCCCEEE-E----EEEC-CCCC--EEECCHH-HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC
Q ss_conf             1146783689-8----4205-7887--3211201-148469970787534479999999999856801107999723421
Q gi|254780606|r  385 FSHSKANLAL-C----LGKT-ISGE--SVIADLA-NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML  455 (744)
Q Consensus       385 ~~~~~~~l~~-~----~g~~-~~g~--~~~~dl~-~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~  455 (744)
                      |......-.. .    +..- ..++  .++.... .-=.+||+|.||||||+|||+++..     -|.+-|++.|-- -.
T Consensus       124 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~fL~~aV~~r~NilI~G~TgSGKTTll~aL~~~-----ip~~eRiitIED-t~  197 (332)
T PRK13900        124 FDETATESLVDEDDVILNELLAEKKIKEFLEHAVISKKNIIISGGTSTGKTTFTNAALRE-----IPAIERLITVED-AR  197 (332)
T ss_pred             CCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHC-----CCCCCCEEEECC-CH
T ss_conf             665554201341567788764105799999999864871999888898899999999835-----895353566314-06


Q ss_pred             EECCCC--CCCCEEEEEEECHHHHHHHHHHHH-HHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEE
Q ss_conf             000125--775200004444178768999999-86676999999807786799999886420267766654323386799
Q gi|254780606|r  456 ELSVYD--GIPHLLTPVVTNPKKAVMALKWAV-REMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIV  532 (744)
Q Consensus       456 ~~~~~~--~~ph~~~~v~~~~~~~~~~l~~~~-~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~iv  532 (744)
                      ||....  +.-|++..--. .......+..++ .-|.-|                                     |- .
T Consensus       198 EL~l~~~pn~v~l~~~~~~-~g~~~vt~~~Ll~~aLR~r-------------------------------------PD-R  238 (332)
T PRK13900        198 EIVLSSHPNRVHLLASKGG-QGRAKVTTQDLIEACLRLR-------------------------------------PD-R  238 (332)
T ss_pred             HHCCCCCCCEEEEEECCCC-CCCCEECHHHHHHHHHCCC-------------------------------------CC-E
T ss_conf             6356668888999971688-8866086999999975689-------------------------------------97-5


Q ss_pred             EEHHHHH-----HHH------------HHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEEC
Q ss_conf             9844568-----767------------53103589999999996420135899985165444414678850563057203
Q gi|254780606|r  533 IIVDEMA-----DLM------------MVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQV  595 (744)
Q Consensus       533 vviDE~a-----~l~------------~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v  595 (744)
                      ||+-|+.     +++            ..+.......+.||+.+....|..       .+.+.+...|.+.++.=|-++.
T Consensus       239 IivGEvRG~EA~~~l~A~nTGH~Gs~tTiHA~sa~~a~~Rl~~l~~~~~~~-------~~~~~i~~~i~~aiDvVV~~~r  311 (332)
T PRK13900        239 IIVGELRGAEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKLMVMQAGLG-------MPPDQIKKYILNVVDIVVQLKR  311 (332)
T ss_pred             EEECCCCHHHHHHHHHHHHCCCCCCEECCCCCCHHHHHHHHHHHHHHHCCC-------CCHHHHHHHHHHHCCEEEEEEE
T ss_conf             844555719999999999769997114627899999999999999851689-------8999999999985899999988


Q ss_pred             C
Q ss_conf             6
Q gi|254780606|r  596 T  596 (744)
Q Consensus       596 ~  596 (744)
                      .
T Consensus       312 ~  312 (332)
T PRK13900        312 G  312 (332)
T ss_pred             C
T ss_conf             4


No 21 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=97.92  E-value=3.6e-05  Score=54.48  Aligned_cols=268  Identities=15%  Similarity=0.199  Sum_probs=129.0

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC--EECCCCCCCCEE-EEEEECHHHHHHHHHHHHHH
Q ss_conf             148469970787534479999999999856801107999723421--000125775200-00444417876899999986
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML--ELSVYDGIPHLL-TPVVTNPKKAVMALKWAVRE  487 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~--~~~~~~~~ph~~-~~v~~~~~~~~~~l~~~~~e  487 (744)
                      .-++++|.|.||.|||..++.++-.|- . ....++++.|+++..  .+..|..+-+-+ ..-+.               
T Consensus        54 ~~~n~~I~G~pGTGKT~~vk~v~~~l~-~-~~~~~~~vyINc~~~~t~~~i~~~i~~~L~~~~~p---------------  116 (394)
T PRK00411         54 RPSNVLILGPPGTGKTTTVKKVFEELE-E-AALKVVYVYINCQIDRTRYAILSEIARSLFGHPPP---------------  116 (394)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHH-H-HCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCC---------------
T ss_conf             998479988999989999999999999-7-46896599996966898999999999995699898---------------


Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEE
Q ss_conf             67699999980778679999988642026776665432338679998445687675310358999999999642013589
Q gi|254780606|r  488 MEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHL  567 (744)
Q Consensus       488 m~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihl  567 (744)
                               ..|...-.-|+........           .-.++|||+||+..|....+.++--.|.|+-..--...+.+
T Consensus       117 ---------~~G~s~~~~~~~l~~~l~~-----------~~~~~ivvLDEiD~L~~~~~~~vLY~L~r~~~~~~~~~~~v  176 (394)
T PRK00411        117 ---------SSGLSFDELFDKIAEYLDE-----------RDRVLIVALDDINYLVEKEGNDVLYSLLRAHEEYPGARIGV  176 (394)
T ss_pred             ---------CCCCCHHHHHHHHHHHHHC-----------CCCEEEEEEECCCCCCCCCCCHHHHHHHHCCCCCCCCCEEE
T ss_conf             ---------7787899999999998616-----------69758999965540203665089999985402268873899


Q ss_pred             EEEECCCC-CCCCHHHHHHCC-CCEEEEECCCHHHCCHHCCCC-------CH-----HHH----C--CCCCE------EE
Q ss_conf             99851654-444146788505-630572036811100326763-------16-----885----6--89846------86
Q gi|254780606|r  568 IMATQRPS-VDVITGTIKANF-PIRISFQVTSKIDSRTILGEH-------GA-----EQL----L--GRGDM------LY  621 (744)
Q Consensus       568 ilatQrp~-~~vi~~~ik~n~-~~ri~~~v~~~~dsr~il~~~-------ga-----e~l----~--g~gd~------l~  621 (744)
                      |.-+...+ .+.+...+++.+ +.+|.|.==+...=+.||...       |+     =.|    .  -.||+      |.
T Consensus       177 I~IsN~~~~~~~Ldprv~S~l~~~~i~F~PY~~~qL~~IL~~R~~~af~~gv~~~~~i~~~A~~~a~~~GDaR~Aldllr  256 (394)
T PRK00411        177 IGISSDLTFLYILDPRVKSVFGPEEIVFPPYTADEIFDILKDRVEEGFYPGVVSDEVLELIADLTGREHGDARVAIDLLR  256 (394)
T ss_pred             EEEECCCCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             99976871776640777502786289858999899999999999841455678978999999998550475899999999


Q ss_pred             ECCCCCEEEEEE-CCCCHHHHHHHHHHHHHCCCCCCCCC-------CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             468984389993-43898899999999984088753111-------1245555444456677777776603899999999
Q gi|254780606|r  622 MSGGGRIQRVHG-PLVSDIEIEKVVQHLKKQGCPEYLNT-------VTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVI  693 (744)
Q Consensus       622 ~~~~~~~~r~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  693 (744)
                      ..+  +.-.-.| .-|+.+.|++..+......--+.+..       ++..-..-. .   .+...-...++|+.-..+.-
T Consensus       257 ~A~--e~Ae~~g~~~Vt~~hV~~A~~~~~~~~~~~~i~~L~~~~klvL~ai~~~~-~---~~~~~~~~g~vy~~Y~~lc~  330 (394)
T PRK00411        257 RAG--EIAEREGSRKVTEEDVRKAYEKSEPVHLEEVLRTLPLHEKLLLLAIVRLL-E---KGAPYVTTGEVYEEYKELCE  330 (394)
T ss_pred             HHH--HHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHHHHH-C---CCCCCCCHHHHHHHHHHHHH
T ss_conf             999--99997189965899999999986000088998738998999999999985-1---78876638999999999999


Q ss_pred             HCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCHH
Q ss_conf             7498623220000010078999999999987975702
Q gi|254780606|r  694 DNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEA  730 (744)
Q Consensus       694 ~~~~~s~s~~qr~~~~g~~ra~~~~~~~e~~g~~~~~  730 (744)
                      ..+.-         ..+|.|--.++..||..|||.-.
T Consensus       331 ~~~~~---------~ls~~~~~~~l~~L~~~giI~~~  358 (394)
T PRK00411        331 ELGYE---------PRSHTRFYEYLNKLDMLGLINTR  358 (394)
T ss_pred             HCCCC---------CCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             73998---------88799999999999867985888


No 22 
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321   These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport.
Probab=97.86  E-value=1.7e-05  Score=56.71  Aligned_cols=190  Identities=27%  Similarity=0.356  Sum_probs=100.5

Q ss_pred             EEECCHHHCC--CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-CCCCCEECCCCCCCCEEEEEEECHHHHHHH
Q ss_conf             3211201148--4699707875344799999999998568011079997-234210001257752000044441787689
Q gi|254780606|r  404 SVIADLANMP--HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-DPKMLELSVYDGIPHLLTPVVTNPKKAVMA  480 (744)
Q Consensus       404 ~~~~dl~~~P--H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-D~k~~~~~~~~~~ph~~~~v~~~~~~~~~~  480 (744)
                      +|+-++++-|  =+||.|-||||||+-|=|||=   |-|.-...+++=| ||=.+=|..-..+=|-. -|=.|.+....+
T Consensus       117 ~v~~~~a~~~~GLiLVTGPTGSGKSTTlAsmID---yIN~~~~~HIiTIEDPIEyvh~~~~sli~QR-EvG~DT~sF~~A  192 (350)
T TIGR01420       117 PVLRELAERPRGLILVTGPTGSGKSTTLASMID---YINKNKAGHIITIEDPIEYVHKNKRSLINQR-EVGLDTLSFANA  192 (350)
T ss_pred             HHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHH---HHHCCCCCCCEEEECCEEEEECCCEEEEECC-CCCCCHHHHHHH
T ss_conf             899999836699389876889867899999997---8740388882563177314104770245436-246754579999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             99999866769999998077867999998864202677666543233867999844568767531035899999999964
Q gi|254780606|r  481 LKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMA  560 (744)
Q Consensus       481 l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~  560 (744)
                      |+.+-                            +..+             =||.|-|+.|+     .-|     ++|-.|
T Consensus       193 LraAL----------------------------ReDP-------------DvILiGE~RD~-----ET~-----~~AL~A  221 (350)
T TIGR01420       193 LRAAL----------------------------REDP-------------DVILIGEMRDL-----ETV-----ELALTA  221 (350)
T ss_pred             HHHHH----------------------------CCCC-------------CEEEEECCCCH-----HHH-----HHHHHH
T ss_conf             76841----------------------------0289-------------88998255627-----899-----999987


Q ss_pred             HCCEEEEEEEECCCC--CCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCC-CCCEEEE-CCCCCEEEEEECCC
Q ss_conf             201358999851654--4441467885056305720368111003267631688568-9846864-68984389993438
Q gi|254780606|r  561 RAAGIHLIMATQRPS--VDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLG-RGDMLYM-SGGGRIQRVHGPLV  636 (744)
Q Consensus       561 ra~GihlilatQrp~--~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g-~gd~l~~-~~~~~~~r~~~~~~  636 (744)
                      --.| ||||+|=-=.  ++.|.+ |=+-||.      .-+..=|    ..=|++|.| -=.+|.. .+|+.=+-++=-.|
T Consensus       222 AETG-HLV~gTLHTnsA~~ti~R-Iid~FP~------~~~~qiR----~~La~~L~Av~sQrL~p~~~G~GRv~~~Eil~  289 (350)
T TIGR01420       222 AETG-HLVFGTLHTNSAAKTIER-IIDVFPA------EEQEQIR----TQLAESLVAVISQRLLPKKNGGGRVLAVEILI  289 (350)
T ss_pred             HHHC-CHHHHHHHHHHHHHHHHH-HHCCCCH------HHHHHHH----HHHHHHHHHHHCCCCEEECCCCCEEEEEEEEC
T ss_conf             4213-156766664238887677-7425977------5668999----99987678770005422338962588887521


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             988999999999840887531111245
Q gi|254780606|r  637 SDIEIEKVVQHLKKQGCPEYLNTVTTD  663 (744)
Q Consensus       637 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  663 (744)
                      ...=|.   ++||+.|+..-+..++..
T Consensus       290 ~Tpav~---~lIre~gk~~qi~~~i~~  313 (350)
T TIGR01420       290 NTPAVR---NLIREEGKTHQIKSVIQT  313 (350)
T ss_pred             CCHHHH---HHHCCCCCHHHHHHHHHH
T ss_conf             587899---960287887689999871


No 23 
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155   This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer . VirB11 is believed to be an ATPase  and is a homologue of the P-like conjugation system TrbB protein and the Flp pilus system protein TadA ..
Probab=97.85  E-value=6.5e-05  Score=52.70  Aligned_cols=213  Identities=22%  Similarity=0.274  Sum_probs=118.0

Q ss_pred             EEEEEEECCCC---CCHHHHHHHHHHHHHHH--C---------------CCCCEE-EEE-----CC-CCEEEEECCCCCC
Q ss_conf             58999754888---63999985999999871--4---------------776327-751-----89-8345442688888
Q gi|254780606|r  319 VTLYEFEPAPG---IKSSRVIGLADDIARSM--S---------------SLSARV-AVI-----PK-RNAIGIELPNETR  371 (744)
Q Consensus       319 ~~~~~~~~~~g---~~~~~~~~~~~d~~~~~--~---------------~~~~~~-~~~-----pg-~~~~~~~~p~~~~  371 (744)
                      .++|++   |-   ...+++..|+.-+|-.=  .               ..+-|| .+|     .| |-.+-|..|  .-
T Consensus        29 ~~~~d~---P~rkaLT~~~l~~La~~~A~~~nt~q~is~y~~P~LSa~LP~G~RvQ~V~PPAc~~~eTvs~tIRKp--S~  103 (328)
T TIGR02788        29 TQRFDV---PERKALTFSHLRRLARAVASFSNTKQSISEYENPILSATLPGGERVQIVIPPACENDETVSITIRKP--SL  103 (328)
T ss_pred             EEEEEC---CCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCCCCEEEEEEECC--CC
T ss_conf             888726---7522441899999999988765378620102286378886999479998068758988589999526--44


Q ss_pred             CEEEHHHHHCCHHHCCCCCCEEEEEEE-CCCCCEEECCH------------H--HCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             707658751281211467836898420-57887321120------------1--14846997078753447999999999
Q gi|254780606|r  372 ETVYLRQIIESRSFSHSKANLALCLGK-TISGESVIADL------------A--NMPHILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       372 ~~v~~~~~~~~~~~~~~~~~l~~~~g~-~~~g~~~~~dl------------~--~~PH~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      ....|.|+-....|.....- .+.-.. -.+-+-=..+|            |  .-=-++|+|.||||||+|+|++|   
T Consensus       104 ~~~sL~dy~~~G~F~~ar~~-~~~~~~~~~d~~~~L~el~~~g~~~~Fl~~Ai~~~knIii~GGTgSGKTTf~kal~---  179 (328)
T TIGR02788       104 VDLSLDDYEEKGFFDTARAV-VVPASTELSDKDEELLELLDAGDIKEFLRLAIASRKNIIISGGTGSGKTTFLKALV---  179 (328)
T ss_pred             CCCCHHHHHHCCCCCEEEEE-ECCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHH---
T ss_conf             45547999627985447776-31443443468999999986288879999998738919999068971899999997---


Q ss_pred             HHHCCHHHEEEEEE-CCCCCEECCCCCCCCEEEEEE-EC---HHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHH-HHHH
Q ss_conf             98568011079997-234210001257752000044-44---178768999999866769999998077867999-9988
Q gi|254780606|r  437 LYRLRPDECRMIMV-DPKMLELSVYDGIPHLLTPVV-TN---PKKAVMALKWAVREMEERYRKMSHLSVRNIKSY-NERI  510 (744)
Q Consensus       437 ~~~~~p~~~~~~li-D~k~~~~~~~~~~ph~~~~v~-~~---~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~-n~~~  510 (744)
                        .+=|.+=|||-| |-....+..-.+.-||+..-- ..   .-....+|+.|-+.-=.| -+|.|++-+..-.| |.- 
T Consensus       180 --~~IP~~ER~iTIED~~E~~~~hhpN~V~L~ysk~v~~g~~~vt~~~Ll~scLRMrPDR-I~LgELRG~Eaf~F~~~~-  255 (328)
T TIGR02788       180 --KEIPKDERLITIEDTRELFLPHHPNKVHLFYSKGVGQGSAKVTPKDLLESCLRMRPDR-ILLGELRGDEAFDFIRAV-  255 (328)
T ss_pred             --HCCCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCH-HHHHHHCCHHHHHHHHHH-
T ss_conf             --3276225278885201147888986456553464234435689899999971177405-767430332578888752-


Q ss_pred             HHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHH--CCEEEE
Q ss_conf             642026776665432338679998445687675310358999999999642--013589
Q gi|254780606|r  511 STMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMAR--AAGIHL  567 (744)
Q Consensus       511 ~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~r--a~Gihl  567 (744)
                               .+|++..              +...+....+.++.|||.|--  .+|.+|
T Consensus       256 ---------nsGHpGs--------------iTT~HA~s~~~Af~qla~l~k~s~~g~gL  291 (328)
T TIGR02788       256 ---------NSGHPGS--------------ITTVHAGSPEEAFEQLALLVKESQAGLGL  291 (328)
T ss_pred             ---------CCCCCCC--------------EEEEEECCHHHHHHHHHHHHHCCHHHCCC
T ss_conf             ---------0598860--------------56787189899999999987202543588


No 24 
>PRK13700 conjugal transfer protein TraD; Provisional
Probab=97.84  E-value=2.1e-05  Score=56.09  Aligned_cols=71  Identities=15%  Similarity=0.119  Sum_probs=53.9

Q ss_pred             CCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC-CC-----CHHHHHHCCCCEEEEECCCHHHC
Q ss_conf             8679998445687675310358999999999642013589998516544-44-----14678850563057203681110
Q gi|254780606|r  528 MPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV-DV-----ITGTIKANFPIRISFQVTSKIDS  601 (744)
Q Consensus       528 ~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~-~v-----i~~~ik~n~~~ri~~~v~~~~ds  601 (744)
                      -.+|++|+|||+.|-.     + ..|......+|..|=..||..|--+- .-     ....|-+++.+|+-||+.|....
T Consensus       417 ~RRiWfiiDELpSL~K-----L-p~L~~~Lae~RKfGGc~VlG~Qs~aQL~~iYG~~~A~ti~dl~nTkl~fR~~d~~tA  490 (732)
T PRK13700        417 NRRVWFFCDELPTLHK-----L-PDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA  490 (732)
T ss_pred             CCCEEEEEECCCCCCC-----C-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHH
T ss_conf             8615999754434334-----0-237899987520377589960649999998778789999986416689867987899


Q ss_pred             CHH
Q ss_conf             032
Q gi|254780606|r  602 RTI  604 (744)
Q Consensus       602 r~i  604 (744)
                      +.+
T Consensus       491 ~~~  493 (732)
T PRK13700        491 EFA  493 (732)
T ss_pred             HHH
T ss_conf             999


No 25 
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=97.84  E-value=0.00013  Score=50.66  Aligned_cols=145  Identities=17%  Similarity=0.195  Sum_probs=68.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE-------CCCCCCCCEE--EEEEECHHHHHHHHHH
Q ss_conf             846997078753447999999999985680110799972342100-------0125775200--0044441787689999
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL-------SVYDGIPHLL--TPVVTNPKKAVMALKW  483 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~-------~~~~~~ph~~--~~v~~~~~~~~~~l~~  483 (744)
                      -=.+|+|.||.|||.|+..++..++.+.   ..+.+++=.-+..-       +.+.+++...  ....++ +. ...+..
T Consensus        14 ~L~vi~a~~g~GKS~~~~~la~~~a~~~---g~~V~~~SlEm~~~~~~~R~~s~~~~i~~~~i~~~~~~~-~~-~~~~~~   88 (242)
T cd00984          14 DLIIIAARPSMGKTAFALNIAENIAKKQ---GKPVLFFSLEMSKEQLLQRLLASESGISLSKLRTGSLSD-ED-WERLAE   88 (242)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHC---CCCEEEEECCCCHHHHHHHHHHHHHCCCHHHHHCCCCCH-HH-HHHHHH
T ss_conf             1899996899999999999999999977---995999933353889999999998297745530265227-99-999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHHHHHHHH
Q ss_conf             998667699999980778679999988642026776665432338679998445687675310------35899999999
Q gi|254780606|r  484 AVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEGAIQRLA  557 (744)
Q Consensus       484 ~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~~~~~la  557 (744)
                      +...+....-.+......++.....++.......    +      + =+||||=+ .||....      .++.....+|-
T Consensus        89 ~~~~~~~~~l~i~d~~~~t~~~i~~~ir~~~~~~----~------~-~~vvvDyl-ql~~~~~~~~~~~~~i~~i~~~Lk  156 (242)
T cd00984          89 AIGELKELPIYIDDSSSLTVSDIRSRARRLKKEH----G------L-GLIVIDYL-QLMSGSKKKGNRQQEVAEISRSLK  156 (242)
T ss_pred             HHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHC----C------C-CEEEEEHH-HHCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             9998616988996699999999999999998836----9------9-89998269-854677766579999999999999


Q ss_pred             HHHHCCEEEEEEEECCC
Q ss_conf             96420135899985165
Q gi|254780606|r  558 QMARAAGIHLIMATQRP  574 (744)
Q Consensus       558 ~~~ra~GihlilatQrp  574 (744)
                      ++|+.++|++|+++|=-
T Consensus       157 ~lA~e~~v~Vi~~sQln  173 (242)
T cd00984         157 LLAKELNVPVIALSQLS  173 (242)
T ss_pred             HHHHHHCCEEEEEECCC
T ss_conf             99999799399984678


No 26 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=97.83  E-value=0.00014  Score=50.32  Aligned_cols=141  Identities=17%  Similarity=0.183  Sum_probs=68.9

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHH
Q ss_conf             48469970787534479999999999856801107999723421000125775200004444178768999999866769
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEER  491 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r  491 (744)
                      ..|+|+.|.+|+|||++++.++..+...+    ..++.++........+....              ....+........
T Consensus         2 ~~~ill~G~~GsGKTtl~~~la~~~~~~~----~~v~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~   63 (148)
T smart00382        2 GEVILIVGPPGSGKTTLARALARELGPPG----GGVIYIDGEDILEEVLDQLL--------------LIIVGGKKASGSG   63 (148)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHCCCC----CCEEEEEHHHHHHHHHHHHH--------------HHHHCCCCCCCCH
T ss_conf             97899999997029999999998726689----96899875998988898765--------------3000112210519


Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHH---HHHHHHHHHCCEEEEE
Q ss_conf             9999980778679999988642026776665432338679998445687675310358999---9999996420135899
Q gi|254780606|r  492 YRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGA---IQRLAQMARAAGIHLI  568 (744)
Q Consensus       492 ~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~---~~~la~~~ra~Gihli  568 (744)
                      .        ..+........               ...+.||+|||+..+...........   .....+.....++++|
T Consensus        64 ~--------~~~~~~~~~~~---------------~~~~~viiiDei~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi  120 (148)
T smart00382       64 E--------LRLRLALALAR---------------KLKPDVLILDEITSLLDAEQEALLLLLEELRLLLLLKSEKNLTVI  120 (148)
T ss_pred             H--------HHHHHHHHHHH---------------HCCCCEEEEECCHHHCCCCCHHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             9--------99999999998---------------449989998275021476207999999999985176578998999


Q ss_pred             EEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             98516544441467885056305720
Q gi|254780606|r  569 MATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       569 latQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
                      ++++. ....+++.++.-+..++-+.
T Consensus       121 ~~~n~-~~~~~~~~~~~~~~~~~~~~  145 (148)
T smart00382      121 LTTND-EKDLGPALLRRRFDRRIVLL  145 (148)
T ss_pred             EEECC-CCCCCHHHHCCCCCEEEEEE
T ss_conf             95699-52249877074478799982


No 27 
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD; InterPro: IPR014128   The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM) , .; GO: 0000746 conjugation.
Probab=97.80  E-value=3.3e-05  Score=54.67  Aligned_cols=55  Identities=42%  Similarity=0.581  Sum_probs=41.3

Q ss_pred             CCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC
Q ss_conf             78873211201148469970787534479999999999856801107999723421000
Q gi|254780606|r  400 ISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS  458 (744)
Q Consensus       400 ~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~  458 (744)
                      |+|-+++=.-.+.=|+||-||||||||++|+-|+..+  |..-|  +.|+.|-.+.-..
T Consensus       196 i~g~~l~K~~sE~Qh~L~~GTtG~GKs~~lr~LL~~i--R~rGd--~AIiYDkgC~f~~  250 (613)
T TIGR02759       196 IGGLPLIKKGSEVQHILIHGTTGSGKSVALRKLLRWI--RQRGD--RAIIYDKGCTFVS  250 (613)
T ss_pred             ECCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHH--HHCCC--EEEEEECCCCCCC
T ss_conf             0780678777742252664541743899999999999--86398--5899825742021


No 28 
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=97.69  E-value=0.0007  Score=45.59  Aligned_cols=125  Identities=17%  Similarity=0.192  Sum_probs=74.1

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHH
Q ss_conf             14846997078753447999999999985680110799972342100012577520000444417876899999986676
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEE  490 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~  490 (744)
                      +..-++|-|.-.||||++|+++.+.+++.+.-    ++ +=.+..++..|+.+-   + .+.+.+....-+-....||.+
T Consensus        28 ~~~~~iiTGpN~sGKSt~lkti~l~~~laq~G----~~-vpa~~~~~~~~~~i~---~-~~~~~d~~~~~~S~F~~e~~~   98 (202)
T cd03243          28 SGRLLLITGPNMGGKSTYLRSIGLAVLLAQIG----CF-VPAESASIPLVDRIF---T-RIGAEDSISDGRSTFMAELLE   98 (202)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHC----CE-EEECCCEEECCCEEE---E-EECCCHHHHCCCCHHHHHHHH
T ss_conf             98289998998875399999999999999838----73-720446894466699---9-846602444353549999999


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHH----HHHHHHHHHHCCEEE
Q ss_conf             9999998077867999998864202677666543233867999844568767531035899----999999964201358
Q gi|254780606|r  491 RYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEG----AIQRLAQMARAAGIH  566 (744)
Q Consensus       491 r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~----~~~~la~~~ra~Gih  566 (744)
                      -..++....                             .+-+|++||+..  -+...+-..    .+..|..    .|.+
T Consensus        99 ~~~i~~~~~-----------------------------~~slvliDE~~~--gT~~~eg~~la~a~l~~l~~----~~~~  143 (202)
T cd03243          99 LKEILSLAT-----------------------------PRSLVLIDELGR--GTSTAEGLAIAYAVLEHLLE----KGCR  143 (202)
T ss_pred             HHHHHHHCC-----------------------------CCCEEEECCCCC--CCCHHHHHHHHHHHHHHHHH----CCCE
T ss_conf             999998677-----------------------------777242052347--99867879999999999985----3684


Q ss_pred             EEEEECCCCCCCC
Q ss_conf             9998516544441
Q gi|254780606|r  567 LIMATQRPSVDVI  579 (744)
Q Consensus       567 lilatQrp~~~vi  579 (744)
                      .|++|-......+
T Consensus       144 ~i~tTH~~~L~~~  156 (202)
T cd03243         144 TLFATHFHELADL  156 (202)
T ss_pred             EEEEECCHHHHHH
T ss_conf             9998253888875


No 29 
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=97.67  E-value=9.9e-05  Score=51.44  Aligned_cols=184  Identities=28%  Similarity=0.385  Sum_probs=87.1

Q ss_pred             EEECCHHHCC--CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHH-
Q ss_conf             3211201148--4699707875344799999999998568011079997234210001257752000044441787689-
Q gi|254780606|r  404 SVIADLANMP--HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMA-  480 (744)
Q Consensus       404 ~~~~dl~~~P--H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~-  480 (744)
                      +++.++++.|  -+||.|.||||||.-|-+||--+   |.-...+++-                     +.|+-+..-. 
T Consensus       115 ~i~~~~~~~~~GLILVTGpTGSGKSTTlAamId~i---N~~~~~HIlT---------------------IEDPIE~vh~s  170 (353)
T COG2805         115 PIVRELAESPRGLILVTGPTGSGKSTTLAAMIDYI---NKHKAKHILT---------------------IEDPIEYVHES  170 (353)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHH---HCCCCCCEEE---------------------ECCCHHHHHCC
T ss_conf             79999982879669986799996787999999998---4147751687---------------------23746865043


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             99999866769999998077867999998864202677666543233867999844568767531035899999999964
Q gi|254780606|r  481 LKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMA  560 (744)
Q Consensus       481 l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~  560 (744)
                      -+.+   ...     .+.|......+|+..+..+..            | =||.|-|+.|+        |+ | ++|-.|
T Consensus       171 kksl---I~Q-----REvG~dT~sF~~aLraALReD------------P-DVIlvGEmRD~--------ET-i-~~ALtA  219 (353)
T COG2805         171 KKSL---INQ-----REVGRDTLSFANALRAALRED------------P-DVILVGEMRDL--------ET-I-RLALTA  219 (353)
T ss_pred             HHHH---HHH-----HHHCCCHHHHHHHHHHHHHCC------------C-CEEEEECCCCH--------HH-H-HHHHHH
T ss_conf             2766---668-----774542788999999986029------------9-97998213469--------99-9-999989


Q ss_pred             HCCEEEEEEEECCCC--CCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCC-CCCEEEE-CCCCCEEEEEECCC
Q ss_conf             201358999851654--4441467885056305720368111003267631688568-9846864-68984389993438
Q gi|254780606|r  561 RAAGIHLIMATQRPS--VDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLG-RGDMLYM-SGGGRIQRVHGPLV  636 (744)
Q Consensus       561 ra~GihlilatQrp~--~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g-~gd~l~~-~~~~~~~r~~~~~~  636 (744)
                      --.| |||++|=.-.  ++.|.. |-+-||.      ..+..=|    ..=||.|.| --..|.. .+|+.-+-++--.+
T Consensus       220 AETG-HLV~~TLHT~sA~~ti~R-iidvFp~------~ek~~vR----~~La~sL~aVisQ~L~~~~~g~GRv~~~EIli  287 (353)
T COG2805         220 AETG-HLVFGTLHTNSAAKTIDR-IIDVFPA------EEKDQVR----SQLAESLRAVISQRLLPKKDGGGRVAAFEILI  287 (353)
T ss_pred             HHCC-CEEEEECCCCCHHHHHHH-HHHHCCH------HHHHHHH----HHHHHHHHHHHHHHCEECCCCCCEEEEEHHHH
T ss_conf             8608-877774023637777779-8873886------3467999----99999999997633100368996146415774


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9889999999998408875311
Q gi|254780606|r  637 SDIEIEKVVQHLKKQGCPEYLN  658 (744)
Q Consensus       637 ~~~~~~~~~~~~~~~~~~~~~~  658 (744)
                      ...-|   -++++ .++..-+.
T Consensus       288 ~TpAv---rnlIr-e~K~~qi~  305 (353)
T COG2805         288 NTPAV---RNLIR-EGKTHQIP  305 (353)
T ss_pred             CCHHH---HHHHH-CCCHHHHH
T ss_conf             78889---99984-48588899


No 30 
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=97.65  E-value=0.0002  Score=49.39  Aligned_cols=143  Identities=20%  Similarity=0.282  Sum_probs=71.0

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC-------CCCCCC-CEEEEEEECHHHHHHHHHHH
Q ss_conf             8469970787534479999999999856801107999723421000-------125775-20000444417876899999
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS-------VYDGIP-HLLTPVVTNPKKAVMALKWA  484 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~-------~~~~~p-h~~~~v~~~~~~~~~~l~~~  484 (744)
                      ==.+|||.||+|||.|+..++..++.++   ..+.+++-+-+..-.       ...+.+ +....-.....   ..++.+
T Consensus        31 eL~viaarpg~GKT~f~~~~a~~~~~~~---g~~vl~~SlEm~~~~~~~Rlls~~~g~~~~~~~~~~~~~~---e~~~~~  104 (271)
T cd01122          31 ELIILTAGTGVGKTTFLREYALDLITQH---GVRVGTISLEEPVVRTARRLLGQYAGKRLHLPDTVFIYTL---EEFDAA  104 (271)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHC---CCEEEEEECCCCHHHHHHHHHHHHHCCCHHHCCCCCCCHH---HHHHHH
T ss_conf             0899996899869999999999999976---9908999704999999999999982997110344677809---999999


Q ss_pred             HHHHHH--HHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHHHHHHH
Q ss_conf             986676--99999980778679999988642026776665432338679998445687675310------3589999999
Q gi|254780606|r  485 VREMEE--RYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEGAIQRL  556 (744)
Q Consensus       485 ~~em~~--r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~~~~~l  556 (744)
                      ..++..  ++-+....+..++.....++.......    +.       =+||||=+..++....      ..+.....+|
T Consensus       105 ~~~~~~~~~l~i~d~~~~~~~~~i~~~ir~~~~~~----~~-------~~vvIDylqll~~~~~~~~d~~~~i~~i~~~L  173 (271)
T cd01122         105 FDEFEGTGRLFMYDSFGEYSMDSVLEKVRYMAVSH----GI-------QHIIIDNLSIMVSDERASGDERKALDEIMTKL  173 (271)
T ss_pred             HHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHHHC----CC-------CEEEEEHHHHCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99970799808878999988999999999999828----99-------88998317850367867731899999999999


Q ss_pred             HHHHHCCEEEEEEEEC
Q ss_conf             9964201358999851
Q gi|254780606|r  557 AQMARAAGIHLIMATQ  572 (744)
Q Consensus       557 a~~~ra~GihlilatQ  572 (744)
                      -.+|+-++||+|+.+|
T Consensus       174 k~lAke~~v~Vi~lsQ  189 (271)
T cd01122         174 RGFATEHGIHITLVSH  189 (271)
T ss_pred             HHHHHHHCCCEEEEEC
T ss_conf             9999997997799952


No 31 
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=97.59  E-value=0.00088  Score=44.93  Aligned_cols=25  Identities=32%  Similarity=0.599  Sum_probs=14.6

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             1148469970787534479999999
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIM  434 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~  434 (744)
                      .+.+-++|+|.||||||+=|=-+|+
T Consensus        87 ~~nqVvii~GeTGsGKTTQiPq~~l  111 (1295)
T PRK11131         87 RDHQVVIVAGETGSGKTTQLPKICL  111 (1295)
T ss_pred             HHCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             9799699976899987889999999


No 32 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=97.58  E-value=0.0011  Score=44.27  Aligned_cols=27  Identities=22%  Similarity=0.427  Sum_probs=22.7

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             148469970787534479999999999
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      .-.|+|+.|.+|+|||.+.+.+...+.
T Consensus        18 ~~~~ill~GppGtGKT~la~~ia~~~~   44 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLARAIANELF   44 (151)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             998089989999886599999999712


No 33 
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=97.54  E-value=0.0034  Score=40.95  Aligned_cols=139  Identities=25%  Similarity=0.322  Sum_probs=73.8

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC--CEECC-------CCCCCCEEEEEEECHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342--10001-------2577520000444417876899999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM--LELSV-------YDGIPHLLTPVVTNPKKAVMALKWA  484 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~--~~~~~-------~~~~ph~~~~v~~~~~~~~~~l~~~  484 (744)
                      ++||.|.+|+|||+++..++.....    ...+.+.+|...  -+...       -....+++....+........+.  
T Consensus         1 ~~li~g~~g~GKttl~~~~~~~~~~----~~~~~~~~~~ee~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--   74 (165)
T cd01120           1 LILVFGPTGSGKTTLALQLALNIAT----KGGKVVYVDIEEEIEELTERLIGESLKGALDNLIIVFATADDPAAARLL--   74 (165)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHH----CCCEEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHH--
T ss_conf             9899989999899999999999876----3997999986664489999999862246713079993599976999999--


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHC-------CHHHHHHHHHHH
Q ss_conf             9866769999998077867999998864202677666543233867999844568767531-------035899999999
Q gi|254780606|r  485 VREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVA-------GKEIEGAIQRLA  557 (744)
Q Consensus       485 ~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~-------~~~~e~~~~~la  557 (744)
                        ++..+   +.+                            ...| .+||||.+.-+....       ...+-..+.+|.
T Consensus        75 --~~~~~---~~~----------------------------~~~~-vliiiDSit~~~~a~~e~~~g~~~~v~~~~~~L~  120 (165)
T cd01120          75 --SKAER---LRE----------------------------RGGD-DLIILDELTRLVRALREIREGYPGELDEELRELL  120 (165)
T ss_pred             --HHHHH---HHH----------------------------CCCC-EEEEEECHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             --99999---998----------------------------6997-7999928899887740015886789999999999


Q ss_pred             HHHHCCEEEEEEEECCCCCCCCH--------HHHHHCCCCEEEE
Q ss_conf             96420135899985165444414--------6788505630572
Q gi|254780606|r  558 QMARAAGIHLIMATQRPSVDVIT--------GTIKANFPIRISF  593 (744)
Q Consensus       558 ~~~ra~GihlilatQrp~~~vi~--------~~ik~n~~~ri~~  593 (744)
                      ..++..+|-+|+..|-+. |..+        ..++....+.|-|
T Consensus       121 ~~Ak~~~itvi~i~~v~~-d~~~~~~~~~g~~~l~~~~d~~i~L  163 (165)
T cd01120         121 ERARKGGVTVIFTLQVPS-GDKGDPRLTRGAQNLEDIADTVIVL  163 (165)
T ss_pred             HHHHCCCCEEEEEEEEEC-CCCCCCCCCCHHHHHHHHCCEEEEE
T ss_conf             999779828999998433-7789977253888883642669998


No 34 
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=97.54  E-value=0.00021  Score=49.20  Aligned_cols=143  Identities=16%  Similarity=0.217  Sum_probs=67.6

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE-EECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHH
Q ss_conf             4846997078753447999999999985680110799-972342100012577520000444417876899999986676
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI-MVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEE  490 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~-liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~  490 (744)
                      ..=++|.|-.|+|||.+++.++-+|    .++.+.++ +.++....-..|..+-.-+.--..+..+ ...++.    +++
T Consensus        43 ~g~~lltGe~GtGKTtllr~l~~~l----~~~~~~~~~i~~~~l~~~~ll~~i~~~lg~~~~~~~~-~~~~~~----l~~  113 (269)
T TIGR03015        43 EGFILITGEVGAGKTTLIRNLLKRL----DQERVVAAKLVNTRVDAEDLLRMVAADFGLETEGRDK-AALLRE----LED  113 (269)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHC----CCCCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCH-HHHHHH----HHH
T ss_conf             9659997299898899999999845----9345489997699999999999999985989889899-999999----999


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHH--HHHCCEEEEE
Q ss_conf             99999980778679999988642026776665432338679998445687675310358999999999--6420135899
Q gi|254780606|r  491 RYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQ--MARAAGIHLI  568 (744)
Q Consensus       491 r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~--~~ra~Gihli  568 (744)
                      +...+...                       +      -..|+||||-..|-.    ++-+.|..|.-  ....-=+++|
T Consensus       114 ~L~~~~~~-----------------------g------~~~vliIDEAq~L~~----~~Le~Lr~L~n~e~~~~~ll~ii  160 (269)
T TIGR03015       114 FLIEQFAA-----------------------G------KRALLVVDEAQNLTP----ELLEELRMLSNFQTDNAKLLQIF  160 (269)
T ss_pred             HHHHHHHC-----------------------C------CCEEEEEECHHHCCH----HHHHHHHHHHCCCCCCCCCEEEE
T ss_conf             99999966-----------------------9------946999724221999----99999999970135888704899


Q ss_pred             EEECCCCCCCCHHHHHHCCCCEEEEECC
Q ss_conf             9851654444146788505630572036
Q gi|254780606|r  569 MATQRPSVDVITGTIKANFPIRISFQVT  596 (744)
Q Consensus       569 latQrp~~~vi~~~ik~n~~~ri~~~v~  596 (744)
                      |+-|--=.+.+...--..+.-||++++.
T Consensus       161 L~GqpeL~~~L~~~~~~~l~qRI~~~~~  188 (269)
T TIGR03015       161 LVGQPEFRETLQSPQLQQLRQRIIASCH  188 (269)
T ss_pred             EECCHHHHHHHCCCCHHHHHHCEEEEEE
T ss_conf             9578679998727402545550767998


No 35 
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149   This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer . TrbB is a homologue of the vir system VirB11 ATPase , and the Flp pilus system ATPase TadA ..
Probab=97.53  E-value=0.00012  Score=50.81  Aligned_cols=145  Identities=20%  Similarity=0.287  Sum_probs=75.9

Q ss_pred             HHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCC-------CHHHHHHHHHHHHHHHCCCCC----EE-E--EEC--CCC
Q ss_conf             9998740355138986764892589997548886-------399998599999987147763----27-7--518--983
Q gi|254780606|r  297 LETILEEFGIKGEIINVNPGPVVTLYEFEPAPGI-------KSSRVIGLADDIARSMSSLSA----RV-A--VIP--KRN  360 (744)
Q Consensus       297 l~~~l~~~~~~~~~~~~~~gp~~~~~~~~~~~g~-------~~~~~~~~~~d~~~~~~~~~~----~~-~--~~p--g~~  360 (744)
                      |...+.-|==+.+|+.+-.-|=-.+|==+++.|+       ...+...+=.-+|-.|...--    +| .  |+-  |.-
T Consensus        10 lG~~i~~~LdD~~vvEIMLNpDG~Lwve~Lg~G~~~~G~t~~~~~a~~Ii~~vA~~l~~~V~~~~PivegELPldflGsR   89 (315)
T TIGR02782        10 LGPEIAAALDDPKVVEIMLNPDGKLWVERLGEGMEPLGKTVSPADAERIIGLVADYLGTEVDRDKPIVEGELPLDFLGSR   89 (315)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCEEECCCCEEEECCCCCHHHCC
T ss_conf             89999997379883899866987010500679730016611789999999999876446043578626610751112011


Q ss_pred             EEEEECCCCCCCEEEHHHHHCCHHHCC-CCCCEEEEEEECCCCCEE-------ECCH-HHCCCEEEEECCCCCHHHHHHH
Q ss_conf             454426888887076587512812114-678368984205788732-------1120-1148469970787534479999
Q gi|254780606|r  361 AIGIELPNETRETVYLRQIIESRSFSH-SKANLALCLGKTISGESV-------IADL-ANMPHILVAGTTGSGKSVAINT  431 (744)
Q Consensus       361 ~~~~~~p~~~~~~v~~~~~~~~~~~~~-~~~~l~~~~g~~~~g~~~-------~~dl-~~~PH~lvaG~TgsGKS~~l~~  431 (744)
                      .-|.=-|           |.+...|.- .++.-=+-|=-.++....       +.+. .--=-.||.|.||||||++-|+
T Consensus        90 FeGl~PP-----------VV~~p~F~IRkkA~~vfTLDdYV~~gimtaaQ~d~l~~Av~ar~NIlv~GGTGSGKTTLaNA  158 (315)
T TIGR02782        90 FEGLLPP-----------VVEAPSFAIRKKAVRVFTLDDYVEAGIMTAAQRDVLREAVAARKNILVVGGTGSGKTTLANA  158 (315)
T ss_pred             CCCCCCC-----------CCCCCCCHHCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHH
T ss_conf             0046877-----------55655101110224104707776404455789999999997129889981458857999999


Q ss_pred             HHHHHHHHCCHHHEEEEEE-CCC
Q ss_conf             9999998568011079997-234
Q gi|254780606|r  432 MIMSLLYRLRPDECRMIMV-DPK  453 (744)
Q Consensus       432 ~i~sl~~~~~p~~~~~~li-D~k  453 (744)
                      +|.-+..-+.|++ |+++| |-.
T Consensus       159 lla~I~~l~~P~d-R~vIiEDT~  180 (315)
T TIGR02782       159 LLAEIAKLNDPDD-RVVIIEDTA  180 (315)
T ss_pred             HHHHHHHCCCCCC-EEEEEECCH
T ss_conf             9998852169996-189985471


No 36 
>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=97.50  E-value=0.0013  Score=43.87  Aligned_cols=147  Identities=16%  Similarity=0.157  Sum_probs=68.8

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE-------ECCCCCCCCEE--EEEEECHHHHHHH
Q ss_conf             11484699707875344799999999998568011079997234210-------00125775200--0044441787689
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE-------LSVYDGIPHLL--TPVVTNPKKAVMA  480 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~-------~~~~~~~ph~~--~~v~~~~~~~~~~  480 (744)
                      ...-=.+|+|.||+|||.|+..+...++.+.   ..+.+++.+-+..       ++...+++...  ..-.++. . ...
T Consensus        17 ~~G~l~vi~g~pg~GKS~~~~~~a~~~a~~~---g~~Vl~~slEm~~~~~~~R~~a~~~~v~~~~i~~~~~~~~-~-~~~   91 (186)
T pfam03796        17 QKGDLIIIAARPSMGKTAFALNIARNAALKQ---DKPVLFFSLEMSAEQLAERLLSSESRISSSKLRSGQLSDE-D-WER   91 (186)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHC---CCCEEEECCCCCHHHHHHHHHHHHHCCCHHHHHCCCHHHH-H-HHH
T ss_conf             8881799996799987999999999999970---9966875475529999999999862676555412512167-9-999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC--------HHHHHH
Q ss_conf             999998667699999980778679999988642026776665432338679998445687675310--------358999
Q gi|254780606|r  481 LKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG--------KEIEGA  552 (744)
Q Consensus       481 l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~--------~~~e~~  552 (744)
                      +..+..++....-.+......++.....++.......           ..=+||||=+. ||...+        .++...
T Consensus        92 ~~~~~~~~~~~~l~i~~~~~~t~~~i~~~i~~~~~~~-----------~~~~vvvDyl~-l~~~~~~~~~~~r~~~v~~i  159 (186)
T pfam03796        92 LAEAAGELSEAPLYIDDTPGLSLSELRAQARRLKREH-----------GLGLIVIDYLQ-LMQGSKASKSENRQQEISEI  159 (186)
T ss_pred             HHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHC-----------CCCEEEEEHHH-HCCCCCCCCCCCHHHHHHHH
T ss_conf             9999999853986884799998999999999999855-----------99889974898-63677888775599999999


Q ss_pred             HHHHHHHHHCCEEEEEEEECC
Q ss_conf             999999642013589998516
Q gi|254780606|r  553 IQRLAQMARAAGIHLIMATQR  573 (744)
Q Consensus       553 ~~~la~~~ra~GihlilatQr  573 (744)
                      ..+|.++|+-.+|.+|+++|=
T Consensus       160 ~~~Lk~lA~e~~i~ii~~sQl  180 (186)
T pfam03796       160 SRSLKALAKELNIPVIALSQL  180 (186)
T ss_pred             HHHHHHHHHHHCCCEEEEECC
T ss_conf             999999999979918997225


No 37 
>pfam04665 Pox_A32 Poxvirus A32 protein. The A32 protein is thought to be involved in viral DNA packaging.
Probab=97.44  E-value=0.0024  Score=41.99  Aligned_cols=150  Identities=18%  Similarity=0.320  Sum_probs=90.2

Q ss_pred             CHHHCC-CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC-CCEECCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             201148-4699707875344799999999998568011079997234-21000125775200004444178768999999
Q gi|254780606|r  408 DLANMP-HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK-MLELSVYDGIPHLLTPVVTNPKKAVMALKWAV  485 (744)
Q Consensus       408 dl~~~P-H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k-~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~  485 (744)
                      .|-+.| .+.+-|.|||||+++|.+++..|..++.    +++|+-|= .-+...| -.|.++.. ++..++..-+|.   
T Consensus         8 sLl~~pFrmaivGgSGSGKT~yLlsLf~tlv~kyk----hIfLfTpv~N~~Yd~Y-VwPdHV~~-vtt~eeleY~L~---   78 (241)
T pfam04665         8 SLLAAPFRMAIVGGSGSGKTTYLLSLLRTLVRKFK----HIFLFTPVYNNAYDGY-VWPDHIFK-VTTNEELEYALS---   78 (241)
T ss_pred             HHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHE----EEEEECCCCCCCCCCC-CCCCCEEE-ECCHHHHHHHHH---
T ss_conf             67408735999815887566999999999977415----8999624467323652-57773256-257235778999---


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEE
Q ss_conf             86676999999807786799999886420267766654323386799984456876753103589999999996420135
Q gi|254780606|r  486 REMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGI  565 (744)
Q Consensus       486 ~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gi  565 (744)
                       .+.+.           |..|-++....     +       .--..++|.|.+.|.-...     ..+..+.--||-+-|
T Consensus        79 -~~k~k-----------Iek~~~~~~~~-----k-------~~~~fLiIlDD~Gd~q~rs-----~~L~~f~N~gRH~n~  129 (241)
T pfam04665        79 -KTKEK-----------IEKFSKKASNQ-----K-------ENFRFLIILDDLGDMQTRS-----KTLLNFTNHGRHLNI  129 (241)
T ss_pred             -HHHHH-----------HHHHHHHCCCC-----C-------CCEEEEEEECCCCCHHHHH-----HHHHHHHCCCCCHHH
T ss_conf             -99999-----------99999860266-----6-------4104899962555323311-----577766401610101


Q ss_pred             EEEEEECCCCCCCCHHHHHHCCCCEEEEECCC
Q ss_conf             89998516544441467885056305720368
Q gi|254780606|r  566 HLIMATQRPSVDVITGTIKANFPIRISFQVTS  597 (744)
Q Consensus       566 hlilatQrp~~~vi~~~ik~n~~~ri~~~v~~  597 (744)
                      -+|+--|+=.  -++..=|+.+..=.|.-|.+
T Consensus       130 Sii~Lcqty~--Hvp~n~R~Sith~cccNvs~  159 (241)
T pfam04665       130 SIILLCQTYK--HVPVNGRDSITHFCCCNVSD  159 (241)
T ss_pred             EEEEEEEEEE--CCCCCCCCCCEEEEEECCCH
T ss_conf             1134442211--04998743204899831546


No 38 
>PRK13833 conjugal transfer protein TrbB; Provisional
Probab=97.44  E-value=0.00016  Score=49.93  Aligned_cols=112  Identities=21%  Similarity=0.364  Sum_probs=61.1

Q ss_pred             CCCHHHHHHHHHHHHHHHCC---------------CCCEE-EE---ECCCCEEEEECCCCCCCEEEHHHHHCCHHHCCCC
Q ss_conf             86399998599999987147---------------76327-75---1898345442688888707658751281211467
Q gi|254780606|r  329 GIKSSRVIGLADDIARSMSS---------------LSARV-AV---IPKRNAIGIELPNETRETVYLRQIIESRSFSHSK  389 (744)
Q Consensus       329 g~~~~~~~~~~~d~~~~~~~---------------~~~~~-~~---~pg~~~~~~~~p~~~~~~v~~~~~~~~~~~~~~~  389 (744)
                      -..-+....+..-+|..+..               .+.|+ +.   +-+..++-|..+  ....+.|.|++++..+....
T Consensus        56 ~~~~~~~~~~i~~iA~~~g~~id~~~Pilda~LP~~G~R~~~v~PP~~~g~sitIRk~--~~~~~tl~dlv~~g~~t~~~  133 (323)
T PRK13833         56 EMSSAAAEIVIGSVAHALQSEADDERPIISGELPIGGHRFEGLLPPVVSGPAFTIRRR--ASRLIPLDDYVRSKVMTEAQ  133 (323)
T ss_pred             CCCHHHHHHHHHHHHHHHCCEECCCCCEEEEECCCCCEEEEEECCCCCCCCEEEEECC--CCCCCCHHHHHHCCCCCHHH
T ss_conf             5899999999999999859986689855899879999899998788679952999687--89999999998769999999


Q ss_pred             CCEEEEEEECCCCCEEECCH-HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-CCCCCEECC
Q ss_conf             83689842057887321120-11484699707875344799999999998568011079997-234210001
Q gi|254780606|r  390 ANLALCLGKTISGESVIADL-ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-DPKMLELSV  459 (744)
Q Consensus       390 ~~l~~~~g~~~~g~~~~~dl-~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-D~k~~~~~~  459 (744)
                      ..             ++..+ ..--.+||+|.||||||+|||+++..+ ..+.|++ |++.| |--  ||..
T Consensus       134 ~~-------------~L~~aV~~r~nilVsGgTGSGKTTllnaL~~~i-~~~~p~e-RivtIEDt~--EL~~  188 (323)
T PRK13833        134 AS-------------TIRSAISSRLNIVISGGTGSGKTTLANAVIAEI-VASAPED-RLVILEDTA--EIQC  188 (323)
T ss_pred             HH-------------HHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHH-CCCCCHH-EEEEECCCC--CCCC
T ss_conf             99-------------999999818968999177775689999999864-0289323-399945750--1146


No 39 
>COG0433 HerA helicase [Replication, recombination, and repair]
Probab=97.43  E-value=0.00013  Score=50.63  Aligned_cols=73  Identities=23%  Similarity=0.434  Sum_probs=57.9

Q ss_pred             EEEEHHHHHHHHHHC-CHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHC
Q ss_conf             999844568767531-035899999999964201358999851654444146788505630572036811100326
Q gi|254780606|r  531 IVIIVDEMADLMMVA-GKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTIL  605 (744)
Q Consensus       531 ivvviDE~a~l~~~~-~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il  605 (744)
                      ++++|||...+.-.. .......+.++|+.||..|+.|+++||||+  .|...+..|..++|.|+..+..|-+.+.
T Consensus       393 ~~~iieea~~~~p~~~~~~~~~~~~~iar~gRk~~v~l~~~tQrps--~l~~~v~~~~~tkii~r~~~~~d~~~~~  466 (520)
T COG0433         393 LLIVIEEAHNFAPSSRKAPVKDIIERIAREGRKFGVGLVLATQRPS--DLDDLVLSQANTKIILRLVEPTDQKYIS  466 (520)
T ss_pred             CCEEHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECHH--HCCHHHHHCCCHHHHHCCCCCHHHHHHH
T ss_conf             4114077776387554214689999999860723541357886767--6307898610349774057822366656


No 40 
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=97.40  E-value=0.0084  Score=38.21  Aligned_cols=140  Identities=20%  Similarity=0.272  Sum_probs=70.9

Q ss_pred             HHHHHHHCCCCEEEEEEEECCCEEEE-E--EECCCCCCHHHHHHHHHHHHHHHCC---------------CCCEE-EEEC
Q ss_conf             99987403551389867648925899-9--7548886399998599999987147---------------76327-7518
Q gi|254780606|r  297 LETILEEFGIKGEIINVNPGPVVTLY-E--FEPAPGIKSSRVIGLADDIARSMSS---------------LSARV-AVIP  357 (744)
Q Consensus       297 l~~~l~~~~~~~~~~~~~~gp~~~~~-~--~~~~~g~~~~~~~~~~~d~~~~~~~---------------~~~~~-~~~p  357 (744)
                      |+..|++=+|.=-.+| .+|-+..-- -  .+....+....+.++..-||.....               .+-|+ +.+|
T Consensus        27 l~~~L~Dp~VtEI~iN-~~~~Vwver~G~~~~~~~~l~~~~~~~~i~~lA~~~g~~i~~~~Pi~da~Lp~dG~R~~~~~p  105 (320)
T PRK13894         27 LLAALNDPKTVEIMLN-ADGKLWLERLGEPMRCIGTLRVAQAQAIIETIAGYHGKEVTRSKPILEGELPLDGSRFAGQLP  105 (320)
T ss_pred             HHHHHCCCCCEEEEEC-CCCEEEEEECCEEEECCCCCCHHHHHHHHHHHHHHHCCEECCCCCEEEEEECCCCEEEEEECC
T ss_conf             9997179996799986-999599994890585167689999999999999980987467896699990899889999878


Q ss_pred             ---CCCEEEEECCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHH-HCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             ---98345442688888707658751281211467836898420578873211201-14846997078753447999999
Q gi|254780606|r  358 ---KRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLA-NMPHILVAGTTGSGKSVAINTMI  433 (744)
Q Consensus       358 ---g~~~~~~~~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~-~~PH~lvaG~TgsGKS~~l~~~i  433 (744)
                         ....+.|..+...  ...|.|++++..|.....             .++.... .--.+||+|.||||||.|||+++
T Consensus       106 P~~~~~~~sIRk~~~~--~~tL~dlv~~G~~~~~~a-------------~~L~~~V~~r~nilI~G~TgsGKTTll~all  170 (320)
T PRK13894        106 PVVPAPTFAIRKKAVA--IFTLDQYVERGIMTAEQR-------------EAIIAAVRAHRNILVIGGTGSGKTTLVNAII  170 (320)
T ss_pred             CCCCCCEEEEECCCCC--CCCHHHHHHCCCCCHHHH-------------HHHHHHHHCCCCEEEECCCCCCHHHHHHHHH
T ss_conf             8789965999686899--999999987699999999-------------9999999728758998588865689999998


Q ss_pred             HHHHHHCCHHHEEEEEE-CCCC
Q ss_conf             99998568011079997-2342
Q gi|254780606|r  434 MSLLYRLRPDECRMIMV-DPKM  454 (744)
Q Consensus       434 ~sl~~~~~p~~~~~~li-D~k~  454 (744)
                      ..+.+ +.|.+ |++.| |.-.
T Consensus       171 ~~i~~-~~p~e-RivtIED~~E  190 (320)
T PRK13894        171 NEMVI-QDPTE-RVFIIEDTGE  190 (320)
T ss_pred             HHHCC-CCCCC-CEEEECCHHH
T ss_conf             63202-69520-1775258788


No 41 
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]
Probab=97.40  E-value=0.0037  Score=40.63  Aligned_cols=191  Identities=19%  Similarity=0.344  Sum_probs=90.8

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             01148469970787534479999999999856801107999723421000125775200004444178768999999866
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREM  488 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em  488 (744)
                      +.+.+-++|.|.||||||+-|--+++..-+   -..-++.+.+|.++.                    |..+-..+.+||
T Consensus        62 i~~~~vvii~getGsGKTTqlP~~lle~g~---~~~g~I~~tQPRRlA--------------------ArsvA~RvAeel  118 (845)
T COG1643          62 IEQNQVVIIVGETGSGKTTQLPQFLLEEGL---GIAGKIGCTQPRRLA--------------------ARSVAERVAEEL  118 (845)
T ss_pred             HHHCCEEEEECCCCCCHHHHHHHHHHHHHC---CCCCEEEECCCHHHH--------------------HHHHHHHHHHHH
T ss_conf             986978998679988758788999996001---668759965843899--------------------999999999983


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHCCCCC-------------CCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             7699999980778679999988642026776-------------665432338679998445687675310358999999
Q gi|254780606|r  489 EERYRKMSHLSVRNIKSYNERISTMYGEKPQ-------------GCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQR  555 (744)
Q Consensus       489 ~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~-------------~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~  555 (744)
                      ...        +...-+|.-|+...-.....             .....+.  -|=+|||||+.+-.... +..-.++.+
T Consensus       119 ~~~--------~G~~VGY~iRfe~~~s~~Trik~mTdGiLlrei~~D~~Ls--~ys~vIiDEaHERSl~t-DilLgllk~  187 (845)
T COG1643         119 GEK--------LGETVGYSIRFESKVSPRTRIKVMTDGILLREIQNDPLLS--GYSVVIIDEAHERSLNT-DILLGLLKD  187 (845)
T ss_pred             CCC--------CCCEEEEEEEEECCCCCCCEEEEECCHHHHHHHHHCCCCC--CCCEEEEECHHHHHHHH-HHHHHHHHH
T ss_conf             898--------6765437999622678771468951479999984380204--58779970133556888-999999999


Q ss_pred             HHHHHHCCEEEEEEEECCCCCCCCHHHHHH---------CCCCEEEEECCCHHHCC------HHCCCCCHHHHCCCCCEE
Q ss_conf             999642013589998516544441467885---------05630572036811100------326763168856898468
Q gi|254780606|r  556 LAQMARAAGIHLIMATQRPSVDVITGTIKA---------NFPIRISFQVTSKIDSR------TILGEHGAEQLLGRGDML  620 (744)
Q Consensus       556 la~~~ra~GihlilatQrp~~~vi~~~ik~---------n~~~ri~~~v~~~~dsr------~il~~~gae~l~g~gd~l  620 (744)
                      +.. .|---..+|+-+=.-+++-+...+..         -||.-|-|.-....|.+      .+++..   .-.+.||-|
T Consensus       188 ~~~-~rr~DLKiIimSATld~~rfs~~f~~apvi~i~GR~fPVei~Y~~~~~~d~~l~~ai~~~v~~~---~~~~~GdIL  263 (845)
T COG1643         188 LLA-RRRDDLKLIIMSATLDAERFSAYFGNAPVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAVDIH---LREGSGSIL  263 (845)
T ss_pred             HHH-HCCCCCEEEEEECCCCHHHHHHHCCCCCEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHH---CCCCCCCEE
T ss_conf             986-4688705999725358899997628998787558866447886577775136999999999996---368999889


Q ss_pred             -EECCCCCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             -646898438999343898899999999984
Q gi|254780606|r  621 -YMSGGGRIQRVHGPLVSDIEIEKVVQHLKK  650 (744)
Q Consensus       621 -~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~  650 (744)
                       |++|             ..||+++++.+.+
T Consensus       264 vFLpG-------------~~EI~~~~~~L~~  281 (845)
T COG1643         264 VFLPG-------------QREIERTAEWLEK  281 (845)
T ss_pred             EECCC-------------HHHHHHHHHHHHH
T ss_conf             97786-------------8999999999973


No 42 
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=97.40  E-value=0.0022  Score=42.19  Aligned_cols=76  Identities=22%  Similarity=0.255  Sum_probs=42.5

Q ss_pred             CCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCC-CCH----HHHCCCCCEEEEC----CC-CCEEEE-EECCCCHHH
Q ss_conf             165444414678850563057203681110032676-316----8856898468646----89-843899-934389889
Q gi|254780606|r  572 QRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGE-HGA----EQLLGRGDMLYMS----GG-GRIQRV-HGPLVSDIE  640 (744)
Q Consensus       572 Qrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~-~ga----e~l~g~gd~l~~~----~~-~~~~r~-~~~~~~~~~  640 (744)
                      ..++.+.+.-+|-.-||-|||.+-.+  ++|-.|-. .||    ..-|.+-++|...    ++ +.-.|+ .++=++.++
T Consensus       484 ~~~~~~~~g~lla~AfPDRIArrRg~--~gry~LanGrga~L~~~d~L~~~ewLvaadl~~~~~~~~~rI~lAa~i~~~~  561 (812)
T PRK11664        484 GEVDSSLIAPLLALAFPDRIARRRGQ--DGRYQLANGMGAMLDADDALSRHEWLVAPLLLQGSASPDARILLALPLDIDE  561 (812)
T ss_pred             CCCCHHHHHHHHHHHCHHHHHHHHCC--CCCEEEECCCEEEECCCCCCCCCCCEEEEEECCCCCCCHHEEEEECCCCHHH
T ss_conf             89986789999999785999886189--9867972687588788877778885899981367877522188626889999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999998
Q gi|254780606|r  641 IEKVVQHLK  649 (744)
Q Consensus       641 ~~~~~~~~~  649 (744)
                      ++......-
T Consensus       562 l~~~~~~~i  570 (812)
T PRK11664        562 LVQRCPQLV  570 (812)
T ss_pred             HHHHHHHHC
T ss_conf             998867562


No 43 
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a
Probab=97.31  E-value=0.006  Score=39.20  Aligned_cols=145  Identities=17%  Similarity=0.237  Sum_probs=72.1

Q ss_pred             CCCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCE
Q ss_conf             46783689842057887321120114846997078753447999999999985680110799972342100012577520
Q gi|254780606|r  387 HSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHL  466 (744)
Q Consensus       387 ~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~  466 (744)
                      +..++|-...+.+.-.+-+.++ ..-.-++|-|.-.||||++|+++.+..++...-   -++-.+ +...+..|+.   +
T Consensus         4 ~~rHPll~~~~~~~V~Ndi~l~-~~~~~~iiTGpN~sGKSt~lk~i~l~~iLAq~G---~~vpa~-~~~~~~~~d~---i   75 (200)
T cd03280           4 EARHPLLPLQGEKVVPLDIQLG-ENKRVLVITGPNAGGKTVTLKTLGLLTLMAQSG---LPIPAA-EGSSLPVFEN---I   75 (200)
T ss_pred             CCCCCEEECCCCCEECCEEEEC-CCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHC---CCEEEC-CCEECCCCCE---E
T ss_conf             7728859757895476258977-993399998898775099999999999999977---780011-0047266567---8


Q ss_pred             EEEEEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC
Q ss_conf             00044441787689999998667699999980778679999988642026776665432338679998445687675310
Q gi|254780606|r  467 LTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG  546 (744)
Q Consensus       467 ~~~v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~  546 (744)
                      ++. +.+.+.....+-....||.+-..++....                             ..-+|++||+.-  -+..
T Consensus        76 ~~~-i~~~d~~~~~~S~F~~E~~~~~~il~~~~-----------------------------~~sLvliDE~~~--gTn~  123 (200)
T cd03280          76 FAD-IGDEQSIEQSLSTFSSHMKNIARILQHAD-----------------------------PDSLVLLDELGS--GTDP  123 (200)
T ss_pred             EEE-ECCCCCHHHHHHHHHHHHHHHHHHHHHCC-----------------------------CCCEEEECCCCC--CCCH
T ss_conf             888-46733666778799999999999998588-----------------------------888797556668--9887


Q ss_pred             HHHH----HHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             3589----9999999964201358999851654
Q gi|254780606|r  547 KEIE----GAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       547 ~~~e----~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .|-.    ..+..|.+    .+.+.|++|-...
T Consensus       124 ~eg~~~a~a~l~~l~~----~~~~~i~tTH~~e  152 (200)
T cd03280         124 VEGAALAIAILEELLE----RGALVIATTHYGE  152 (200)
T ss_pred             HHHHHHHHHHHHHHHH----CCCEEEEECCCHH
T ss_conf             8999999999999985----7997999897178


No 44 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=97.31  E-value=0.001  Score=44.52  Aligned_cols=83  Identities=22%  Similarity=0.473  Sum_probs=52.4

Q ss_pred             CEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHC---
Q ss_conf             67999844568767531035899999999964201358999851654444146788505630572036811100326---
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTIL---  605 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il---  605 (744)
                      +|-|||+||...|.    .+...++.++-..- +-..++||+|.+++ .++.. |+.-. .++-|+--+..+=+..|   
T Consensus       125 ~~KiiIlDEad~lt----~~Aq~aLlk~lEe~-~~~~~fIl~t~~~~-~ii~t-I~SRC-~~i~F~~~s~~~i~~~L~~I  196 (337)
T PRK12402        125 DYKLILFDNAEALR----EDAQQALRRIMERY-SETCRFIFSTTQPS-KLIPP-IRSRC-LPLFFRPVPDDEIRSVLESI  196 (337)
T ss_pred             CEEEEEEECCCCCC----HHHHHHHHHHHHCC-CCCEEEEEECCCCC-CCCHH-HHHHC-EEEECCCCCHHHHHHHHHHH
T ss_conf             80499970713179----99999999887408-87669987238644-47524-77624-45435898999999999999


Q ss_pred             --------CCCCHHHH--CCCCCE
Q ss_conf             --------76316885--689846
Q gi|254780606|r  606 --------GEHGAEQL--LGRGDM  619 (744)
Q Consensus       606 --------~~~gae~l--~g~gd~  619 (744)
                              +..+.+.|  ...|||
T Consensus       197 ~~~E~i~~~~~~l~~ia~~s~Gdl  220 (337)
T PRK12402        197 AAAEGVEISDDGLDLIAYYAEGDL  220 (337)
T ss_pred             HHHCCCCCCHHHHHHHHHHCCCCH
T ss_conf             998499989999999999869989


No 45 
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family.
Probab=97.26  E-value=0.002  Score=42.48  Aligned_cols=121  Identities=17%  Similarity=0.217  Sum_probs=70.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999856801107999723421000125775200004444178768999999866769999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRK  494 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~  494 (744)
                      ++|-|.-.||||++|+++.+..++.+.=   -+  +=.+...+..|+.+-   + .+.+.+....-+-....||.+-...
T Consensus         2 ~iiTGpN~sGKSt~lk~i~l~~~laq~G---~~--vpa~~~~~~~~d~i~---~-~i~~~d~~~~~~S~F~~e~~~~~~i   72 (185)
T smart00534        2 VIITGPNMGGKSTYLRQVGLIVIMAQIG---SF--VPAESAELPVFDRIF---T-RIGASDSLAQGLSTFMVEMKETANI   72 (185)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHC---CC--EEECCCEEECCCEEE---E-EECCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             8997999884899999999999999978---88--615771995031002---3-3564100215641899999999999


Q ss_pred             HHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHH-HHHHHHCCEEEEEEEECC
Q ss_conf             9980778679999988642026776665432338679998445687675310358999999-999642013589998516
Q gi|254780606|r  495 MSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQR-LAQMARAAGIHLIMATQR  573 (744)
Q Consensus       495 ~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~-la~~~ra~GihlilatQr  573 (744)
                      +...+                             ..-+|++||+..  -+...|-...... |-.+....|.+.|++|-.
T Consensus        73 l~~~~-----------------------------~~sLvliDEl~~--GT~~~eg~ala~aile~l~~~~~~~~iitTH~  121 (185)
T smart00534       73 LKNAT-----------------------------ENSLVLLDELGR--GTSTYDGVAIAAAVLEYLLEKIGALTLFATHY  121 (185)
T ss_pred             HHHCC-----------------------------CCEEEEECCCCC--CCCHHHHHHHHHHHHHHHHHCCCCEEEEEECH
T ss_conf             98389-----------------------------873763041136--88814789999999999996369759986043


Q ss_pred             CC
Q ss_conf             54
Q gi|254780606|r  574 PS  575 (744)
Q Consensus       574 p~  575 (744)
                      ..
T Consensus       122 ~e  123 (185)
T smart00534      122 HE  123 (185)
T ss_pred             HH
T ss_conf             78


No 46 
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]
Probab=97.24  E-value=0.0017  Score=42.95  Aligned_cols=113  Identities=26%  Similarity=0.379  Sum_probs=65.6

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC--------------------CCEECCCC----------
Q ss_conf             484699707875344799999999998568011079997234--------------------21000125----------
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK--------------------MLELSVYD----------  461 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k--------------------~~~~~~~~----------  461 (744)
                      .=|++|.-.||||||.+-+--|+..+++..-.  +.+++-|=                    ++.++.|+          
T Consensus        85 G~~vvVtTgTgSGKTe~FllPIld~~l~~~~a--~AL~lYPtnALa~DQ~~rl~~~~~~~~~~v~~~~y~Gdt~~~~r~~  162 (851)
T COG1205          85 GRNVVVTTGTGSGKTESFLLPILDHLLRDPSA--RALLLYPTNALANDQAERLRELISDLPGKVTFGRYTGDTPPEERRA  162 (851)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHCCCCC--EEEEEECHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
T ss_conf             99889978998854589899999998308665--0899804377676699999999984787513544348896788899


Q ss_pred             ---CCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH
Q ss_conf             ---77520000444417876899999986676999999807786799999886420267766654323386799984456
Q gi|254780606|r  462 ---GIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEM  538 (744)
Q Consensus       462 ---~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~  538 (744)
                         +-||.   ++||++.....|                  .|+-..|.-...               .|  -+||+||+
T Consensus       163 ~~~~pp~I---llTNpdMLh~~l------------------lr~~~~~~~~~~---------------~L--k~lVvDEl  204 (851)
T COG1205         163 IIRNPPDI---LLTNPDMLHYLL------------------LRNHDAWLWLLR---------------NL--KYLVVDEL  204 (851)
T ss_pred             HHHCCCCE---EEECHHHHHHHH------------------HCCCCCHHHHHH---------------CC--CEEEEECC
T ss_conf             87389978---983889998986------------------368822788873---------------27--58998444


Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHCCE
Q ss_conf             87675310358999999999642013
Q gi|254780606|r  539 ADLMMVAGKEIEGAIQRLAQMARAAG  564 (744)
Q Consensus       539 a~l~~~~~~~~e~~~~~la~~~ra~G  564 (744)
                      .-.--..+.++--.+-||-++.|..|
T Consensus       205 HtYrGv~GS~vA~llRRL~~~~~~~~  230 (851)
T COG1205         205 HTYRGVQGSEVALLLRRLLRRLRRYG  230 (851)
T ss_pred             EECCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             12156037889999999999972458


No 47 
>PRK04328 hypothetical protein; Provisional
Probab=97.17  E-value=0.0088  Score=38.06  Aligned_cols=138  Identities=13%  Similarity=0.225  Sum_probs=68.6

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC-----------CCEECCCCCCCCEEEEEEE---C-HH
Q ss_conf             1484699707875344799999999998568011079997234-----------2100012577520000444---4-17
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK-----------MLELSVYDGIPHLLTPVVT---N-PK  475 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k-----------~~~~~~~~~~ph~~~~v~~---~-~~  475 (744)
                      +.=-.||+|.+|+|||.|-..++..-+.+  -+.+-++-++-.           +.++..|.....+.  +++   . ..
T Consensus        23 ~gs~~Lv~G~pGtGKT~la~qFl~~g~~~--GE~~lyis~eE~~~~l~~~~~~~G~d~~~~~~~g~l~--iid~~~~~~~   98 (250)
T PRK04328         23 ERNVVLLSGGPGTGKSIFSQQFLWNGLQM--GEPGIYVALEEHPVQVRRNMAQFGWDVRKYEEEGKFA--IVDAFTGGIG   98 (250)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHHHHHC--CCCEEEEEEECCHHHHHHHHHHCCCCHHHHHHCCCEE--EEECCCCCCC
T ss_conf             99699998289999899999999999876--9977999972799999999998099868986569779--9851233334


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             87689999998667699999980778679999988642026776665432338679998445687675310358999999
Q gi|254780606|r  476 KAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQR  555 (744)
Q Consensus       476 ~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~  555 (744)
                      .+....++...+.            .++..+-..+...-    +..      -+. .||||-+..|.+.........+.+
T Consensus        99 ~~~~~~~~~~~~~------------~~~~~~~~~l~~~i----~~~------~~~-rvVIDSit~l~~~~~~~~r~~l~~  155 (250)
T PRK04328         99 EAAEREKYVVKDP------------DDVRELIDVLRQAI----RDI------GAK-RVVIDSVSTLYLTKPAVARSIVMQ  155 (250)
T ss_pred             CCCHHHHHCCCCC------------CCHHHHHHHHHHHH----HHH------CCC-EEEEECCHHHHHCCHHHHHHHHHH
T ss_conf             2000001013685------------35999999999999----851------898-899937078774585889999999


Q ss_pred             HHHHHHCCEEEEEEEECCCC
Q ss_conf             99964201358999851654
Q gi|254780606|r  556 LAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       556 la~~~ra~GihlilatQrp~  575 (744)
                      |.+.-+..|+-.++.++.+.
T Consensus       156 l~~~l~~~g~Ttll~~e~~~  175 (250)
T PRK04328        156 LKRVLAGLGCTSIFVSQVSV  175 (250)
T ss_pred             HHHHHHHCCCEEEEEECCCC
T ss_conf             99999868986999971003


No 48 
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=97.16  E-value=0.0095  Score=37.86  Aligned_cols=119  Identities=18%  Similarity=0.242  Sum_probs=70.9

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100012577520000444417876899999986676999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYR  493 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~  493 (744)
                      .++|-|.-.||||++|+++.+..++.+.--     .|=-+..++..|+.+   ++ -+.+.+.....+-....||.+-..
T Consensus        32 ~~iiTGpN~sGKSt~lk~i~l~~ilaq~G~-----~vpA~~~~~~~~d~i---~~-~i~~~d~~~~~~StF~~e~~~~~~  102 (218)
T cd03286          32 ILVLTGPNMGGKSTLLRTVCLAVIMAQMGM-----DVPAKSMRLSLVDRI---FT-RIGARDDIMKGESTFMVELSETAN  102 (218)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHCCC-----CEECCCCEEECCCEE---EE-EECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             899989998873899999999999998288-----430146477346648---99-745866143115069999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHH----HHHHHHHHHHHCCEEEEEE
Q ss_conf             999807786799999886420267766654323386799984456876753103589----9999999964201358999
Q gi|254780606|r  494 KMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIE----GAIQRLAQMARAAGIHLIM  569 (744)
Q Consensus       494 ~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e----~~~~~la~~~ra~Gihlil  569 (744)
                      .+...+                             +.-+|++||+..  -+...|-.    ..+..|+   ...+.+.|+
T Consensus       103 il~~~~-----------------------------~~sLvllDE~~~--GT~~~eg~ala~aile~L~---~~~~~~~i~  148 (218)
T cd03286         103 ILRHAT-----------------------------PDSLVILDELGR--GTSTHDGYAIAHAVLEYLV---KKVKCLTLF  148 (218)
T ss_pred             HHHHCC-----------------------------CCCCEECCCCCC--CCCCHHHHHHHHHHHHHHH---HCCCCEEEE
T ss_conf             998679-----------------------------985010255468--9981167999999999998---637976999


Q ss_pred             EECCCC
Q ss_conf             851654
Q gi|254780606|r  570 ATQRPS  575 (744)
Q Consensus       570 atQrp~  575 (744)
                      +|-...
T Consensus       149 tTH~~e  154 (218)
T cd03286         149 STHYHS  154 (218)
T ss_pred             ECCCHH
T ss_conf             767289


No 49 
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion. These proteins aid the transfer of DNA from the plasmid into the host bacterial chromosome. They contain an ATP binding domain. VirD4 is involved in DNA transfer to plant cells and is required for virulence.
Probab=97.16  E-value=0.00048  Score=46.72  Aligned_cols=69  Identities=20%  Similarity=0.314  Sum_probs=48.3

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC-CC-----CHHHHHHCCCCEEEEECCCHHHCCH
Q ss_conf             79998445687675310358999999999642013589998516544-44-----1467885056305720368111003
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV-DV-----ITGTIKANFPIRISFQVTSKIDSRT  603 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~-~v-----i~~~ik~n~~~ri~~~v~~~~dsr~  603 (744)
                      .+++++|||+-+-     .+. .+.++...+|+.||+++++.|-.+- +.     -...|.+|+.++|.|++.+..+-+.
T Consensus       264 ~v~~~lDEf~nl~-----~ip-~l~~~ls~~Rs~Gi~~~~~~Qs~~Ql~~~YG~~~~~~i~~n~~~~i~~~~~d~~ta~~  337 (384)
T cd01126         264 RVLFLLDEFPLLG-----KLE-TFEKAIAIMAGYGIRLLLIFQSLAQLEGTYGDAGASSFLSNCGVRLFFAVNDYETARY  337 (384)
T ss_pred             CEEEEEECHHHCC-----CHH-HHHHHHHHHHCCCEEEEEEEECHHHHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHH
T ss_conf             5599986611017-----738-8999999874289199999954999998855617999996078499925899899999


Q ss_pred             H
Q ss_conf             2
Q gi|254780606|r  604 I  604 (744)
Q Consensus       604 i  604 (744)
                      +
T Consensus       338 ~  338 (384)
T cd01126         338 I  338 (384)
T ss_pred             H
T ss_conf             9


No 50 
>pfam05621 TniB Bacterial TniB protein. This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.
Probab=97.14  E-value=0.0015  Score=43.36  Aligned_cols=222  Identities=13%  Similarity=0.183  Sum_probs=111.9

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEE--EECH-HHHHHHHHHHH-
Q ss_conf             1148469970787534479999999999856801107999723421000125775200004--4441-78768999999-
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPV--VTNP-KKAVMALKWAV-  485 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v--~~~~-~~~~~~l~~~~-  485 (744)
                      ..||.+|+.|-||.|||..++-..-    .|.+.      .|...      ..+|-+....  --|. .-....|..+. 
T Consensus        59 ~Rmp~lLlvGdsnnGKT~Iv~rF~~----~hp~~------~d~~~------~~~PVl~vq~P~~p~~~~lY~~IL~~l~a  122 (302)
T pfam05621        59 QRMPNLLLVGPTNNGKSMIVEKFRR----AHPAG------SDADQ------EHIPVLVVQMPSEPSVIRFYVALLAAMGA  122 (302)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHH----HCCCC------CCCCC------CCCEEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             6887558870798878999999999----67998------78666------70218999769998868999999998378


Q ss_pred             --------HHHHHH-HHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             --------866769-99999807786799999886420267766654323386799984456876753103589999999
Q gi|254780606|r  486 --------REMEER-YRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRL  556 (744)
Q Consensus       486 --------~em~~r-~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~l  556 (744)
                              .+++.+ ..+|...+                              .-++||||+.-++.....+-...+.-|
T Consensus       123 P~~~~~~~~~~~~~~~~ll~~~~------------------------------vrmLIIDEiHnlL~Gs~~~qr~~ln~L  172 (302)
T pfam05621       123 PLRPRPRLPEMEQLALALLRKVG------------------------------VRMLVIDELHNVLAGNSVNRREFLNLL  172 (302)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCC------------------------------CCEEEEECHHHHCCCCHHHHHHHHHHH
T ss_conf             77888778999999999999749------------------------------878998543656048688999999999


Q ss_pred             HHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEEECCCCCEEEEEECCC
Q ss_conf             99642013589998516544441467885056305720368111003267631688568984686468984389993438
Q gi|254780606|r  557 AQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLV  636 (744)
Q Consensus       557 a~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~~~~~~~~~r~~~~~~  636 (744)
                      -.+|..+-|-+|++--+=-.+              +|+...+..||              =+...++.          |=
T Consensus       173 K~L~Nel~IpiV~vGt~eA~~--------------ai~tD~QlasR--------------F~~~~Lp~----------W~  214 (302)
T pfam05621       173 RFLGNELRIPLVGVGTRDAYL--------------AIRSDDQLENR--------------FEPMLLPP----------WE  214 (302)
T ss_pred             HHHHHCCCCCEEEECCHHHHH--------------HHHCCHHHHHH--------------CCCCCCCC----------CC
T ss_conf             998636587869953199999--------------97068888850--------------58611688----------88


Q ss_pred             CHHHHHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHH
Q ss_conf             988999999999840---88753111124555544445667777777660389999999974986232200000100789
Q gi|254780606|r  637 SDIEIEKVVQHLKKQ---GCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNR  713 (744)
Q Consensus       637 ~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~s~~qr~~~~g~~r  713 (744)
                      -|+|-.+++.-+..-   .+++++..-......-   ...+| ...+--.|+.+|+...+++|+--++            
T Consensus       215 ~d~ef~~LL~sfe~~LPL~~~S~L~~~~~a~~I~---~~SeG-~iGei~~Ll~~aA~~AI~sG~E~It------------  278 (302)
T pfam05621       215 ANDDCCSLLASFAASLPLRRPSPIATLDMARYLL---TRSEG-TIGELAHLLMAAAIAAVESGEEAIN------------  278 (302)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHH---HHCCC-CHHHHHHHHHHHHHHHHHCCCCCCC------------
T ss_conf             9808999999999868887776888899999999---98599-2879999999999999847871008------------


Q ss_pred             HHHHHHHHHHCCCCCHHHCCCC
Q ss_conf             9999999998797570216886
Q gi|254780606|r  714 AALLVERMEQEGLVSEADHVGK  735 (744)
Q Consensus       714 a~~~~~~~e~~g~~~~~~~~~~  735 (744)
                          .+.+++.++|+|.++-+.
T Consensus       279 ----~~~l~~~~~i~ps~r~r~  296 (302)
T pfam05621       279 ----HRTLSMADYIGPSERRRQ  296 (302)
T ss_pred             ----HHHHHHCCCCCCCCCCCH
T ss_conf             ----999966798683334306


No 51 
>KOG0926 consensus
Probab=97.13  E-value=0.0021  Score=42.31  Aligned_cols=243  Identities=20%  Similarity=0.317  Sum_probs=118.7

Q ss_pred             CCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             88887076587512812114678368984205788732112011484699707875344799999999998568011079
Q gi|254780606|r  368 NETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       368 ~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      +..|+++|. .+-.+...+++...|||..-    -.-++.-+...|-++|+|.|||||++-|--.+.--=|. +++    
T Consensus       232 ~~~~~a~yV-~V~R~~EIQ~sR~~LPI~ae----Eq~IMEaIn~n~vvIIcGeTGsGKTTQvPQFLYEAGf~-s~~----  301 (1172)
T KOG0926         232 ACRRKAFYV-IVSRPAEIQESRLDLPIVAE----EQRIMEAINENPVVIICGETGSGKTTQVPQFLYEAGFA-SEQ----  301 (1172)
T ss_pred             CCCCCCEEE-EECCCHHHHHHHHCCCHHHH----HHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHCCCC-CCC----
T ss_conf             545530799-84485788887751763678----99999986228749995488888644341899871347-766----


Q ss_pred             EEECCCCCEECCCCCCCCEEEEEEECHHHHHHH--HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH-----CCCC--
Q ss_conf             997234210001257752000044441787689--9999986676999999807786799999886420-----2677--
Q gi|254780606|r  448 IMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMA--LKWAVREMEERYRKMSHLSVRNIKSYNERISTMY-----GEKP--  518 (744)
Q Consensus       448 ~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~--l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~-----~~~~--  518 (744)
                                  +.. +.+++  ||.+...+..  -+.+..||-.       +  ..-.+|--|+....     ..+.  
T Consensus       302 ------------~~~-~gmIG--ITqPRRVAaiamAkRVa~EL~~-------~--~~eVsYqIRfd~ti~e~T~IkFMTD  357 (1172)
T KOG0926         302 ------------SSS-PGMIG--ITQPRRVAAIAMAKRVAFELGV-------L--GSEVSYQIRFDGTIGEDTSIKFMTD  357 (1172)
T ss_pred             ------------CCC-CCEEE--ECCCHHHHHHHHHHHHHHHHCC-------C--CCCEEEEEEECCCCCCCCEEEEECC
T ss_conf             ------------799-87054--0572278999999999998525-------7--6411489985365688740477402


Q ss_pred             ----CCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCC----------EEEEEEEECCCCCC-------
Q ss_conf             ----666543233867999844568767531035899999999964201----------35899985165444-------
Q gi|254780606|r  519 ----QGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAA----------GIHLIMATQRPSVD-------  577 (744)
Q Consensus       519 ----~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~----------GihlilatQrp~~~-------  577 (744)
                          +....|+----|=||||||-.+-.+. .+-.-+++.||..+-+-.          -.-+.-||=|-+ |       
T Consensus       358 GVLLrEi~~DflL~kYSvIIlDEAHERSvn-TDILiGmLSRiV~LR~k~~ke~~~~kpLKLIIMSATLRVs-DFtenk~L  435 (1172)
T KOG0926         358 GVLLREIENDFLLTKYSVIILDEAHERSVN-TDILIGMLSRIVPLRQKYYKEQCQIKPLKLIIMSATLRVS-DFTENKRL  435 (1172)
T ss_pred             HHHHHHHHHHHHHHHCEEEEECHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEEC-CCCCCCEE
T ss_conf             388999887675542015785125430312-7899999988778889976641356761699974147711-02467542


Q ss_pred             --CCHHHHH---HCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCC
Q ss_conf             --4146788---50563057203681110032676316885689846864689843899934389889999999998408
Q gi|254780606|r  578 --VITGTIK---ANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQG  652 (744)
Q Consensus       578 --vi~~~ik---~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~  652 (744)
                        +++.+||   -+||.-|-|.-.+..|.-   +  .|..-.-+=+ --++.|+=++.+-|    ..||+.+|..++...
T Consensus       436 Fpi~pPlikVdARQfPVsIHF~krT~~DYi---~--eAfrKtc~IH-~kLP~G~ILVFvTG----QqEV~qL~~kLRK~~  505 (1172)
T KOG0926         436 FPIPPPLIKVDARQFPVSIHFNKRTPDDYI---A--EAFRKTCKIH-KKLPPGGILVFVTG----QQEVDQLCEKLRKRF  505 (1172)
T ss_pred             CCCCCCEEEEECCCCCEEEEECCCCCCHHH---H--HHHHHHHHHH-HCCCCCCEEEEEEC----HHHHHHHHHHHHHHC
T ss_conf             478996055304528568873267984178---9--9999999886-10899827999807----589999999998648


Q ss_pred             CCCC
Q ss_conf             8753
Q gi|254780606|r  653 CPEY  656 (744)
Q Consensus       653 ~~~~  656 (744)
                      .-.|
T Consensus       506 p~~f  509 (1172)
T KOG0926         506 PESF  509 (1172)
T ss_pred             CCCC
T ss_conf             4102


No 52 
>pfam00488 MutS_V MutS domain V. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters.
Probab=97.10  E-value=0.0081  Score=38.30  Aligned_cols=132  Identities=16%  Similarity=0.169  Sum_probs=74.4

Q ss_pred             CCEEECCHHHC---CC-EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHH
Q ss_conf             87321120114---84-699707875344799999999998568011079997234210001257752000044441787
Q gi|254780606|r  402 GESVIADLANM---PH-ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKA  477 (744)
Q Consensus       402 g~~~~~dl~~~---PH-~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~  477 (744)
                      .++|--|+.=.   ++ ++|-|.-.||||++|+++-+..++.+.-     ..|-.+..++..|+.+   ++ -+.+.+..
T Consensus        28 ~~~VpNdi~l~~~~~~~~iiTGpN~sGKSt~Lk~igl~~~lAq~G-----~~VPA~~a~~~~~d~I---~~-~i~~~dsl   98 (234)
T pfam00488        28 ENFVPNDVSLGKERSRILLITGPNMGGKSTYLRQVALIVIMAQIG-----SFVPAESARIGIVDRI---FT-RIGASDDL   98 (234)
T ss_pred             CCEECCEEEECCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHC-----CCEEECCEEEECCCEE---EE-EECCCCHH
T ss_conf             976876589779961699997887776199999999999999836-----8742220599636559---99-85675334


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHH----HHH
Q ss_conf             6899999986676999999807786799999886420267766654323386799984456876753103589----999
Q gi|254780606|r  478 VMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIE----GAI  553 (744)
Q Consensus       478 ~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e----~~~  553 (744)
                      ..-+-....||.+-...+.....                             .-+|++||+..  -+...|-.    ..+
T Consensus        99 ~~~~StF~~e~~~~~~il~~~~~-----------------------------~sLvliDEl~~--GT~~~eg~al~~ail  147 (234)
T pfam00488        99 ASGRSTFMVEMLETANILHNATD-----------------------------KSLVILDELGR--GTSTYDGLAIAWAVA  147 (234)
T ss_pred             HCCCCHHHHHHHHHHHHHHHCCC-----------------------------CCEECCCCCCC--CCCHHHHHHHHHHHH
T ss_conf             46611799999999999973887-----------------------------73220142458--998346799999999


Q ss_pred             HHHHHHHHCCEEEEEEEECCCCC
Q ss_conf             99999642013589998516544
Q gi|254780606|r  554 QRLAQMARAAGIHLIMATQRPSV  576 (744)
Q Consensus       554 ~~la~~~ra~GihlilatQrp~~  576 (744)
                      ..|.++   .|...|++|-....
T Consensus       148 e~L~~~---~~~~~i~tTH~~~L  167 (234)
T pfam00488       148 EHLAEK---IRARTLFATHYHEL  167 (234)
T ss_pred             HHHHHH---CCCEEEEEECHHHH
T ss_conf             999973---59779997135779


No 53 
>PRK10436 hypothetical protein; Provisional
Probab=97.08  E-value=0.00089  Score=44.91  Aligned_cols=145  Identities=23%  Similarity=0.279  Sum_probs=73.6

Q ss_pred             CCCCEEEEEEEECCCEEEEEEECC---------CCC----CHHHHHHHHH-HHHHHHCCCCCEEE-EECCCCEEEEE---
Q ss_conf             355138986764892589997548---------886----3999985999-99987147763277-51898345442---
Q gi|254780606|r  304 FGIKGEIINVNPGPVVTLYEFEPA---------PGI----KSSRVIGLAD-DIARSMSSLSARVA-VIPKRNAIGIE---  365 (744)
Q Consensus       304 ~~~~~~~~~~~~gp~~~~~~~~~~---------~g~----~~~~~~~~~~-d~~~~~~~~~~~~~-~~pg~~~~~~~---  365 (744)
                      +.-+|.=+++.+...-++++++-.         +.-    =++||.-+++ |++-.-...+-|+. ...|+ .+-+.   
T Consensus        93 i~~~ASDIHieP~~~~~~Ir~RiDG~L~~~~~l~~~~~~~l~sriK~la~ldiae~r~PQdGr~~~~~~~~-~id~Rvst  171 (461)
T PRK10436         93 LQKRASDIHFEPAQNHYRIRLRIDGVLHPLPDPSPETGAALTARLKVLGNLDIAEHRLPQDGQFTVELAGN-AYSFRIAT  171 (461)
T ss_pred             HHCCCCEEEEEECCCCEEEEEEECCEEEEECCCCHHHHHHHHHHHHHHCCCCHHHCCCCCCCCEEEEECCE-EEEEEEEE
T ss_conf             97599658998469818999986899988515898789999999999749981205568778279988996-89999993


Q ss_pred             CCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCE--EEEECCCCCHHHHHHHHHHHHHHHCCHH
Q ss_conf             68888870765875128121146783689842057887321120114846--9970787534479999999999856801
Q gi|254780606|r  366 LPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHI--LVAGTTGSGKSVAINTMIMSLLYRLRPD  443 (744)
Q Consensus       366 ~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~--lvaG~TgsGKS~~l~~~i~sl~~~~~p~  443 (744)
                      +|...-+.|.||=+- ...+..   .|. -||.+-.-.-.+..+.+.||.  ||.|-||||||+.|.+++-.|   ++++
T Consensus       172 ~Pt~~GE~ivlRlL~-~~~~~~---~L~-~LG~~~~~~~~~~~~~~~p~GliLvtGPTGSGKTTTLya~L~~l---~~~~  243 (461)
T PRK10436        172 LPCRGGEKVVLRLLQ-QVQQTL---DLE-TLGMTPAQLAQFRQALQQPQGLVLVTGPTGSGKTVTLYSALQTL---NTAQ  243 (461)
T ss_pred             CCCCCCCEEEEEEEC-CCCCCC---CHH-HHCCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCC
T ss_conf             346788778999524-665668---887-84889999999999983899779997899995699999999743---4677


Q ss_pred             HEEEEEE-CCCCCEEC
Q ss_conf             1079997-23421000
Q gi|254780606|r  444 ECRMIMV-DPKMLELS  458 (744)
Q Consensus       444 ~~~~~li-D~k~~~~~  458 (744)
                       .+++-| ||=...+.
T Consensus       244 -~~I~TiEDPVE~~l~  258 (461)
T PRK10436        244 -INICSVEDPVEIPLA  258 (461)
T ss_pred             -CEEEEEECCCCCCCC
T ss_conf             -169996077435546


No 54 
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=97.06  E-value=0.00048  Score=46.72  Aligned_cols=35  Identities=34%  Similarity=0.631  Sum_probs=28.0

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             4846997078753447999999999985680110799972
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
                      --.+||+|.||||||+|+|+++..+     |.+-|++.|-
T Consensus       162 r~NIlIsGgTGSGKTTllnALl~~I-----P~~eRIvtIE  196 (343)
T PRK13851        162 RLTMLLCGPTGSGKTTMSKTLISAI-----PPQERLITIE  196 (343)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHCC-----CCCCCEEEEC
T ss_conf             9889998889861999999999628-----9655279961


No 55 
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=97.04  E-value=0.0055  Score=39.47  Aligned_cols=121  Identities=13%  Similarity=0.222  Sum_probs=68.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999856801107999723421000125775200004444178768999999866769999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRK  494 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~  494 (744)
                      +||.|.-.||||++|+++-+..++...--   ++  =-+..++..|+.+   ++ .+.+.+.....+-....||.+-..+
T Consensus        32 ~iiTGpN~gGKSt~lkti~l~~ilaq~G~---~v--pa~~~~~~~~~~i---~~-~i~~~d~~~~~~StF~~E~~~~~~i  102 (213)
T cd03281          32 MVITGPNSSGKSVYLKQVALIVFLAHIGS---FV--PADSATIGLVDKI---FT-RMSSRESVSSGQSAFMIDLYQVSKA  102 (213)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHCC---CE--EECCEEEECCCCE---EE-EECCHHHHHCCCCHHHHHHHHHHHH
T ss_conf             99989998765999999999999998588---57--6740399721223---76-7676434441325899999999999


Q ss_pred             HHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHH----HHHHHHHHHCCEEEEEEE
Q ss_conf             9980778679999988642026776665432338679998445687675310358999----999999642013589998
Q gi|254780606|r  495 MSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGA----IQRLAQMARAAGIHLIMA  570 (744)
Q Consensus       495 ~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~----~~~la~~~ra~Gihlila  570 (744)
                      +....                             +.-+|++||+..  -+...|-...    +..|..++- .--+.|++
T Consensus       103 l~~~~-----------------------------~~sLvliDEl~~--GT~~~eg~ala~a~le~l~~~~~-~~~~~~~t  150 (213)
T cd03281         103 LRLAT-----------------------------RRSLVLIDEFGK--GTDTEDGAGLLIATIEHLLKRGP-ECPRVIVS  150 (213)
T ss_pred             HHHCC-----------------------------CCCEEEEEECCC--CCCHHHHHHHHHHHHHHHHHCCC-CCCEEEEE
T ss_conf             98588-----------------------------886587731347--88835679999999999996588-76649998


Q ss_pred             ECCCCC
Q ss_conf             516544
Q gi|254780606|r  571 TQRPSV  576 (744)
Q Consensus       571 tQrp~~  576 (744)
                      |.....
T Consensus       151 TH~~~L  156 (213)
T cd03281         151 THFHEL  156 (213)
T ss_pred             CCHHHH
T ss_conf             972787


No 56 
>KOG2035 consensus
Probab=97.02  E-value=0.032  Score=34.26  Aligned_cols=154  Identities=22%  Similarity=0.381  Sum_probs=87.7

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE----CCC-CCEECCCCCCCCEEEEEEECHHHHHHHHHHH
Q ss_conf             11484699707875344799999999998568011079997----234-2100012577520000444417876899999
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV----DPK-MLELSVYDGIPHLLTPVVTNPKKAVMALKWA  484 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li----D~k-~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~  484 (744)
                      ..+||+|+.|-.|+||-+-+.+++-.| |-..-+.+++-.-    +-| ..|.+.....-|+-.    ++..+-.--+.+
T Consensus        32 ~d~PHll~yGPSGaGKKTrimclL~el-YG~gveklki~~~t~~tpS~kklEistvsS~yHlEi----tPSDaG~~DRvV  106 (351)
T KOG2035          32 GDFPHLLVYGPSGAGKKTRIMCLLREL-YGVGVEKLKIETRTFTTPSKKKLEISTVSSNYHLEI----TPSDAGNYDRVV  106 (351)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHH-HCCCCHHEEEEEEEEECCCCCEEEEEEECCCCEEEE----CHHHCCCCCHHH
T ss_conf             778707888889887211189999988-578724505666788648886379999425651774----734337511799


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCE
Q ss_conf             98667699999980778679999988642026776665432338679998445687675310358999999999642013
Q gi|254780606|r  485 VREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAG  564 (744)
Q Consensus       485 ~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~G  564 (744)
                      +.||-.   .|+...  -|+ .+                  ..-+|-||||-|...|..    +...++-|-- ---+.-
T Consensus       107 iQellK---evAQt~--qie-~~------------------~qr~fKvvvi~ead~LT~----dAQ~aLRRTM-EkYs~~  157 (351)
T KOG2035         107 IQELLK---EVAQTQ--QIE-TQ------------------GQRPFKVVVINEADELTR----DAQHALRRTM-EKYSSN  157 (351)
T ss_pred             HHHHHH---HHHHHC--CHH-HC------------------CCCCEEEEEEECHHHHHH----HHHHHHHHHH-HHHHCC
T ss_conf             999999---987414--133-32------------------666548999803576508----8999999999-998607


Q ss_pred             EEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCC
Q ss_conf             58999851654444146788505630572036811100
Q gi|254780606|r  565 IHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSR  602 (744)
Q Consensus       565 ihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr  602 (744)
                      ++|||+-.--| .+|.. ||.-.   +..||.-..|+.
T Consensus       158 ~RlIl~cns~S-riIep-IrSRC---l~iRvpaps~ee  190 (351)
T KOG2035         158 CRLILVCNSTS-RIIEP-IRSRC---LFIRVPAPSDEE  190 (351)
T ss_pred             CEEEEEECCCC-CCHHH-HHHHE---EEEECCCCCHHH
T ss_conf             16999926743-02267-76220---587678998789


No 57 
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=96.94  E-value=0.0011  Score=44.36  Aligned_cols=39  Identities=33%  Similarity=0.620  Sum_probs=28.2

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-CCCC
Q ss_conf             1484699707875344799999999998568011079997-2342
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-DPKM  454 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-D~k~  454 (744)
                      ..-.+||+|.||||||.+|++++..+     |.+.+++.| |+-.
T Consensus        24 ~~~nIlIsG~tGSGKTTll~al~~~i-----~~~~rivtiEd~~E   63 (186)
T cd01130          24 ARKNILISGGTGSGKTTLLNALLAFI-----PPDERIITIEDTAE   63 (186)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHC-----CCCCCEEEECCCHH
T ss_conf             59989998999998999999999613-----34564598415354


No 58 
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=96.93  E-value=0.0021  Score=42.33  Aligned_cols=183  Identities=14%  Similarity=0.257  Sum_probs=84.5

Q ss_pred             CCCCEEEEEEECCCCCEEECCHHH--CCCEEEEECCCCCHHHHHHHHHHHHH----------HHCCHHHEEEEEECCCCC
Q ss_conf             678368984205788732112011--48469970787534479999999999----------856801107999723421
Q gi|254780606|r  388 SKANLALCLGKTISGESVIADLAN--MPHILVAGTTGSGKSVAINTMIMSLL----------YRLRPDECRMIMVDPKML  455 (744)
Q Consensus       388 ~~~~l~~~~g~~~~g~~~~~dl~~--~PH~lvaG~TgsGKS~~l~~~i~sl~----------~~~~p~~~~~~liD~k~~  455 (744)
                      ..++++-.+|.+.--.-.+..+..  .-|+||.|--|.|||++.+++ ..||          |.+.|+.=.++--+.. .
T Consensus         7 ~~fPf~aIvGQe~~k~aLll~av~p~iGgVLi~G~~GtgKStlvRal-a~lLP~i~~v~~~~f~~~p~~p~~~~~~~~-~   84 (347)
T CHL00081          7 PVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL-VDLLPEIEVVKNDPFNSDPRDPDLMSDEVR-E   84 (347)
T ss_pred             CCCCHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHH-HHHCCCCEEECCCCCCCCCCCCCCCCHHHH-H
T ss_conf             88984065384999999999825788786998789987499999999-985787422068876789898100242666-5


Q ss_pred             EECCCCCCC--CEEEEEEECH-----HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             000125775--2000044441-----787689999998667699999980778679999988642026776665432338
Q gi|254780606|r  456 ELSVYDGIP--HLLTPVVTNP-----KKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPM  528 (744)
Q Consensus       456 ~~~~~~~~p--h~~~~v~~~~-----~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~  528 (744)
                      .+..-+.++  ....++++-+     +.....++-     ++  .+.  .|.              ..+..+.   +..-
T Consensus        85 ~~~~~~~~~~~~~~~p~v~lPlgaTEDrv~GslDi-----e~--al~--~G~--------------~~f~pGl---La~A  138 (347)
T CHL00081         85 RIRNGEKIPTKKIKIPMVDLPLGATEDRVCGTIDI-----EK--ALT--EGV--------------KAFEPGL---LAKA  138 (347)
T ss_pred             HHCCCCCCCCEECCCCEEECCCCCCCCEECCCHHH-----HH--HHH--CCC--------------CCCCCCH---HHHC
T ss_conf             43146667521146862536888852301140009-----98--984--587--------------1156531---2220


Q ss_pred             CEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHH--------CCEE---EEEEEECCCCCCCCHHHHHHCCCCEEEEECCC
Q ss_conf             679998445687675310358999999999642--------0135---89998516544441467885056305720368
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAGKEIEGAIQRLAQMAR--------AAGI---HLIMATQRPSVDVITGTIKANFPIRISFQVTS  597 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~r--------a~Gi---hlilatQrp~~~vi~~~ik~n~~~ri~~~v~~  597 (744)
                      -+=|+.|||.+-|    .+.+.+.|..-+..|.        +.-.   ++++|||.|..+-+..++-+-|...+...-..
T Consensus       139 ~rGiLyvDEINll----~d~~v~~LLda~a~G~~~VEReG~S~~~Pa~F~liaT~NPeEgeLrp~llDRF~l~v~v~~~~  214 (347)
T CHL00081        139 NRGILYVDEVNLL----DDHLVDILLDSAASGWNTVEREGISIRHPARFVLIGSGNPEEGELRPQLLDRFGMHAEIRTVK  214 (347)
T ss_pred             CCCEEEEEHHHHH----HHHHHHHHHHHHHCCEEEECCCCEEECCCCCEEEEECCCCCCCCCCHHHHHHEEEEEECCCCC
T ss_conf             3885886145432----379999999998558089804642330575006885578655674888882632267458878


Q ss_pred             HHHCC
Q ss_conf             11100
Q gi|254780606|r  598 KIDSR  602 (744)
Q Consensus       598 ~~dsr  602 (744)
                      ..+.|
T Consensus       215 ~~e~R  219 (347)
T CHL00081        215 DPELR  219 (347)
T ss_pred             CHHHH
T ss_conf             98999


No 59 
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=96.92  E-value=0.0029  Score=41.35  Aligned_cols=152  Identities=18%  Similarity=0.258  Sum_probs=72.8

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC---CE------------ECCCCCCCCEEEEE
Q ss_conf             1120114846997078753447999999999985680110799972342---10------------00125775200004
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM---LE------------LSVYDGIPHLLTPV  470 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~---~~------------~~~~~~~ph~~~~v  470 (744)
                      -+.+.+.-.+-|-|.+|||||++|| +|.+| -+-+...+.+.-.|...   -+            |-.|+-+|.+    
T Consensus        25 ~l~i~~Ge~vaI~GpSGSGKSTLLn-iig~l-d~pt~G~v~i~g~~~~~l~~~~~~~~R~~~iGfvFQ~~nLl~~l----   98 (226)
T COG1136          25 NLEIEAGEFVAIVGPSGSGKSTLLN-LLGGL-DKPTSGEVLINGKDLTKLSEKELAKLRRKKIGFVFQNFNLLPDL----   98 (226)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHH-HHHCC-CCCCCCEEEECCEECCCCCHHHHHHHHHHHEEEECCCCCCCCCC----
T ss_conf             5887499899998999998999999-99646-67888469999888675898899999777489987567778988----


Q ss_pred             EECHHHHHHHHHH--H-HHHHHHHHHH-HHHCCCCCHHH----------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHH
Q ss_conf             4441787689999--9-9866769999-99807786799----------9998864202677666543233867999844
Q gi|254780606|r  471 VTNPKKAVMALKW--A-VREMEERYRK-MSHLSVRNIKS----------YNERISTMYGEKPQGCGDDMRPMPYIVIIVD  536 (744)
Q Consensus       471 ~~~~~~~~~~l~~--~-~~em~~r~~~-~~~~~~~~i~~----------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviD  536 (744)
                       |-.+...-.+..  . ..++.++... +...|..+...          =.+|++..+.-.         .-|.|++.-+
T Consensus        99 -tv~ENv~lpl~~~~~~~~~~~~~~~~l~~~lgl~~~~~~~~p~~LSGGqqQRVAIARAL~---------~~P~iilADE  168 (226)
T COG1136          99 -TVLENVELPLLIAGKSAGRRKRAAEELLEVLGLEDRLLKKKPSELSGGQQQRVAIARALI---------NNPKIILADE  168 (226)
T ss_pred             -CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCCCHHCCHHHHHHHHHHHHHH---------CCCCEEEEEC
T ss_conf             -899999869987478736799999999986698123235881226979999999999982---------4998699607


Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC
Q ss_conf             5687675310358999999999642013589998516544
Q gi|254780606|r  537 EMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV  576 (744)
Q Consensus       537 E~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~  576 (744)
                      .-..|-....+++...   |.+..+..|.-+|++|-.|..
T Consensus       169 PTgnLD~~t~~~V~~l---l~~~~~~~g~tii~VTHD~~l  205 (226)
T COG1136         169 PTGNLDSKTAKEVLEL---LRELNKERGKTIIMVTHDPEL  205 (226)
T ss_pred             CCCCCCHHHHHHHHHH---HHHHHHHCCCEEEEECCCHHH
T ss_conf             6665886789999999---999987469899999089899


No 60 
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=96.92  E-value=0.0012  Score=44.07  Aligned_cols=158  Identities=16%  Similarity=0.270  Sum_probs=69.3

Q ss_pred             CC-CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHH
Q ss_conf             48-46997078753447999999999985680110799972342100012577520000444417876899999986676
Q gi|254780606|r  412 MP-HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEE  490 (744)
Q Consensus       412 ~P-H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~  490 (744)
                      +| +++|.|.||+|||+.++-++--| ...++... .+-|++-                ....+..+...+.   ...- 
T Consensus        41 ~p~n~~iyG~~GTGKT~~~~~v~~~l-~~~~~~~~-~~yINc~----------------~~~t~~~i~~~i~---~~~~-   98 (366)
T COG1474          41 RPSNIIIYGPTGTGKTATVKFVMEEL-EESSANVE-VVYINCL----------------ELRTPYQVLSKIL---NKLG-   98 (366)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHH-HHHCCCCC-EEEEEEE----------------ECCCHHHHHHHHH---HHHC-
T ss_conf             98607998899987328999999999-73315675-7999513----------------0787879999999---9826-


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEE
Q ss_conf             99999980778679999988642026776665432338679998445687675310358999999999642013589998
Q gi|254780606|r  491 RYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMA  570 (744)
Q Consensus       491 r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlila  570 (744)
                         -.-..|......|+........           .--++|||.||+.-|....+ ++--.|.|+.... ...+-+|.-
T Consensus        99 ---~~p~~g~~~~~~~~~l~~~~~~-----------~~~~~IvvLDEid~L~~~~~-~~LY~L~r~~~~~-~~~v~vi~i  162 (366)
T COG1474          99 ---KVPLTGDSSLEILKRLYDNLSK-----------KGKTVIVILDEVDALVDKDG-EVLYSLLRAPGEN-KVKVSIIAV  162 (366)
T ss_pred             ---CCCCCCCCHHHHHHHHHHHHHH-----------CCCEEEEEECCHHHHHCCCC-CHHHHEECCCCCC-CEEEEEEEE
T ss_conf             ---8997676326899999997774-----------18759999764765415464-1455111247767-537999997


Q ss_pred             ECCCC-CCCCHHHHHHCCC-CEEEEECCCHHHCCHHCCC
Q ss_conf             51654-4441467885056-3057203681110032676
Q gi|254780606|r  571 TQRPS-VDVITGTIKANFP-IRISFQVTSKIDSRTILGE  607 (744)
Q Consensus       571 tQrp~-~~vi~~~ik~n~~-~ri~~~v~~~~dsr~il~~  607 (744)
                      +---. .+.+...|+..+. .+|-|.-=+...=+.||..
T Consensus       163 ~n~~~~~~~ld~rv~s~l~~~~I~F~pY~a~el~~Il~~  201 (366)
T COG1474         163 SNDDKFLDYLDPRVKSSLGPSEIVFPPYTAEELYDILRE  201 (366)
T ss_pred             ECCHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHH
T ss_conf             354889998756676506876355289898999999999


No 61 
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=96.92  E-value=0.0091  Score=37.97  Aligned_cols=119  Identities=17%  Similarity=0.177  Sum_probs=68.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999856801107999723421000125775200004444178768999999866769999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRK  494 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~  494 (744)
                      ++|-|.-.||||++|+++-+..++.+.-     ..|-.+..++..|+.   +++ .+.+.+.....+-....||.+-...
T Consensus        33 ~iiTGpN~sGKSt~lk~i~l~~~laq~G-----~~vpa~~~~~~~~d~---i~t-~i~~~d~~~~~~StF~~e~~~~~~i  103 (222)
T cd03285          33 LIITGPNMGGKSTYIRQIGVIVLMAQIG-----CFVPCDSADIPIVDC---ILA-RVGASDSQLKGVSTFMAEMLETAAI  103 (222)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHC-----CCEEEEEEEEECCCE---EEE-EECCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             9998999887189999999999999868-----754632389952764---999-9889971003352899999999999


Q ss_pred             HHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHH----HHHHHHHHHHHCCEEEEEEE
Q ss_conf             99807786799999886420267766654323386799984456876753103589----99999999642013589998
Q gi|254780606|r  495 MSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIE----GAIQRLAQMARAAGIHLIMA  570 (744)
Q Consensus       495 ~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e----~~~~~la~~~ra~Gihlila  570 (744)
                      +....                             +.-+|++|||..  -+...+-.    ..+..|+   +..+-+.|++
T Consensus       104 l~~~~-----------------------------~~sLvliDElg~--GT~~~eg~aia~aile~L~---~~~~~~~i~t  149 (222)
T cd03285         104 LKSAT-----------------------------ENSLIIIDELGR--GTSTYDGFGLAWAIAEYIA---TQIKCFCLFA  149 (222)
T ss_pred             HHHCC-----------------------------CCCEECCCCCCC--CCCHHHHHHHHHHHHHHHH---HCCCCEEEEE
T ss_conf             98476-----------------------------773200023468--9882267999999999998---5068509998


Q ss_pred             ECCCCC
Q ss_conf             516544
Q gi|254780606|r  571 TQRPSV  576 (744)
Q Consensus       571 tQrp~~  576 (744)
                      |-....
T Consensus       150 TH~~~L  155 (222)
T cd03285         150 THFHEL  155 (222)
T ss_pred             EECHHH
T ss_conf             200779


No 62 
>pfam02534 TraG TraG/TraD family. These proteins contain a P-loop and walker-B site for nucleotide binding. TraG is essential for DNA transfer in bacterial conjugation. These proteins are thought to mediate interactions between the DNA-processing (Dtr) and the mating pair formation (Mpf) systems.
Probab=96.90  E-value=0.0012  Score=44.08  Aligned_cols=61  Identities=23%  Similarity=0.351  Sum_probs=36.0

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC--CCC----HHHHHHCCCCEEEEECC
Q ss_conf             79998445687675310358999999999642013589998516544--441----46788505630572036
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV--DVI----TGTIKANFPIRISFQVT  596 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~--~vi----~~~ik~n~~~ri~~~v~  596 (744)
                      .++.+.|||+-|-.     +. .+......+|+.||++++..|--+-  ++-    --.|-.|...++.|...
T Consensus       303 ~vlflLDEF~nlg~-----i~-~l~~~l~~~rg~gi~~~~i~Qs~~QL~~~YG~~~a~til~n~~~~~~f~~~  369 (468)
T pfam02534       303 EVLFLLDEFPSLGK-----LE-ILEEALATIRGYGIRLTTICQSISQLKETYGGEGAKSILSNHAVVICFAAS  369 (468)
T ss_pred             EEEEEEECHHCCCC-----HH-HHHHHHHHHHHCCCEEEEEEECHHHHHHHHCCCCHHHHHHCCCEEEEEECC
T ss_conf             47999982111487-----78-999999988617969999996199999885841278898548738999678


No 63 
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=96.84  E-value=0.014  Score=36.74  Aligned_cols=128  Identities=16%  Similarity=0.200  Sum_probs=70.8

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100012577520000444417876899999986676999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYR  493 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~  493 (744)
                      -++|.|.-.+|||++|+++.+..++...    -+.. =-+...+..|+   ++++ .+.+.+....-+-....||.+-..
T Consensus        31 ~~iITGpN~gGKSt~Lktigl~~ilAq~----G~~v-pA~~a~~~~~d---~I~t-~i~~~d~i~~~~StF~~E~~~~~~  101 (204)
T cd03282          31 FHIITGPNMSGKSTYLKQIALLAIMAQI----GCFV-PAEYATLPIFN---RLLS-RLSNDDSMERNLSTFASEMSETAY  101 (204)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHH----CCEE-EHHHCCCCCCC---EEEE-EECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             9999899988719999999999999996----8916-71321033667---7899-987666100664589999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHH----HHHHHHHHHHHHCCEEEEEE
Q ss_conf             99980778679999988642026776665432338679998445687675310358----99999999964201358999
Q gi|254780606|r  494 KMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEI----EGAIQRLAQMARAAGIHLIM  569 (744)
Q Consensus       494 ~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~----e~~~~~la~~~ra~Gihlil  569 (744)
                      ++....                             ..-+|++||+..  -+...|-    ...+..|.++    |-+.|+
T Consensus       102 il~~~~-----------------------------~~sLvliDEl~~--GT~~~eg~a~a~aile~l~~~----~~~~i~  146 (204)
T cd03282         102 ILDYAD-----------------------------GDSLVLIDELGR--GTSSADGFAISLAILECLIKK----ESTVFF  146 (204)
T ss_pred             HHHHCC-----------------------------CCCEEEECCCCC--CCCHHHHHHHHHHHHHHHHHC----CCEEEE
T ss_conf             998588-----------------------------898798543348--998678999999999999967----987999


Q ss_pred             EECCCCCCCCHHHHHHCCCC
Q ss_conf             85165444414678850563
Q gi|254780606|r  570 ATQRPSVDVITGTIKANFPI  589 (744)
Q Consensus       570 atQrp~~~vi~~~ik~n~~~  589 (744)
                      +|-..+   |...+. +.+.
T Consensus       147 tTH~~~---L~~l~~-~~~~  162 (204)
T cd03282         147 ATHFRD---IAAILG-NKSC  162 (204)
T ss_pred             ECCHHH---HHHHHH-HCCC
T ss_conf             897689---999886-3888


No 64 
>TIGR02746 TraC-F-type type-IV secretion system protein TraC; InterPro: IPR014117   The proteins in this entry are found in the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The proteins contain the Walker A and B motifs and so are putative nucleotide triphosphatases..
Probab=96.81  E-value=0.0017  Score=43.03  Aligned_cols=107  Identities=23%  Similarity=0.239  Sum_probs=72.6

Q ss_pred             CEEEEEHHHHHHHHH-HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCC
Q ss_conf             679998445687675-3103589999999996420135899985165444414678850563057203681110032676
Q gi|254780606|r  529 PYIVIIVDEMADLMM-VAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGE  607 (744)
Q Consensus       529 p~ivvviDE~a~l~~-~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~  607 (744)
                      -+-++||||.=.||. -+...+-.-|.+++|.+|-.|==||..||.-+ |-..  =|||-.+|-|+.-+   |-.+||.+
T Consensus       734 ~rK~~~iDEAW~Ll~~g~~~~~~~FIE~gyRr~RK~~Ga~~tiTQ~~~-D~~~--dka~~~arA~yaNS---~~~iiL~Q  807 (900)
T TIGR02746       734 RRKILIIDEAWSLLDDGANPQAANFIETGYRRARKYGGAFITITQGIE-DFYS--DKASPEARAAYANS---DWKIILRQ  807 (900)
T ss_pred             CCEEEEEHHHHHHHHCCCCCHHHHHHHHHHHCCHHHCCCEEEEECCEE-HHHC--CCCCHHHHHHHHCC---CEEEEECC
T ss_conf             551676442489874278513589888763201111643689964400-1000--34798899988453---30041278


Q ss_pred             C--CHHHHCCCCCEEEECCCCC----EEEEEECCCCHHHH
Q ss_conf             3--1688568984686468984----38999343898899
Q gi|254780606|r  608 H--GAEQLLGRGDMLYMSGGGR----IQRVHGPLVSDIEI  641 (744)
Q Consensus       608 ~--gae~l~g~gd~l~~~~~~~----~~r~~~~~~~~~~~  641 (744)
                      .  +=++|.-.+-.=|-+.+-+    +-.++|.+-|+-=|
T Consensus       808 ~~~~~~~~~~~~~~~~~~~~~~~i~sl~~~~~~GfSe~~I  847 (900)
T TIGR02746       808 SAESIEKLKAENPLQFSPFEKRLIKSLRTAKGAGFSELLI  847 (900)
T ss_pred             CHHHHHHHHHCCCCCCCHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             8647899996389888988999997225356630676676


No 65 
>PRK08694 consensus
Probab=96.80  E-value=0.011  Score=37.32  Aligned_cols=151  Identities=15%  Similarity=0.135  Sum_probs=76.4

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC-------CCCCCE--EEEEEECHHHHHH
Q ss_conf             0114846997078753447999999999985680110799972342100012-------577520--0004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY-------DGIPHL--LTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~-------~~~ph~--~~~v~~~~~~~~~  479 (744)
                      |.+.--++|||.+|+|||.|..+|+...+....   ...+++-.-|..-..+       .++++.  ...-+++.++  .
T Consensus       215 l~~G~LiVIaaRPsmGKTalalnia~~~a~~~~---~~V~~fSLEMs~~~l~~Rlla~~s~v~~~~i~~g~l~~~e~--~  289 (468)
T PRK08694        215 LQPGDLIIVAGRPSMGKTAFSINIAEHVAVEGK---LPVAVFSMEMGGAQLVMRMLGSVGRLDQSVLKTGRLEDEHW--G  289 (468)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCC---CCEEEECCCCCHHHHHHHHHHHHCCCCHHHCCCCCCCHHHH--H
T ss_conf             887847999617865378999999999998479---84799778899999999999972598632110489999999--9


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCH------HHHHHH
Q ss_conf             99999986676999999807786799999886420267766654323386799984456876753103------589999
Q gi|254780606|r  480 ALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGK------EIEGAI  553 (744)
Q Consensus       480 ~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~------~~e~~~  553 (744)
                      .+.++..+|...--.+......++.....+.+......    +.     ..=+||||=+. ||...++      ++...-
T Consensus       290 ~~~~a~~~l~~~pl~idd~~~~t~~~i~a~~r~~~~~~----~~-----kl~~vvIDYLq-Li~~~~~~~~r~~~i~~is  359 (468)
T PRK08694        290 RLNEAVVKLSDAPVYIDETPGLTALELRARARRLARQF----NN-----KLGLIVIDYLQ-LMAGSGRSDNRASELGEIS  359 (468)
T ss_pred             HHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHH----CC-----CCCEEEEEHHH-HCCCCCCCCCHHHHHHHHH
T ss_conf             99999999862996897699998879999999999983----89-----87389973675-4168887655999999999


Q ss_pred             HHHHHHHHCCEEEEEEEECCC
Q ss_conf             999996420135899985165
Q gi|254780606|r  554 QRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       554 ~~la~~~ra~GihlilatQrp  574 (744)
                      ..|-.+|+.++|.+|+.+|=-
T Consensus       360 r~LK~lAkel~ipvi~LsQLn  380 (468)
T PRK08694        360 RSLKALAKELQVPIIALSQLS  380 (468)
T ss_pred             HHHHHHHHHHCCCEEEECCCC
T ss_conf             999999999799899963268


No 66 
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=96.79  E-value=0.0031  Score=41.21  Aligned_cols=37  Identities=35%  Similarity=0.546  Sum_probs=25.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE-ECCCC
Q ss_conf             69970787534479999999999856801107999-72342
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM-VDPKM  454 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l-iD~k~  454 (744)
                      +||+|.||||||.+|++++-.+   +.....+++- =||-.
T Consensus         4 iLitG~TGSGKTTtl~all~~i---~~~~~~~IiTiEDPiE   41 (198)
T cd01131           4 VLVTGPTGSGKSTTLAAMIDYI---NKNKTHHILTIEDPIE   41 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH---CCCCCCEEEEECCCHH
T ss_conf             9998999997999999999853---6378836999647377


No 67 
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=96.76  E-value=0.021  Score=35.45  Aligned_cols=119  Identities=17%  Similarity=0.184  Sum_probs=67.2

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100012577520000444417876899999986676999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYR  493 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~  493 (744)
                      .++|-|.-.||||++|+++.+..++.+.=   -+  +--+...+. |.+   +++. +.+.+....-+-....||.+-..
T Consensus        27 ~~iiTGpN~~GKSt~Lk~i~l~~ilaq~G---~~--vpa~~~~~~-~~~---i~t~-i~~~d~~~~~~S~F~~E~~~~~~   96 (199)
T cd03283          27 GILITGSNMSGKSTFLRTIGVNVILAQAG---AP--VCASSFELP-PVK---IFTS-IRVSDDLRDGISYFYAELRRLKE   96 (199)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHC---CE--EEHHHEEEC-CCE---EEEE-EECCCHHHCCCCHHHHHHHHHHH
T ss_conf             89998999986599999999999999968---93--862447823-308---9999-83475122453579999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHH----HHHHHHHHHCCEEEEEE
Q ss_conf             99980778679999988642026776665432338679998445687675310358999----99999964201358999
Q gi|254780606|r  494 KMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGA----IQRLAQMARAAGIHLIM  569 (744)
Q Consensus       494 ~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~----~~~la~~~ra~Gihlil  569 (744)
                      ++.....                           -...+|++||+.-  -+...|-...    +..|.+    .+.+.|+
T Consensus        97 il~~~~~---------------------------~~~sLvliDEl~~--GT~~~eg~a~a~a~le~l~~----~~~~~ii  143 (199)
T cd03283          97 IVEKAKK---------------------------GEPVLFLLDEIFK--GTNSRERQAASAAVLKFLKN----KNTIGII  143 (199)
T ss_pred             HHHHHCC---------------------------CCCEEEEECCCCC--CCCHHHHHHHHHHHHHHHHH----CCCEEEE
T ss_conf             9997248---------------------------9857996143247--99867899999999999986----7987999


Q ss_pred             EECCCC
Q ss_conf             851654
Q gi|254780606|r  570 ATQRPS  575 (744)
Q Consensus       570 atQrp~  575 (744)
                      +|-...
T Consensus       144 tTH~~~  149 (199)
T cd03283         144 STHDLE  149 (199)
T ss_pred             ECCCHH
T ss_conf             887289


No 68 
>PRK09165 replicative DNA helicase; Provisional
Probab=96.73  E-value=0.015  Score=36.51  Aligned_cols=151  Identities=15%  Similarity=0.174  Sum_probs=74.8

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEE---EEEECCCCCEECCC---------------CCCC--CEEEEE
Q ss_conf             148469970787534479999999999856801107---99972342100012---------------5775--200004
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECR---MIMVDPKMLELSVY---------------DGIP--HLLTPV  470 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~---~~liD~k~~~~~~~---------------~~~p--h~~~~v  470 (744)
                      +.=-++|||.+|+|||.|..+|....+..+......   .....-+.|-|+-+               .+++  ++...-
T Consensus       204 ~GdLiIIAARPsmGKTafaLniA~n~A~~~~~~~~~~~~~~~~~g~~V~~FSLEMs~~ql~~Rlls~~s~V~~~~ir~g~  283 (484)
T PRK09165        204 PSDLIILAGRPSMGKTALATNIAFNAAKAYLREAQPDGSKKAVNGGVVGFFSLEMSAEQLATRILSEQSEISSSKIRRGK  283 (484)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCHHHHHCCC
T ss_conf             77379996079997789999999999987410222233211368984899947799999999999997268613554489


Q ss_pred             EECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC----
Q ss_conf             4441787689999998667699999980778679999988642026776665432338679998445687675310----
Q gi|254780606|r  471 VTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG----  546 (744)
Q Consensus       471 ~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~----  546 (744)
                      .++.++  ..+.+++.+|...--.+.....-+|....++.+......         .+.  +||||=+. ||...+    
T Consensus       284 l~~~e~--~~i~~a~~~l~~~~l~IdD~~~~ti~~Ira~~Rr~k~~~---------gl~--livIDYLq-Li~~~~~~~~  349 (484)
T PRK09165        284 ISEEDF--EKLVDASQELQKLPLYIDDTPALSISALRARARRLKRQH---------GLD--LLVIDYLQ-LIRGSSKRSQ  349 (484)
T ss_pred             CCHHHH--HHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHH---------CCC--EEEEECHH-HCCCCCCCCC
T ss_conf             999999--999999999971984897799987999999999999860---------998--89995176-3578888861


Q ss_pred             ----HHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             ----35899999999964201358999851654
Q gi|254780606|r  547 ----KEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       547 ----~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                          .++...-..|-++|+-++|.+|+..|-=.
T Consensus       350 ~~R~~ev~~Isr~LK~lAkel~ipVi~LsQLnR  382 (484)
T PRK09165        350 DNRVQEISEITQGLKALAKELNIPVIALSQLSR  382 (484)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             219999999999999999996996999745784


No 69 
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=96.71  E-value=0.014  Score=36.64  Aligned_cols=151  Identities=21%  Similarity=0.299  Sum_probs=79.0

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-------CC----CCEECCCCCCCCEEEEEEECH
Q ss_conf             1120114846997078753447999999999985680110799972-------34----210001257752000044441
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-------PK----MLELSVYDGIPHLLTPVVTNP  474 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-------~k----~~~~~~~~~~ph~~~~v~~~~  474 (744)
                      -+++.+.-.+-|-|..|||||++|+. |.+|.   .|+.=++++-+       ++    +.-|-.|.-+||+-  |..|.
T Consensus        20 sl~v~~Ge~~~i~GpSG~GKSTlLr~-iaGl~---~p~~G~I~~~g~~i~~~~~~~R~ig~VfQ~~~LfP~lt--V~eNI   93 (213)
T cd03301          20 NLDIADGEFVVLLGPSGCGKTTTLRM-IAGLE---EPTSGRIYIGGRDVTDLPPKDRDIAMVFQNYALYPHMT--VYDNI   93 (213)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCC--HHHHH
T ss_conf             77986998999999998809999999-97699---99863999999999999976788789945876465470--99999


Q ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHHHH
Q ss_conf             787689999998667699-9999807786799---------99988642026776665432338679998445-687675
Q gi|254780606|r  475 KKAVMALKWAVREMEERY-RKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADLMM  543 (744)
Q Consensus       475 ~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l~~  543 (744)
                      ......-++-..|+++|. +++...+..++..         -.+|++-.+.-.         .-|.|+ +.|| |+.|-.
T Consensus        94 ~~~l~~~~~~~~e~~~~v~~~l~~~gl~~~~~~~P~~LSGGqkQRVaiARAl~---------~~P~lL-LlDEP~saLD~  163 (213)
T cd03301          94 AFGLKLRKVPKDEIDERVREVAELLQIEHLLDRKPKQLSGGQRQRVALGRAIV---------REPKVF-LMDEPLSNLDA  163 (213)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHH---------CCCCEE-EECCCCCCCCH
T ss_conf             98999859998999999999998759924650995569999999999999987---------599989-98388764298


Q ss_pred             HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             31035899999999964201358999851654
Q gi|254780606|r  544 VAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       544 ~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ...   +.....|.+.-+..|+-+|+.|-.++
T Consensus       164 ~~r---~~i~~~l~~~~~~~~~T~i~vTHd~~  192 (213)
T cd03301         164 KLR---VQMRAELKRLQQRLGTTTIYVTHDQV  192 (213)
T ss_pred             HHH---HHHHHHHHHHHHHHCCEEEEECCCHH
T ss_conf             999---99999999999974998999999989


No 70 
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=96.69  E-value=0.0058  Score=39.30  Aligned_cols=110  Identities=32%  Similarity=0.472  Sum_probs=65.8

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-CCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             11484699707875344799999999998568011079997-23421000125775200004444178768999999866
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-DPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREM  488 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-D~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em  488 (744)
                      +|---++|.|+||||||.-+-+||-   |+|.-.-=+++-| ||  .||-.    .|. ..++|..+-......|-+.--
T Consensus       125 ~kRGLviiVGaTGSGKSTtmAaMi~---yRN~~s~gHIiTIEDP--IEfih----~h~-~CIvTQREvGvDTesw~~Alk  194 (375)
T COG5008         125 AKRGLVIIVGATGSGKSTTMAAMIG---YRNKNSTGHIITIEDP--IEFIH----KHK-RCIVTQREVGVDTESWEVALK  194 (375)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHC---CCCCCCCCCEEEECCH--HHHHH----CCC-CEEEEEEEECCCHHHHHHHHH
T ss_conf             4374599987788884016899860---1346887735882381--99874----156-415873341446188999999


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             76999999807786799999886420267766654323386799984456876753103589999999996420135899
Q gi|254780606|r  489 EERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLI  568 (744)
Q Consensus       489 ~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihli  568 (744)
                                        |..                +.-| =||+|-|..+-     +-+| +-..+|+-|     ||.
T Consensus       195 ------------------Ntl----------------RQaP-DvI~IGEvRsr-----etMe-yAi~fAeTG-----HLc  228 (375)
T COG5008         195 ------------------NTL----------------RQAP-DVILIGEVRSR-----ETME-YAIQFAETG-----HLC  228 (375)
T ss_pred             ------------------HHH----------------HCCC-CEEEEEECCCH-----HHHH-HHHHHHHCC-----CEE
T ss_conf             ------------------877----------------5189-86999730437-----6799-999887328-----658


Q ss_pred             EEECCCC
Q ss_conf             9851654
Q gi|254780606|r  569 MATQRPS  575 (744)
Q Consensus       569 latQrp~  575 (744)
                      +||=.-.
T Consensus       229 maTLHAN  235 (375)
T COG5008         229 MATLHAN  235 (375)
T ss_pred             EEEECCC
T ss_conf             9985057


No 71 
>KOG0922 consensus
Probab=96.68  E-value=0.019  Score=35.79  Aligned_cols=52  Identities=17%  Similarity=0.330  Sum_probs=22.1

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHH
Q ss_conf             7999844568767531035899999999964201358999851654444146788
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIK  584 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik  584 (744)
                      |=|||+||..+-.. ..+-.-+.+.+|.++-..  ..||+.+=.-+++.+.....
T Consensus       164 YsvIIlDEAHERsl-~TDiLlGlLKki~~~R~~--LklIimSATlda~kfS~yF~  215 (674)
T KOG0922         164 YSVIILDEAHERSL-HTDILLGLLKKILKKRPD--LKLIIMSATLDAEKFSEYFN  215 (674)
T ss_pred             CCEEEEECHHHHHH-HHHHHHHHHHHHHHCCCC--CEEEEEEEEECHHHHHHHHC
T ss_conf             44899832231015-788999999998732778--36999923524899999864


No 72 
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam
Probab=96.68  E-value=0.02  Score=35.69  Aligned_cols=123  Identities=15%  Similarity=0.186  Sum_probs=70.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999856801107999723421000125775200004444178768999999866769999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRK  494 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~  494 (744)
                      ++|-|.-.||||++|+++.+..++.+.--   ++  --+...+..|+.+   ++ -+.+.+.....+-....||.+-...
T Consensus        33 ~iiTGpN~sGKSt~Lk~igl~~ilaq~G~---~v--pA~~a~i~~~d~I---~t-~i~~~d~i~~~~StF~~e~~~~~~i  103 (216)
T cd03284          33 LLITGPNMAGKSTYLRQVALIALLAQIGS---FV--PASKAEIGVVDRI---FT-RIGASDDLAGGRSTFMVEMVETANI  103 (216)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHCC---EE--EECCEEEEECCEE---EE-EECCCCHHHCCCCHHHHHHHHHHHH
T ss_conf             99989987745999999999999998687---58--7661599704469---99-5068621333726589999999999


Q ss_pred             HHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHH-HHHHHHHHCCEEEEEEEECC
Q ss_conf             99807786799999886420267766654323386799984456876753103589999-99999642013589998516
Q gi|254780606|r  495 MSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAI-QRLAQMARAAGIHLIMATQR  573 (744)
Q Consensus       495 ~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~-~~la~~~ra~GihlilatQr  573 (744)
                      +....                             .+-+|++||+.-  -+...+-.... .-|-.+....+.+.|++|-.
T Consensus       104 l~~a~-----------------------------~~sLvliDEl~~--gT~~~eg~ala~aile~L~~~~~~~~i~tTH~  152 (216)
T cd03284         104 LNNAT-----------------------------ERSLVLLDEIGR--GTSTYDGLSIAWAIVEYLHEKIGAKTLFATHY  152 (216)
T ss_pred             HHHCC-----------------------------CCCEEEECCCCC--CCCHHHHHHHHHHHHHHHHHCCCCEEEEEECH
T ss_conf             98487-----------------------------761563344568--99857889999999999997079728975050


Q ss_pred             CCCC
Q ss_conf             5444
Q gi|254780606|r  574 PSVD  577 (744)
Q Consensus       574 p~~~  577 (744)
                      ....
T Consensus       153 ~~L~  156 (216)
T cd03284         153 HELT  156 (216)
T ss_pred             HHHH
T ss_conf             8899


No 73 
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.67  E-value=0.011  Score=37.48  Aligned_cols=165  Identities=19%  Similarity=0.324  Sum_probs=84.0

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC-----------CEECCCCCCCCEEEEEEE
Q ss_conf             321120114846997078753447999999999985680110799972342-----------100012577520000444
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM-----------LELSVYDGIPHLLTPVVT  472 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~-----------~~~~~~~~~ph~~~~v~~  472 (744)
                      -|-+++.+.-.+.|-|-.|||||++|+. |.+|+   .|+.=++++-+-..           .-|-.|.-.||+-  |..
T Consensus        17 ~vs~~v~~Ge~~~iiGpSGsGKSTLlr~-i~Gl~---~p~~G~I~~~G~di~~~~~~~r~ig~vfQ~~~Lfp~~t--V~e   90 (235)
T cd03299          17 NVSLEVERGDYFVILGPTGSGKSVLLET-IAGFI---KPDSGKILLNGKDITNLPPEKRDISYVPQNYALFPHMT--VYK   90 (235)
T ss_pred             CCEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCC--HHH
T ss_conf             1487988998999999996359999999-97499---99965999999999999976789789457986689990--999


Q ss_pred             CHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHH
Q ss_conf             4178768999999866769-99999807786799---------99988642026776665432338679998445-6876
Q gi|254780606|r  473 NPKKAVMALKWAVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADL  541 (744)
Q Consensus       473 ~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l  541 (744)
                      +.........+-..++++| .+++...|..++..         -.+|++-.+.-.         .-|.+ ++.|| ++.|
T Consensus        91 Ni~~~l~~~~~~~~e~~~rv~e~l~~~gl~~~~~~~p~~LSGGq~QRVaiARAl~---------~~P~l-lllDEP~s~L  160 (235)
T cd03299          91 NIAYGLKKRKVDKKEIERKVLEIAEMLGIDHLLNRKPETLSGGEQQRVAIARALV---------VNPKI-LLLDEPFSAL  160 (235)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHH---------CCCCE-EEEECCCCCC
T ss_conf             9999998769999999999999998779977874894458999999999999997---------38998-9992887646


Q ss_pred             HHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             75310358999999999642013589998516544441467885056305720
Q gi|254780606|r  542 MMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       542 ~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
                      -...   ....+..|.++-+..|+-+|+.|...+ ++.      .+.-||++=
T Consensus       161 D~~~---~~~i~~~l~~l~~~~~~T~i~vTHd~~-~a~------~~aDri~vl  203 (235)
T cd03299         161 DVRT---KEKLREELKKIRKEFGVTVLHVTHDFE-EAW------ALADKVAIM  203 (235)
T ss_pred             CHHH---HHHHHHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEEE
T ss_conf             9999---999999999999982999999878999-999------969999999


No 74 
>PRK05595 replicative DNA helicase; Provisional
Probab=96.66  E-value=0.033  Score=34.16  Aligned_cols=150  Identities=13%  Similarity=0.113  Sum_probs=76.3

Q ss_pred             CHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC-------CCCCCC--EEEEEEECHHHHH
Q ss_conf             2011484699707875344799999999998568011079997234210001-------257752--0000444417876
Q gi|254780606|r  408 DLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV-------YDGIPH--LLTPVVTNPKKAV  478 (744)
Q Consensus       408 dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~-------~~~~ph--~~~~v~~~~~~~~  478 (744)
                      -|.+.--++|||.+|+|||.|.-+|....+.++   ....+++-.-|..-..       ..+++.  +...-.++.  -.
T Consensus       197 Gl~~GdLiiiaaRP~mGKTa~alnia~~~a~~~---g~~V~~fSlEMs~~ql~~R~ls~~s~i~~~~i~~g~l~~~--~~  271 (444)
T PRK05595        197 GFQKGDMILIAARPSMGKTTFALNIAEYAALRE---GKSVVIFSLEMSKEQLAYKLLCSEANVDMLRLRTGNLEDK--DW  271 (444)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC---CCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHH--HH
T ss_conf             998577799985798980799999999999866---9937999588999999999999646988442326897999--99


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHHH
Q ss_conf             89999998667699999980778679999988642026776665432338679998445687675310------358999
Q gi|254780606|r  479 MALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEGA  552 (744)
Q Consensus       479 ~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~~  552 (744)
                      ..+.++..++...--.+.....-++.....+........         .+  =+||||=+. ||....      .++...
T Consensus       272 ~~~~~a~~~l~~~~l~i~d~~~~ti~~i~~~~r~~~~~~---------~~--~liiiDYlq-Li~~~~~~~~r~~ev~~i  339 (444)
T PRK05595        272 ENIARASGPLAAAKIYIDDTAGVSVMEMRSKCRRLKIEH---------GI--DLILIDYLQ-LMSGGKSSESRQQEVSEI  339 (444)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC---------CC--CEEEEEHHH-HCCCCCCCCCHHHHHHHH
T ss_conf             999999999854897054899964899999999999873---------99--989982376-357898888899999999


Q ss_pred             HHHHHHHHHCCEEEEEEEECCC
Q ss_conf             9999996420135899985165
Q gi|254780606|r  553 IQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       553 ~~~la~~~ra~GihlilatQrp  574 (744)
                      -..|-.+|+-++|.+|+..|=-
T Consensus       340 sr~LK~lAkel~ipvi~lsQLn  361 (444)
T PRK05595        340 SRSIKALAKEMECPVIALSQLS  361 (444)
T ss_pred             HHHHHHHHHHHCCCEEEECCCC
T ss_conf             9999999999699799970268


No 75 
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=96.65  E-value=0.0021  Score=42.34  Aligned_cols=158  Identities=20%  Similarity=0.273  Sum_probs=76.0

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC-------------CEECCCCC-CCCEEEEEE
Q ss_conf             1120114846997078753447999999999985680110799972342-------------10001257-752000044
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM-------------LELSVYDG-IPHLLTPVV  471 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~-------------~~~~~~~~-~ph~~~~v~  471 (744)
                      -+.+.+.-.++|.|.+|||||++++. +.+|+ ....-.+   ++|-+.             +.+ .|++ .-+++.+.|
T Consensus        24 ~~~i~~Ge~~~i~G~nGsGKSTL~~~-l~GLl-~p~~G~v---~~~g~~~~~~~~~~~~~~~vG~-VfQnpd~q~~~~tV   97 (235)
T COG1122          24 SLEIEKGERVLLIGPNGSGKSTLLKL-LNGLL-KPTSGEV---LVDGLDTSSEKSLLELRQKVGL-VFQNPDDQLFGPTV   97 (235)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHH-HCCCC-CCCCCEE---EECCCCCCCHHHHHHHHCCEEE-EEECHHHCEECCCH
T ss_conf             38987898999988999889999999-53767-6889848---8778133100218876312169-99971126104758


Q ss_pred             E-CHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCHHHHHHHHHHHHCCCCCCCC---CCCCCCCEEEEEHHHHHHHHHHCC
Q ss_conf             4-4178768999999866769999-9980778679999988642026776665---432338679998445687675310
Q gi|254780606|r  472 T-NPKKAVMALKWAVREMEERYRK-MSHLSVRNIKSYNERISTMYGEKPQGCG---DDMRPMPYIVIIVDEMADLMMVAG  546 (744)
Q Consensus       472 ~-~~~~~~~~l~~~~~em~~r~~~-~~~~~~~~i~~~n~~~~~~~~~~~~~~~---~~~~~~p~ivvviDE~a~l~~~~~  546 (744)
                      . |.......+..-.+||++|-.. +...|...   |-.+....-+...+...   .-+.--|. +++.||=-.  +...
T Consensus        98 ~~evafg~~n~g~~~~e~~~rv~~~l~~vgl~~---~~~r~p~~LSGGqkqRvaIA~vLa~~P~-iliLDEPta--~LD~  171 (235)
T COG1122          98 EDEVAFGLENLGLPREEIEERVAEALELVGLEE---LLDRPPFNLSGGQKQRVAIAGVLAMGPE-ILLLDEPTA--GLDP  171 (235)
T ss_pred             HHHHHCCHHHCCCCHHHHHHHHHHHHHHHCCHH---HCCCCCCCCCCCCEEEHHHHHHHHCCCC-EEEECCCCC--CCCH
T ss_conf             888753574449998999999999999818611---1238811069731665886688871898-999749988--9897


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             35899999999964201358999851654
Q gi|254780606|r  547 KEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       547 ~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      +-.+..+..|-.+...-|+.+|++|-+-+
T Consensus       172 ~~~~~l~~~l~~L~~~~~~tiii~tHd~~  200 (235)
T COG1122         172 KGRRELLELLKKLKEEGGKTIIIVTHDLE  200 (235)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCHH
T ss_conf             89999999999988607976999947478


No 76 
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=96.64  E-value=0.006  Score=39.21  Aligned_cols=149  Identities=23%  Similarity=0.384  Sum_probs=73.6

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             11484699707875344799999999998568011079997234210001257752000044441787689999998667
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREME  489 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~  489 (744)
                      .+.||+|+.|..|+|||.+.+.++..|.......                     |++.--..|... ....+..     
T Consensus        35 ~~~phlLf~GppG~GKTt~a~~la~~l~~~~~~~---------------------~~lelnasd~r~-id~vr~~-----   87 (318)
T PRK00440         35 KNMPHLLFAGPPGTGKTTAALALARELYGEYWRE---------------------NFLELNASDERG-IDVIRNK-----   87 (318)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCC---------------------CEEEECCCCCCC-HHHHHHH-----
T ss_conf             9986698889599889999999999976986434---------------------768951645667-1789999-----


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             69999998077867999998864202677666543233867999844568767531035899999999964201358999
Q gi|254780606|r  490 ERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIM  569 (744)
Q Consensus       490 ~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlil  569 (744)
                                   |..|-..    .         ....-+|-+||+||...|..    +....+.++--.- +-...+||
T Consensus        88 -------------i~~~~~~----~---------~~~~~~~kiiiiDE~d~l~~----~aq~aL~~~mE~~-~~~~~fil  136 (318)
T PRK00440         88 -------------IKEFART----A---------PVGGAPFKIIFLDEADNLTS----DAQQALRRTMEMY-SQTTRFIL  136 (318)
T ss_pred             -------------HHHHHHH----C---------CCCCCCEEEEEEECCCCCCH----HHHHHHHHHHHCC-CCCCEEEE
T ss_conf             -------------9999972----6---------77899738999868553225----5678887643105-66625886


Q ss_pred             EECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHC-----------CCCCHHHH--CCCCCE
Q ss_conf             851654444146788505630572036811100326-----------76316885--689846
Q gi|254780606|r  570 ATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTIL-----------GEHGAEQL--LGRGDM  619 (744)
Q Consensus       570 atQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il-----------~~~gae~l--~g~gd~  619 (744)
                      .+.+++ .++.. |+.-. ..|-|+-.+..+=+..|           +..+.+.|  ...|||
T Consensus       137 ~~n~~~-kii~~-i~SRc-~~i~f~~~~~~~i~~~L~~I~~~E~i~~~~~~l~~i~~~s~gdl  196 (318)
T PRK00440        137 SCNYSS-KIIDP-IQSRC-AVFRFSPLPKEAVIERLRYIAKNEGLEITDDALEAIYYVSEGDM  196 (318)
T ss_pred             ECCCCC-CCCCC-HHHHH-EEEECCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCH
T ss_conf             348833-37615-56551-01115789999999999999998599989999999998649989


No 77 
>PRK05636 replicative DNA helicase; Provisional
Probab=96.63  E-value=0.017  Score=36.17  Aligned_cols=150  Identities=15%  Similarity=0.162  Sum_probs=74.3

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC-------CCCCC--CEEEEEEECHHHHHH
Q ss_conf             011484699707875344799999999998568011079997234210001-------25775--200004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV-------YDGIP--HLLTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~-------~~~~p--h~~~~v~~~~~~~~~  479 (744)
                      |.+.--++|||.+|+|||.|..+|....+.++   ....+++-.-|..-..       ..+++  ++...-.++.++  .
T Consensus       264 l~~G~LiIiAARPsmGKTalAlnia~n~A~~~---g~~v~~fSLEMs~~ql~~Rlla~~s~V~~~~ir~g~l~~~~~--~  338 (507)
T PRK05636        264 LRGGQMIIVAARPGVGKSTIALDFMRSASIKN---NKASVIFSLEMSKSEIVMRLLSAEAEVRLADMRGGKMDEDAW--E  338 (507)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHC---CCCEEEEECCCCHHHHHHHHHHHHCCCCHHHHHCCCCCHHHH--H
T ss_conf             88356799973787866899999999999876---993799715699899999999984798878885588788999--9


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHHHH
Q ss_conf             9999998667699999980778679999988642026776665432338679998445687675310------3589999
Q gi|254780606|r  480 ALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEGAI  553 (744)
Q Consensus       480 ~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~~~  553 (744)
                      .+..++.+|...--.+.....-++....++.+......      .   +  =+||||=+. ||....      .++...-
T Consensus       339 ~l~~a~~~l~~~pl~IdD~~~lti~~Ira~aRrlk~~~------~---l--~livVDYLQ-Lm~~~~~~~~R~~ev~~IS  406 (507)
T PRK05636        339 KLVQRLGKIAQAPIFIDDSANLTMMEIRSKARRLKQKH------D---L--KMIVVDYLQ-LMSSGKRVESRQQEVSEFS  406 (507)
T ss_pred             HHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHC------C---C--CEEEEEHHH-HCCCCCCCCCHHHHHHHHH
T ss_conf             99999999861988998499976999999999998617------9---9--989984588-4568888766899999999


Q ss_pred             HHHHHHHHCCEEEEEEEECCCC
Q ss_conf             9999964201358999851654
Q gi|254780606|r  554 QRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       554 ~~la~~~ra~GihlilatQrp~  575 (744)
                      ..|-.+|+.++|.+|+..|=-.
T Consensus       407 r~LK~lAkel~vpVi~LsQLnR  428 (507)
T PRK05636        407 RQLKLLAKELDVPLIAISQLNR  428 (507)
T ss_pred             HHHHHHHHHHCCCEEEECCCCC
T ss_conf             9999999997998899712684


No 78 
>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=96.62  E-value=0.039  Score=33.64  Aligned_cols=45  Identities=18%  Similarity=0.432  Sum_probs=32.2

Q ss_pred             EEEHHHHHHHHHHCC-HHHHHHHHHHHHHHHCCEEEEEEEECCCCC
Q ss_conf             998445687675310-358999999999642013589998516544
Q gi|254780606|r  532 VIIVDEMADLMMVAG-KEIEGAIQRLAQMARAAGIHLIMATQRPSV  576 (744)
Q Consensus       532 vvviDE~a~l~~~~~-~~~e~~~~~la~~~ra~GihlilatQrp~~  576 (744)
                      .||||-+..+..... .++...+..|.+..|..|+-.++..+..+.
T Consensus       122 ~vVIDsit~l~~~~~~~~~r~~l~~l~~~lk~~g~t~l~t~e~~~~  167 (231)
T pfam06745       122 RVVIDSITTLFYLLKPAMAREILRRLKRVLKKLGVTAIFTSEKPSG  167 (231)
T ss_pred             EEEEECCHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEECCC
T ss_conf             8999764164005889999999999999999769919999821257


No 79 
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=96.61  E-value=0.063  Score=32.20  Aligned_cols=40  Identities=18%  Similarity=0.279  Sum_probs=26.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCC--HHHEEEEEECCCC
Q ss_conf             699707875344799999999998568--0110799972342
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLR--PDECRMIMVDPKM  454 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~--p~~~~~~liD~k~  454 (744)
                      ..|+|..|+|||.|...+..+......  -..-+.+.||-++
T Consensus        22 tEi~G~~GsGKTql~lqla~~~~~~~~~~g~~~~vvyIdtE~   63 (235)
T cd01123          22 TEIFGEFGSGKTQLCHQLAVTVQLPIELGGLEGKAVYIDTEG   63 (235)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             999999998499999999999842475367896299995367


No 80 
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=96.61  E-value=0.015  Score=36.43  Aligned_cols=152  Identities=19%  Similarity=0.221  Sum_probs=73.5

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--CCC---------------CEECCCCCCCCE
Q ss_conf             321120114846997078753447999999999985680110799972--342---------------100012577520
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--PKM---------------LELSVYDGIPHL  466 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~k~---------------~~~~~~~~~ph~  466 (744)
                      -+-+++.+.-.+.|-|..|||||++|+. |.+|.   .|+.=++.+-+  ...               .-|-.|.-+||+
T Consensus        16 ~vsl~i~~Ge~~~i~GpSGsGKSTLL~~-i~gl~---~p~sG~i~~~g~~~~~~~~~~~~~~rr~~iG~VfQ~~~L~~~l   91 (206)
T TIGR03608        16 DLNLTIEKGKMVAIVGESGSGKSTLLNI-IGLLE---KPDSGQVYLNGQETPPINSKKASKFRREKLGYLFQNFALIENE   91 (206)
T ss_pred             CEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCHHHHHHHHHCCEEEECCCCCCCCCC
T ss_conf             8077986998999987999709999999-97599---9897599999999998998899999865889985798767989


Q ss_pred             EEEEEECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHH
Q ss_conf             0004444178768999999866769-99999807786799---------9998864202677666543233867999844
Q gi|254780606|r  467 LTPVVTNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVD  536 (744)
Q Consensus       467 ~~~v~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviD  536 (744)
                      -  |..+..-......+-..+...| .+++...|..+...         -.+|++-.+.-         -.-|.| ++.|
T Consensus        92 t--V~eNi~l~l~~~~~~~~~~~~~~~~~L~~vgl~~~~~~~p~~LSGGe~QRVAIARAL---------~~~P~i-llaD  159 (206)
T TIGR03608        92 T--VEENLDLALKYSKLSKKEKREKKKEALEKVGLNLKLKQKIYELSGGEQQRVALARAI---------LKPSEL-ILAD  159 (206)
T ss_pred             C--HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHCCCHHCCHHHHHHHHHHHHH---------HCCCCE-EEEC
T ss_conf             1--999999999865999999999999999986990565299244486999999999998---------249999-9963


Q ss_pred             H-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             5-68767531035899999999964201358999851654
Q gi|254780606|r  537 E-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       537 E-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      | .+.|-.....++...|.+|.+.    |.-+|++|-.+.
T Consensus       160 EPT~~LD~~~~~~i~~ll~~l~~~----g~tii~vTHd~~  195 (206)
T TIGR03608       160 EPTGSLDPKNRDEVLDLLLELNDE----GKTIIIVTHDPE  195 (206)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHC----CCEEEEECCCHH
T ss_conf             998778999999999999999867----999999898789


No 81 
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277   This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=96.61  E-value=0.017  Score=36.08  Aligned_cols=276  Identities=16%  Similarity=0.240  Sum_probs=133.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHCCHH---H-EEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             8469970787534479999999999856801---1-07999723421000125775200004444178768999999866
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMIMSLLYRLRPD---E-CRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREM  488 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~---~-~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em  488 (744)
                      +-++|.|-||.|||.-.+.++--|- ....+   . |..+-|+|....-                   .-.++..++...
T Consensus        44 ~Ni~iYGkTGtGKT~vt~~v~~~l~-~~~~~~d~~D~~~~~~NC~~~~T-------------------~y~~~~~L~~~l  103 (383)
T TIGR02928        44 SNIFIYGKTGTGKTAVTKYVMKELE-EAAEDRDVRDVSTVYINCQILDT-------------------SYQVLVELANQL  103 (383)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHH-HHHHCCCCCCEEEEEECCCCCCC-------------------HHHHHHHHHHHH
T ss_conf             7258878889878899999999999-98622699715899977854684-------------------699999999985


Q ss_pred             H--HHHHHHHHCCCCCHHHHHHHHHHHH-CCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHH-----HHHHHHHH--HH
Q ss_conf             7--6999999807786799999886420-2677666543233867999844568767531035-----89999999--99
Q gi|254780606|r  489 E--ERYRKMSHLSVRNIKSYNERISTMY-GEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKE-----IEGAIQRL--AQ  558 (744)
Q Consensus       489 ~--~r~~~~~~~~~~~i~~~n~~~~~~~-~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~-----~e~~~~~l--a~  558 (744)
                      .  ..-...-..|+-.=.-|+..+.... ..           --.+|||.||+--|....+++     +--.|.|+  .-
T Consensus       104 n~~~~~~~vP~tG~s~~~~~~~l~~~l~~~~-----------~~~~~ivLDEiD~Lv~~~~d~PAyS~~LY~L~Ra~~~~  172 (383)
T TIGR02928       104 NRRGSGEEVPTTGLSTSEVFRELYKELNRER-----------GDSLIIVLDEIDKLVRKDDDDPAYSKLLYQLSRARENG  172 (383)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC-----------CCEEEEEECCCCHHHCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             1577888898877878999999999983201-----------88799986231022158888807878853433100035


Q ss_pred             HHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHH----CCCC-CEEEECCC--CCEEEE
Q ss_conf             6420135899985165444414678850563057203681110032676316885----6898-46864689--843899
Q gi|254780606|r  559 MARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQL----LGRG-DMLYMSGG--GRIQRV  631 (744)
Q Consensus       559 ~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l----~g~g-d~l~~~~~--~~~~r~  631 (744)
                      .-..+=|++|-=|...+       .+.|+..||==.+.   .--++..-.+|++|    --+= ||-|..|-  ...|++
T Consensus       173 ~~~~~~vgvIgISND~~-------f~~~Ld~RVkSsL~---~eei~FpPYdA~eL~~IL~~R~v~~AF~dGvl~d~VI~l  242 (383)
T TIGR02928       173 DLENAKVGVIGISNDLK-------FRENLDPRVKSSLC---EEEIVFPPYDAEELRDILENRAVEKAFYDGVLDDGVIPL  242 (383)
T ss_pred             CCCCCCEEEEEEECCCH-------HHHHCCCCEECCCC---CCCCEECCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHH
T ss_conf             77885348999865714-------36445753013248---740040798869999999720312033688546227999


Q ss_pred             EECCCCHHH--HHHHHHHHHHCCCCCCCC---CCCCCCCCCCCCCCCCCCCCC-CCCCHHH-------------HHHH-H
Q ss_conf             934389889--999999998408875311---112455554444566777777-7660389-------------9999-9
Q gi|254780606|r  632 HGPLVSDIE--IEKVVQHLKKQGCPEYLN---TVTTDTDTDKDGNNFDSEEKK-ERSNLYA-------------KAVD-L  691 (744)
Q Consensus       632 ~~~~~~~~~--~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~-~~~~~~~-------------~~~~-~  691 (744)
                      =+||...+.  -.+..|-++.-|+--.-+   .++.+.....       ...- |.|-+.+             .|+- +
T Consensus       243 cAA~aAq~hGDAR~AiDLLR~AGe~A~~~g~~~Vt~~HV~~A-------~e~~PE~~r~~e~~~~Lp~h~k~~L~A~~~l  315 (383)
T TIGR02928       243 CAALAAQEHGDARKAIDLLRVAGEIAEREGAERVTEDHVEEA-------QEKIPEVDRVLELIRGLPTHSKLVLLAIANL  315 (383)
T ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH-------HHHCCHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             999862067878999999998768753157631008889999-------9832228899998607986799999999999


Q ss_pred             HH---HCCCEEEEEEECCCC----------CCHHHHHHHHHHHHHCCCCCHHHCCCCC
Q ss_conf             99---749862322000001----------0078999999999987975702168862
Q gi|254780606|r  692 VI---DNQRCSTSFIQRRLQ----------IGYNRAALLVERMEQEGLVSEADHVGKR  736 (744)
Q Consensus       692 ~~---~~~~~s~s~~qr~~~----------~g~~ra~~~~~~~e~~g~~~~~~~~~~r  736 (744)
                      ..   ...++.|+-+...++          ++|.|.-.+|-.|+..|||+-..-++-|
T Consensus       316 ~~~~~~~~~~~t~~vY~~Y~~~c~~~~~dpl~~rR~~~~l~eL~~LG~~~~~~~~~G~  373 (383)
T TIGR02928       316 AAESPEEDPFRTGEVYEVYKELCEDIGVDPLTQRRISDLLNELDMLGLVEAEERNKGR  373 (383)
T ss_pred             HHHCCCCCEEEEHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             8516788736612778999999876267766146799988767660733456774267


No 82 
>pfam05707 Zot Zonular occludens toxin (Zot). This family consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophages present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers
Probab=96.58  E-value=0.003  Score=41.24  Aligned_cols=61  Identities=21%  Similarity=0.383  Sum_probs=43.9

Q ss_pred             EEEHHHHHHHHHH--CCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEEC
Q ss_conf             9984456876753--103589999999996420135899985165444414678850563057203
Q gi|254780606|r  532 VIIVDEMADLMMV--AGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQV  595 (744)
Q Consensus       532 vvviDE~a~l~~~--~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v  595 (744)
                      +|||||...+.-.  .++.....+..|+. .|-.|+-+||-||.|+  -|...||+.+..-+-++=
T Consensus        73 liViDE~~~~~~~r~~~~~~~~~i~~l~~-HRH~G~DiiliTQ~~~--~id~~ir~lve~~~~~~r  135 (183)
T pfam05707        73 LLVIDEAQTWFPSRRGGDKVPPVLDAFST-HRHLGWDIILITQNPS--KIDKQIRALVEHHVHCRR  135 (183)
T ss_pred             EEEEECCHHHCCCCCCCCCCCHHHHHHHH-CCCCCCEEEEEECCHH--HHHHHHHHHHCEEEEEEE
T ss_conf             99998976554887778888389999998-0778820899918979--972999986148999995


No 83 
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]
Probab=96.57  E-value=0.0026  Score=41.67  Aligned_cols=175  Identities=22%  Similarity=0.330  Sum_probs=77.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCC------EEEEEEEECCCEEEEEEECCCCCCHH--------HHHHHHHHHHHHHCC--
Q ss_conf             00788998899999987403551------38986764892589997548886399--------998599999987147--
Q gi|254780606|r  285 ITHEILEKNAGSLETILEEFGIK------GEIINVNPGPVVTLYEFEPAPGIKSS--------RVIGLADDIARSMSS--  348 (744)
Q Consensus       285 ~~~~~~~~~~~~l~~~l~~~~~~------~~~~~~~~gp~~~~~~~~~~~g~~~~--------~~~~~~~d~~~~~~~--  348 (744)
                      ++..+.+..++.+..-+..||.=      -.+.++-.-+....|-.. .-|+.-+        -+..+.+-|+..+..  
T Consensus        28 ~~~~e~~~l~~~i~~~~~g~G~Le~ll~dd~i~dImVn~~~~v~v~~-~~~~~~t~irf~d~~~l~~ii~ria~~vgrri  106 (355)
T COG4962          28 ISEAELDSLARDIQDELTGYGPLEPLLADDDIEDIMVNGPGRVFVER-KGGLEPTDIRFLDEAALLRIIQRIAAAVGRRI  106 (355)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCEEEEECCCCCEEEEE-CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             22578999999999875062320034408974168862787389993-27454578624898999999999999858810


Q ss_pred             --CCCEE-EEECCCCEEEEECCCCCCCEEEH-HHHHCCHHHCCCCCCEEEEEEECC---CCCEEECCHHH-CCCEEEEEC
Q ss_conf             --76327-75189834544268888870765-875128121146783689842057---88732112011-484699707
Q gi|254780606|r  349 --LSARV-AVIPKRNAIGIELPNETRETVYL-RQIIESRSFSHSKANLALCLGKTI---SGESVIADLAN-MPHILVAGT  420 (744)
Q Consensus       349 --~~~~~-~~~pg~~~~~~~~p~~~~~~v~~-~~~~~~~~~~~~~~~l~~~~g~~~---~g~~~~~dl~~-~PH~lvaG~  420 (744)
                        .+-.+ |..|..+-|-.-+|     .|.+ .-.+.-..|.+.+..|--.+....   ..-.+.+...+ -...||+|.
T Consensus       107 D~~~P~~darLpdGsRvna~~p-----Pva~dGp~lsIRKf~k~~ltl~dli~~gt~~~~~a~~L~~av~~r~NILisGG  181 (355)
T COG4962         107 DESQPIVDARLPDGSRLNANSP-----PVAIDGPTLSIRKFPKIKLTLLDLIIFGTMIRRAAKFLRRAVGIRCNILISGG  181 (355)
T ss_pred             CCCCCEEEEECCCCCEEEEECC-----CCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHCEEEEEECC
T ss_conf             4689636526798866775248-----63257875044125655255999987389588999999999862015999678


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-CCCCCEECCCCCCCCEEEEEEECHH
Q ss_conf             875344799999999998568011079997-2342100012577520000444417
Q gi|254780606|r  421 TGSGKSVAINTMIMSLLYRLRPDECRMIMV-DPKMLELSVYDGIPHLLTPVVTNPK  475 (744)
Q Consensus       421 TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-D~k~~~~~~~~~~ph~~~~v~~~~~  475 (744)
                      |||||+++||++.    ..-++++ +.+.| |--...+.    -||++- ..|.+.
T Consensus       182 TGSGKTTlLNal~----~~i~~~e-RvItiEDtaELql~----~ph~vr-L~TR~~  227 (355)
T COG4962         182 TGSGKTTLLNALS----GFIDSDE-RVITIEDTAELQLA----HPHVVR-LETRPP  227 (355)
T ss_pred             CCCCHHHHHHHHH----HCCCCCC-EEEEEEEHHHHCCC----CCCEEE-EEECCC
T ss_conf             7887999999997----1579765-08998123664469----985578-863488


No 84 
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=96.56  E-value=0.011  Score=37.45  Aligned_cols=153  Identities=18%  Similarity=0.214  Sum_probs=74.2

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC---CE-----------ECCCCCCCCEEEEE
Q ss_conf             21120114846997078753447999999999985680110799972342---10-----------00125775200004
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM---LE-----------LSVYDGIPHLLTPV  470 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~---~~-----------~~~~~~~ph~~~~v  470 (744)
                      +-+++.+.-.+.+-|-.|||||++|+. |.+| .+-+.-++.+--.|.+.   -+           |-.|.-+||+  .|
T Consensus        20 vsl~i~~Ge~v~i~GpSGsGKSTLl~~-i~gl-~~p~sG~i~i~g~~~~~~~~~~~~~~Rr~iG~VfQ~~~L~~~l--tV   95 (214)
T cd03292          20 INISISAGEFVFLVGPSGAGKSTLLKL-IYKE-ELPTSGTIRVNGQDVSDLRGRAIPYLRRKIGVVFQDFRLLPDR--NV   95 (214)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCC-CCCCCEEEEECCEECCCCCHHHHHHHHCCEEEEEECCCCCCCC--CH
T ss_conf             177985998999997999539999999-9629-8988649999999989899778999866749990187647999--79


Q ss_pred             EECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HH
Q ss_conf             444178768999999866769-99999807786799---------99988642026776665432338679998445-68
Q gi|254780606|r  471 VTNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MA  539 (744)
Q Consensus       471 ~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a  539 (744)
                      ..+.........+-..++.+| ..++...|..+...         -.+|++-.+.-.         .-|. +++.|| .+
T Consensus        96 ~eNv~~~l~~~~~~~~~~~~rv~~~L~~vgL~~~~~~~p~~LSGGqkQRvaIARALv---------~~P~-ill~DEPT~  165 (214)
T cd03292          96 YENVAFALEVTGVPPREIRKRVPAALELVGLSHKHRALPAELSGGEQQRVAIARAIV---------NSPT-ILIADEPTG  165 (214)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHH---------CCCC-EEEECCCCC
T ss_conf             999999999849999999999999998779965754994248889999999999997---------2999-999839878


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             767531035899999999964201358999851654
Q gi|254780606|r  540 DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       540 ~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .|--....++...+..|    +..|+-+|+.|..+.
T Consensus       166 ~LD~~~~~~i~~ll~~l----~~~g~Tii~vTHd~~  197 (214)
T cd03292         166 NLDPDTTWEIMNLLKKI----NKAGTTVVVATHAKE  197 (214)
T ss_pred             CCCHHHHHHHHHHHHHH----HHCCCEEEEECCCHH
T ss_conf             77989999999999999----850999999898989


No 85 
>pfam10236 DAP3 Mitochondrial ribosomal death-associated protein 3. This is a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29).
Probab=96.51  E-value=0.066  Score=32.06  Aligned_cols=69  Identities=19%  Similarity=0.223  Sum_probs=38.8

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE--CCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100--01257752000044441787689999998
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL--SVYDGIPHLLTPVVTNPKKAVMALKWAVR  486 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~--~~~~~~ph~~~~v~~~~~~~~~~l~~~~~  486 (744)
                      -.++-|..|+|||++|..++.- ++  .-+=+-|++=++...--  ..|...+. ....+.-+..+...|+....
T Consensus        25 r~vL~G~~GsGKS~~L~q~v~~-A~--~~~wiVl~vP~~~~~~~~~~~~~~s~~-~~~~ydqP~~a~~~L~~~~~   95 (274)
T pfam10236        25 RFVLTGERGSGKSVLLAQAMAY-AL--TQGWVVLHVPEAEDLVNGTTDYAPDPG-NPGLYDQPMYAAALLQRILK   95 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH-HH--HCCEEEEECCCHHHHHCCCCEEEECCC-CCCEEECHHHHHHHHHHHHH
T ss_conf             8998897997799999999999-98--599899984988998308642768899-99713578999999999999


No 86 
>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=96.51  E-value=0.002  Score=42.54  Aligned_cols=40  Identities=33%  Similarity=0.623  Sum_probs=27.8

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-CCCCC
Q ss_conf             484699707875344799999999998568011079997-23421
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-DPKML  455 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-D~k~~  455 (744)
                      --.+||+|.||||||++|++++..+    ...+-+++.| |+-..
T Consensus       139 ~~~ilIsG~TGSGKTT~l~all~~i----~~~~~riitiED~~El  179 (283)
T pfam00437       139 RGNILVSGGTGSGKTTLLYALLNEI----NTDDERIVTIEDPVEI  179 (283)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHC----CCCCCCEEEECCCCEE
T ss_conf             9759998899998899999999840----8777627873378523


No 87 
>PRK08082 consensus
Probab=96.51  E-value=0.019  Score=35.74  Aligned_cols=151  Identities=15%  Similarity=0.146  Sum_probs=77.1

Q ss_pred             CHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC-------CCCCCCE--EEEEEECHHHHH
Q ss_conf             2011484699707875344799999999998568011079997234210001-------2577520--000444417876
Q gi|254780606|r  408 DLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV-------YDGIPHL--LTPVVTNPKKAV  478 (744)
Q Consensus       408 dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~-------~~~~ph~--~~~v~~~~~~~~  478 (744)
                      -|.+.--.+|||.+|+|||.|..+|+..++.++.-   ..+++-.-|..-..       ..++++-  ...-.++.++  
T Consensus       199 G~~~g~LiviaaRPsmGKTa~alnia~~~a~~~~~---~V~~fSlEM~~~~l~~R~la~~s~i~~~~i~~g~l~~~e~--  273 (453)
T PRK08082        199 GFQRNDLIIVAARPSVGKTAFALNIAQNVATKTDE---NVAIFSLEMGADQLVMRMLCAEGNIDAQRLRTGSLTSDDW--  273 (453)
T ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC---CEEEEECCCCHHHHHHHHHHCCCCCCHHHHHCCCCCHHHH--
T ss_conf             77758579998678875789999999999985599---4899731389899999999715588866775189999999--


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC-------HHHHH
Q ss_conf             89999998667699999980778679999988642026776665432338679998445687675310-------35899
Q gi|254780606|r  479 MALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG-------KEIEG  551 (744)
Q Consensus       479 ~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~-------~~~e~  551 (744)
                      ..+.++..+|.+.--.+.....-++.....+.+......           ..=+||||=+. ||...+       .++..
T Consensus       274 ~~i~~a~~~l~~~~l~idd~~~~~i~~i~~~~r~~~~~~-----------~~~livIDYlq-Li~~~~~~~~~r~~ev~~  341 (453)
T PRK08082        274 GKLTMAMGSLSNAGIYIDDTPGIRVNEIRAKCRRLKQEQ-----------GLGMILIDYLQ-LIQGSGRSGENRQQEVSE  341 (453)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHC-----------CCCEEEEECHH-HCCCCCCCCCCHHHHHHH
T ss_conf             999999998506973897899998999999999999866-----------99889995077-337789888789999999


Q ss_pred             HHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             999999964201358999851654
Q gi|254780606|r  552 AIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       552 ~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .-..|-++|+.++|.+|+.+|=-.
T Consensus       342 isr~LK~lAkel~ipvi~lsQLnR  365 (453)
T PRK08082        342 ISRTLKALARELEVPVIALSQLSR  365 (453)
T ss_pred             HHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             999999999996997999644784


No 88 
>PRK06321 replicative DNA helicase; Provisional
Probab=96.50  E-value=0.038  Score=33.70  Aligned_cols=147  Identities=16%  Similarity=0.187  Sum_probs=76.5

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE--E-----CCCCCCCC--EEEEEEECHHHHHHHH
Q ss_conf             1484699707875344799999999998568011079997234210--0-----01257752--0000444417876899
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE--L-----SVYDGIPH--LLTPVVTNPKKAVMAL  481 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~--~-----~~~~~~ph--~~~~v~~~~~~~~~~l  481 (744)
                      +.--++|||.+|+|||.|..+|...++.++.   ....++-.-|..  +     +...++++  +...-+++.+  ...+
T Consensus       225 ~GdliviaaRPsmGKTalalnia~~~a~~~~---~~v~~fSLEMs~~ql~~R~ls~~s~i~~~~i~~g~l~~~e--~~~~  299 (472)
T PRK06321        225 PSNLMILAARPAMGKTALALNIAENFCFQNR---LPVGIFSLEMTVDQLIHRIICSRSEVESKKISVGDLSGRD--FQRI  299 (472)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHCC---CCEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHH--HHHH
T ss_conf             6757998538999779999999999998569---9469975779999999999874037675521047999999--9999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC---------HHHHHH
Q ss_conf             99998667699999980778679999988642026776665432338679998445687675310---------358999
Q gi|254780606|r  482 KWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG---------KEIEGA  552 (744)
Q Consensus       482 ~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~---------~~~e~~  552 (744)
                      .+++.+|...--.+.....-+|.....+.+..+...           ..=+||||=+. ||...+         .++...
T Consensus       300 ~~a~~~l~~~~l~idd~~~~ti~~i~~~~r~~k~~~-----------~l~~vvIDYlq-L~~~~~~~~~~~~r~~~i~~i  367 (472)
T PRK06321        300 VSVVNEMQEHTLLIDDQPGLKITDLRARARRMKESY-----------DIQFLIIDYLQ-LLSGSGTLRNSESRQTEISEI  367 (472)
T ss_pred             HHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHC-----------CCCEEEEEEHH-HCCCCCCCCCCCCHHHHHHHH
T ss_conf             999999854875786799998999999999998738-----------99879997277-416777777788899999999


Q ss_pred             HHHHHHHHHCCEEEEEEEECCC
Q ss_conf             9999996420135899985165
Q gi|254780606|r  553 IQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       553 ~~~la~~~ra~GihlilatQrp  574 (744)
                      -..|-.+|+.++|.+|+..|=-
T Consensus       368 sr~lK~lAkel~vpvi~LsQLn  389 (472)
T PRK06321        368 SRMLKNLARELNIPILCLSQLS  389 (472)
T ss_pred             HHHHHHHHHHHCCCEEEECCCC
T ss_conf             9999999999799799972268


No 89 
>PRK07004 replicative DNA helicase; Provisional
Probab=96.49  E-value=0.026  Score=34.88  Aligned_cols=150  Identities=19%  Similarity=0.160  Sum_probs=77.0

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC-------CCCCCCCE--EEEEEECHHHHHH
Q ss_conf             01148469970787534479999999999856801107999723421000-------12577520--0004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS-------VYDGIPHL--LTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~-------~~~~~ph~--~~~v~~~~~~~~~  479 (744)
                      |.+.--++|||.+|+|||.|..+|....+.++   ....+++-.-|..-.       ...++++.  ...-.++.+  ..
T Consensus       210 l~~gdLiIIAARPsmGKTafAlniA~n~A~~~---g~~V~~FSLEMs~eql~~Rlls~~s~I~~~~ir~g~l~~~e--~~  284 (460)
T PRK07004        210 MHGGELIIVAGRPSMGKTAFSMNIGEYVAVEY---GLPVAVFSMEMPGTQLAMRMLGSVGRLDQHRMRTGRLTDED--WP  284 (460)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHC---CCCEEEECCCCCHHHHHHHHHHHCCCCCCCHHHCCCCCHHH--HH
T ss_conf             98775799973687642699999999998725---88669984779999999999986069882110078899999--99


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHHHH
Q ss_conf             9999998667699999980778679999988642026776665432338679998445687675310------3589999
Q gi|254780606|r  480 ALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEGAI  553 (744)
Q Consensus       480 ~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~~~  553 (744)
                      .+.+++.+|...--.+.....-++.....+.+......    +    ++  =+||||=+. ||...+      .++...-
T Consensus       285 ~i~~a~~~l~~~~l~IdD~~~lt~~~ira~~Rr~~~~~----g----~l--~lvviDYlq-li~~~~~~~~r~~ei~~is  353 (460)
T PRK07004        285 KLTHAVQKMSEAQLFIDETGGLNPMELRSRARRLARQC----G----KL--GLIIIDYLQ-LMSGSSQGENRATEISEIS  353 (460)
T ss_pred             HHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHC----C----CC--CEEEEEHHH-HCCCCCCCCCHHHHHHHHH
T ss_conf             99999999855974896898730789999999999743----5----88--899850775-4478888888999999999


Q ss_pred             HHHHHHHHCCEEEEEEEECCC
Q ss_conf             999996420135899985165
Q gi|254780606|r  554 QRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       554 ~~la~~~ra~GihlilatQrp  574 (744)
                      ..|-++|+-++|.+|+.+|=-
T Consensus       354 r~lK~lAkel~ipvi~lsQLn  374 (460)
T PRK07004        354 RSLKSLAKELDVPVIALSQLN  374 (460)
T ss_pred             HHHHHHHHHHCCCEEEECCCC
T ss_conf             999999999699789970468


No 90 
>PHA00520 packaging NTPase P4
Probab=96.48  E-value=0.02  Score=35.65  Aligned_cols=124  Identities=20%  Similarity=0.321  Sum_probs=65.6

Q ss_pred             CCCCEEECCHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEE-EECH
Q ss_conf             788732112011----48469970787534479999999999856801107999723421000125775200004-4441
Q gi|254780606|r  400 ISGESVIADLAN----MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPV-VTNP  474 (744)
Q Consensus       400 ~~g~~~~~dl~~----~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v-~~~~  474 (744)
                      ..-.|++..+-.    ---.+|-|.||||||.++|.+..-|.-+..-     +.|-+.. -+.-|+-..   .++ ++|.
T Consensus        97 ~a~~pvv~~~~~~~i~SG~~vv~G~t~sGKT~~lna~~~~~~~k~~~-----v~IRwGE-p~e~yde~e---~~~~~sdL  167 (326)
T PHA00520         97 VACSPVVHRWGGHRIASGMVIVTGGTGSGKTPLLNALGEPLGGKDKD-----VTVRWGE-PLEGYDEAE---RPLYGSDL  167 (326)
T ss_pred             CCCCCCEEECCCCCCCCCEEEEECCCCCCCCHHHHHHHCCCCCCCCC-----EEEEECC-CCCCCCCCC---CCCCCCCH
T ss_conf             02453100036652104249996478888675566542102589987-----4898368-543346201---33210449


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC--------
Q ss_conf             787689999998667699999980778679999988642026776665432338679998445687675310--------
Q gi|254780606|r  475 KKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG--------  546 (744)
Q Consensus       475 ~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~--------  546 (744)
                      ...+..   +..-|                                       +-..+|+||-|..+.-..+        
T Consensus       168 ~~~l~v---~l~a~---------------------------------------~~~~vvvvDSlR~v~~~l~Gnat~GGI  205 (326)
T PHA00520        168 NVFLAV---ILRAM---------------------------------------LQHRVVVVDSLRNVIFALGGNATSGGI  205 (326)
T ss_pred             HHHHHH---HHHHH---------------------------------------HCCCEEEEECHHHHHHHCCCCCCCCCH
T ss_conf             999999---99986---------------------------------------457179952146666441378787744


Q ss_pred             -HHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             -35899999999964201358999851654
Q gi|254780606|r  547 -KEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       547 -~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                       .-+-.+|..|.+++++.|+.+|++- .|.
T Consensus       206 Sr~~y~~LTdl~n~aas~gc~vV~~l-NPm  234 (326)
T PHA00520        206 SRGAYDLLTDIGNMAASRGCVVVASL-NPM  234 (326)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEC-CCC
T ss_conf             68899999888888876395799973-888


No 91 
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=96.48  E-value=0.014  Score=36.58  Aligned_cols=156  Identities=15%  Similarity=0.222  Sum_probs=76.5

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC-------CCCCCCCEEEE
Q ss_conf             887321120----1148469970787534479999999999856801107999723421000-------12577520000
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS-------VYDGIPHLLTP  469 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~-------~~~~~ph~~~~  469 (744)
                      +|+++.-|+    .+.=++-|.|.||||||++++.|+ .+ |-+ -..+.+--+|.+.....       ....-+|++..
T Consensus       361 ~~~~vL~~is~~i~~Ge~vaIVG~SGsGKSTl~~LL~-g~-~p~-~G~I~i~g~di~~i~~~~lr~~i~~V~Q~~~LF~~  437 (588)
T PRK11174        361 DGKTLAGPLNFTLPAGQRVALVGPSGAGKTSLLNALL-GF-LPY-QGSLKINGIELRELDPESWRKHLSWVGQNPQLFHG  437 (588)
T ss_pred             CCCEECCCEEEEECCCCEEEEECCCCCCHHHHHHHHH-HH-CCC-CCEEEECCEECCCCCHHHHHHHEEEECCCCCCCCC
T ss_conf             9985103646997499789998999864999999998-72-898-83899999860308999999660351666777766


Q ss_pred             -----------EEECHHHHHHHHHHH-----HHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHCCCCCCCCCCCCCCCEEE
Q ss_conf             -----------444417876899999-----9866769999998077867-99999886420267766654323386799
Q gi|254780606|r  470 -----------VVTNPKKAVMALKWA-----VREMEERYRKMSHLSVRNI-KSYNERISTMYGEKPQGCGDDMRPMPYIV  532 (744)
Q Consensus       470 -----------v~~~~~~~~~~l~~~-----~~em~~r~~~~~~~~~~~i-~~~n~~~~~~~~~~~~~~~~~~~~~p~iv  532 (744)
                                 -++| ++...+++.+     +..|...|+..-..+..++ .+=.+|++-.+.-..        . |- +
T Consensus       438 TI~eNI~~g~~~atd-eei~~A~~~a~~~~~I~~Lp~GldT~vge~G~~LSGGQrQRiaiARAll~--------~-~~-I  506 (588)
T PRK11174        438 TLRDNVLLANPDASD-EQLQQALENAWVSEFVPLLPQGLDTPIGDQAAGLSVGQAQRLALARALLQ--------P-CQ-L  506 (588)
T ss_pred             CHHHHHHCCCCCCCH-HHHHHHHHHHHHHHHHHHCCCCCCCHHCCCCCCCCHHHHHHHHHHHHHHC--------C-CC-E
T ss_conf             299865335854334-57999999862478998451322363228888779999999999999837--------9-89-8


Q ss_pred             EEHHHHHHHHHHCCHHHHHHHHH-HHHHHHCCEEEEEEEECCCC
Q ss_conf             98445687675310358999999-99964201358999851654
Q gi|254780606|r  533 IIVDEMADLMMVAGKEIEGAIQR-LAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       533 vviDE~a~l~~~~~~~~e~~~~~-la~~~ra~GihlilatQrp~  575 (744)
                      +|.||.---+.   .+-|..|.+ |.+.  .-|--+|+-|.|++
T Consensus       507 LILDEaTSaLD---~~tE~~i~~~L~~~--~~~rTviiIaHRls  545 (588)
T PRK11174        507 LLLDEPTASLD---AHSEQLVMQALNAA--SQGQTTLMVTHQLE  545 (588)
T ss_pred             EEEECCCCCCC---HHHHHHHHHHHHHH--CCCCEEEEEECCHH
T ss_conf             99989877989---99999999999986--79998999806799


No 92 
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.46  E-value=0.015  Score=36.53  Aligned_cols=164  Identities=19%  Similarity=0.265  Sum_probs=78.8

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE--CC---CC-----------CEECCCCCCCCEEE
Q ss_conf             2112011484699707875344799999999998568011079997--23---42-----------10001257752000
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV--DP---KM-----------LELSVYDGIPHLLT  468 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li--D~---k~-----------~~~~~~~~~ph~~~  468 (744)
                      +-+++.+.-.+-|-|..|||||++++ +|.+|.   .|+.=.+++-  |.   +.           .-|-.|+-+|++  
T Consensus        24 vsl~i~~Ge~~~ivG~SGsGKSTllr-~i~gL~---~p~sG~I~~~g~~i~~~~~~~~~~~Rr~ig~VFQ~~~L~~~~--   97 (233)
T cd03258          24 VSLSVPKGEIFGIIGRSGAGKSTLIR-CINGLE---RPTSGSVLVDGTDLTLLSGKELRKARRRIGMIFQHFNLLSSR--   97 (233)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCCEEEECCEECCCCCHHHHHHHHCCCCEEECCCCCCCCC--
T ss_conf             28899999999998898058999999-996799---999808999999989799999999862587794377889988--


Q ss_pred             EEEECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHH-H--------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH
Q ss_conf             04444178768999999866769-99999807786799-9--------99886420267766654323386799984456
Q gi|254780606|r  469 PVVTNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKS-Y--------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEM  538 (744)
Q Consensus       469 ~v~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~-~--------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~  538 (744)
                      .+..+.........+-..+..+| .+++...|..+... |        .+|+...+.-         -.-|.| ++.||=
T Consensus        98 tv~~nv~~~l~~~~~~~~~~~~r~~~lL~~vgL~~~~~~yP~eLSGGq~QRVaIARAL---------~~~P~l-llaDEP  167 (233)
T cd03258          98 TVFENVALPLEIAGVPKAEIEERVLELLELVGLEDKADAYPAQLSGGQKQRVGIARAL---------ANNPKV-LLCDEA  167 (233)
T ss_pred             CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHH---------HCCCCE-EEECCC
T ss_conf             3999999999974999999999999999867991676269652677888999999998---------339989-996597


Q ss_pred             H-HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             8-7675310358999999999642013589998516544441467885056305720
Q gi|254780606|r  539 A-DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       539 a-~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
                      . .|-.....++.+   -|..+-+..|+-+|+.|--..  ++     ..+..||++-
T Consensus       168 Ts~LD~~~~~~il~---ll~~l~~e~g~t~i~vTHDl~--~~-----~~~adrv~vm  214 (233)
T cd03258         168 TSALDPETTQSILA---LLRDINRELGLTIVLITHEME--VV-----KRICDRVAVM  214 (233)
T ss_pred             CCCCCHHHHHHHHH---HHHHHHHHHCCEEEEECCCHH--HH-----HHHCCEEEEE
T ss_conf             66469889999999---999999972989999898999--99-----9869979999


No 93 
>PRK08760 replicative DNA helicase; Provisional
Probab=96.46  E-value=0.028  Score=34.63  Aligned_cols=148  Identities=17%  Similarity=0.190  Sum_probs=73.0

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC-------CCCCCC--EEEEEEECHHHHHH
Q ss_conf             011484699707875344799999999998568011079997234210001-------257752--00004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV-------YDGIPH--LLTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~-------~~~~ph--~~~~v~~~~~~~~~  479 (744)
                      |...--++|||.+|+|||.|..+|....+.+...   ..+++-.-|..-..       -.++++  +...-.++.++  .
T Consensus       226 l~~G~LiViaaRPsmGKTalalnia~~~A~~~~~---~V~~fSLEMs~~ql~~Rlls~~s~v~~~~i~~g~l~~~e~--~  300 (476)
T PRK08760        226 LQPTDLIILAARPAMGKTTFALNIAEYAAIKSKK---GVAVFSMEMSASQLAMRLISSNGRINAQRLRTGALEDEDW--A  300 (476)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC---CEEEEECCCCHHHHHHHHHHHHCCCCHHHHHCCCCCHHHH--H
T ss_conf             9877779998778874789999999999983799---7899703699999999999983389767776489999999--9


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHHHH
Q ss_conf             9999998667699999980778679999988642026776665432338679998445687675310------3589999
Q gi|254780606|r  480 ALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEGAI  553 (744)
Q Consensus       480 ~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~~~  553 (744)
                      .+..+..+|...--.+.....-++.....+.+......      .   +  =+||||=+. ||...+      .++...-
T Consensus       301 ~~~~a~~~l~~~~l~idD~~~~t~~~ir~~~R~~k~~~------~---l--~lvvIDYLq-L~~~~~~~~~r~~~v~~is  368 (476)
T PRK08760        301 RVTGAIKMLKETKIFIDDTPGVSPEVLRSKCRRLKREH------D---L--GLIVIDYLQ-LMSVPGNSENRATEISEIS  368 (476)
T ss_pred             HHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHHHC------C---C--CEEEEEHHH-HCCCCCCCCCHHHHHHHHH
T ss_conf             99999999860881685799999999999999998727------9---9--879997076-4158888744889999999


Q ss_pred             HHHHHHHHCCEEEEEEEECC
Q ss_conf             99999642013589998516
Q gi|254780606|r  554 QRLAQMARAAGIHLIMATQR  573 (744)
Q Consensus       554 ~~la~~~ra~GihlilatQr  573 (744)
                      ..|-.+|+.++|.+|+..|=
T Consensus       369 r~lK~lAkel~vpVi~LsQL  388 (476)
T PRK08760        369 RSLKGLAKELNVPVIALSQL  388 (476)
T ss_pred             HHHHHHHHHHCCCEEEECCC
T ss_conf             99999999979978996315


No 94 
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=96.42  E-value=0.029  Score=34.52  Aligned_cols=33  Identities=24%  Similarity=0.367  Sum_probs=21.3

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             3211201148469970787534479999999999
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      -+-+++.+.--+-|+|.-|||||+++++ |++|+
T Consensus       302 ~vs~~v~~GEi~gi~G~nGsGKsTL~k~-l~Gl~  334 (520)
T TIGR03269       302 NVSLEVKEGEIFGIVGTSGAGKTTLSKI-IAGVL  334 (520)
T ss_pred             CEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC
T ss_conf             2068972896899987888878999999-94887


No 95 
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.41  E-value=0.022  Score=35.39  Aligned_cols=207  Identities=18%  Similarity=0.258  Sum_probs=93.6

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECCCCC-EE--------CCCCCCC-CEEEEEE-
Q ss_conf             211201148469970787534479999999999856801107999--723421-00--------0125775-2000044-
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDPKML-EL--------SVYDGIP-HLLTPVV-  471 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~k~~-~~--------~~~~~~p-h~~~~v~-  471 (744)
                      +-+++.+.-.+.|.|.+|||||++++. |.+|+   .|+.=++++  .|.+.. .+        ..|++.- +++...+ 
T Consensus        21 vsl~i~~Ge~vaiiG~nGsGKSTL~~~-l~Gll---~P~~G~I~v~G~d~~~~~~~~~~r~~ig~vfQ~p~~q~~~~tV~   96 (274)
T PRK13644         21 INLVIKKGEYIGIIGKNGSGKSTLALH-LNGLL---RPQKGKVLVSGIDTGDFSKLQGIRKLVGIVFQNPETQFVGRTVE   96 (274)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEECCEECCCCHHHHHHHHHEEEEEECCCCCCCCCCHH
T ss_conf             177984899999999999809999999-97068---58887299999987870567999873179965821103615199


Q ss_pred             ECHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH-
Q ss_conf             441787689999998667699-9999807786799---------99988642026776665432338679998445687-
Q gi|254780606|r  472 TNPKKAVMALKWAVREMEERY-RKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD-  540 (744)
Q Consensus       472 ~~~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~-  540 (744)
                      .+.......+.+-..|+.+|. +.++..|..+...         -.+|++-...         +..-|. +++.||=.. 
T Consensus        97 e~iafg~~~~~l~~~e~~~~v~~aL~~~gl~~~~~~~p~~LSGGqkQRvaiA~a---------La~~P~-iLiLDEPTs~  166 (274)
T PRK13644         97 EDLAFGPENLCLPPIEIRKRVDRALAEIGLEKYRHRSPKTLSGGQGQCVALAGI---------LTMEPE-CLIFDEVTSM  166 (274)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHH---------HHHCCC-EEEEECCCCC
T ss_conf             999621976699999999999999998596877628911099769999999999---------982999-9999798667


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEE
Q ss_conf             67531035899999999964201358999851654444146788505630572036811100326763168856898468
Q gi|254780606|r  541 LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDML  620 (744)
Q Consensus       541 l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l  620 (744)
                      |-.....++...+.+|.+    .|.-+|+.|.+.+      .++ + --||.+=-    +-++|.+. -.+.++.+-+ |
T Consensus       167 LD~~~~~~i~~~l~~L~~----~g~TvI~itHdl~------~~~-~-aDrvivl~----~G~Iv~~G-~p~eif~~~~-l  228 (274)
T PRK13644        167 LDPDSGIAVLERIKKLHE----KGKTIVYITHNLE------ELH-D-ADRIIVMD----RGKIVLEG-EPENVLSDVS-L  228 (274)
T ss_pred             CCHHHHHHHHHHHHHHHH----CCCEEEEEEECHH------HHH-C-CCEEEEEE----CCEEEEEC-CHHHHHCCHH-H
T ss_conf             899999999999999986----8999999833789------997-1-99899998----99999987-9899848962-8


Q ss_pred             EECCCCCEEEEEECCCCHHHHHHHHHHHHHCCCC
Q ss_conf             6468984389993438988999999999840887
Q gi|254780606|r  621 YMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCP  654 (744)
Q Consensus       621 ~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~  654 (744)
                                 +..-+....+-++...++.+|-+
T Consensus       229 -----------~~~~l~~P~~~~~~~~L~~~g~~  251 (274)
T PRK13644        229 -----------QTLGLTPPSLIELAENLKMHGVV  251 (274)
T ss_pred             -----------HHCCCCCCHHHHHHHHHHHCCCC
T ss_conf             -----------87699998499999999976998


No 96 
>PRK07263 consensus
Probab=96.39  E-value=0.034  Score=34.01  Aligned_cols=152  Identities=15%  Similarity=0.131  Sum_probs=75.8

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC-------CCCC--CEEEEEEECHHHHHH
Q ss_conf             0114846997078753447999999999985680110799972342100012-------5775--200004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY-------DGIP--HLLTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~-------~~~p--h~~~~v~~~~~~~~~  479 (744)
                      |.+.--++|||.+|+|||.|..+|+..++.++   ....+++-.-|..-...       .+++  ++...-.++.++  .
T Consensus       200 l~~GdLiviaaRPsmGKTa~alnia~~iA~~~---~~~V~~fSlEMs~~ql~~R~la~~~~i~~~~i~~g~l~~~e~--~  274 (453)
T PRK07263        200 LHPDQLIILAARPAVGKTAFVLNIAQNVGTKQ---KKTVAIFSLEMGAESLVDRMLAAEGMVDSHSLRTGQLTDQDW--N  274 (453)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHC---CCEEEEEECCCCHHHHHHHHHHHHCCCCHHCCCCCCCCHHHH--H
T ss_conf             99786899972788847899999999999855---982899924699899999999986173310331365247999--9


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC-----HHHHHHHH
Q ss_conf             9999998667699999980778679999988642026776665432338679998445687675310-----35899999
Q gi|254780606|r  480 ALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG-----KEIEGAIQ  554 (744)
Q Consensus       480 ~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~-----~~~e~~~~  554 (744)
                      .+..+..+|...--.+.....-++.....+.+........    .     -=+||||=+. ||...+     .++...-.
T Consensus       275 ~~~~a~~~l~~~~l~idd~~~~~i~~i~~~~r~~~~~~~~----~-----l~livIDYlq-Li~~~~~~~r~~ev~~isr  344 (453)
T PRK07263        275 NVTIAQGALAEAPIYIDDTPGIKITEIRARSRKLSQEVDG----G-----LGLIVIDYLQ-LITGTKPENRQQEVSDISR  344 (453)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCC----C-----CCEEEEEHHH-HCCCCCCCCHHHHHHHHHH
T ss_conf             9999998740685899789999989999999999986058----9-----8689973676-4468885359999999999


Q ss_pred             HHHHHHHCCEEEEEEEECCCC
Q ss_conf             999964201358999851654
Q gi|254780606|r  555 RLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       555 ~la~~~ra~GihlilatQrp~  575 (744)
                      .|-.+|+-++|.+|+.+|=-.
T Consensus       345 ~lK~lAkel~ipvi~lsQLnR  365 (453)
T PRK07263        345 QLKILAKELKVPVIALSQLSR  365 (453)
T ss_pred             HHHHHHHHHCCCEEEECCCCC
T ss_conf             999999987997999743684


No 97 
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=96.39  E-value=0.026  Score=34.87  Aligned_cols=38  Identities=29%  Similarity=0.431  Sum_probs=25.9

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC
Q ss_conf             8469970787534479999999999856801107999723
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP  452 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~  452 (744)
                      -+++|.+.||||||.+.-.++..++.+..  .-+.+++=|
T Consensus        25 ~~~~i~~~tGsGKT~~~~~~~~~~~~~~~--~~~~li~~P   62 (201)
T smart00487       25 RDVILAAPTGSGKTLAALLPALEALKRGK--GKRVLVLVP   62 (201)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHCCC--CCEEEEEEC
T ss_conf             98899899996099999999999863389--975999908


No 98 
>PRK06749 replicative DNA helicase; Provisional
Probab=96.38  E-value=0.039  Score=33.66  Aligned_cols=151  Identities=14%  Similarity=0.123  Sum_probs=73.3

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC-------CCCCC--EEEE--EEECHHHH
Q ss_conf             0114846997078753447999999999985680110799972342100012-------57752--0000--44441787
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY-------DGIPH--LLTP--VVTNPKKA  477 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~-------~~~ph--~~~~--v~~~~~~~  477 (744)
                      |...--++|||.+|+|||.|...|....+..+.    ...++-.-|..-...       .+++.  +..+  ..++.++ 
T Consensus       183 l~~g~LiviaaRPsmGKTa~alnia~~~a~~g~----~v~~fSlEMs~~~l~~R~ls~~s~v~~~~i~~~~~~~~~~~~-  257 (428)
T PRK06749        183 LQEGDFVVLGARPSMGKTAFALNVGLHAAKSGA----AVGLFSLEMSSKQLLKRMASCVGEVSGGRLKNPKHRFAMEDW-  257 (428)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC----CEEEEECCCCHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHH-
T ss_conf             998868999627989768999999999996499----279983789999999999997549988886277677999999-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC-------HHHH
Q ss_conf             689999998667699999980778679999988642026776665432338679998445687675310-------3589
Q gi|254780606|r  478 VMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG-------KEIE  550 (744)
Q Consensus       478 ~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~-------~~~e  550 (744)
                       ..+..++.+|...--.+......++.....+.+......    +     .-..+||||=+. ||...+       .++.
T Consensus       258 -~~~~~a~~~l~~~~l~i~d~~~~ti~~i~~~~r~~~~~~----g-----~~~~livIDYlq-Li~~~~~~~~~r~~ev~  326 (428)
T PRK06749        258 -EKVSKAFAEIGELPLEIYDNAGVTVQDIWMQTRKLKRKH----G-----DKKVLIIVDYLQ-LITGDPKHKGNRFQEIS  326 (428)
T ss_pred             -HHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHC----C-----CCCEEEEEEHHH-HCCCCCCCCCCHHHHHH
T ss_conf             -999999999855965997589976799999999999974----9-----987699976776-50578777778999999


Q ss_pred             HHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             9999999964201358999851654
Q gi|254780606|r  551 GAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       551 ~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ..-..|-.+|+-++|.+|+.+|=-.
T Consensus       327 ~isr~lK~lAkel~vpvi~lsQLnR  351 (428)
T PRK06749        327 EISRKLKLLARELNVCVVALSQLSR  351 (428)
T ss_pred             HHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             9999999999996998999713785


No 99 
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=96.38  E-value=0.014  Score=36.77  Aligned_cols=30  Identities=20%  Similarity=0.336  Sum_probs=23.3

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             2112011484699707875344799999999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMS  435 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~s  435 (744)
                      +-+++.+.-.+-|.|.-|||||++++.| ++
T Consensus       279 vs~~v~~GE~~~i~G~nGsGKSTLl~~l-~G  308 (490)
T PRK10938        279 LSWQVNPGEHWQIVGPNGAGKSTLLSLI-TG  308 (490)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHH-HC
T ss_conf             5789838988999867888799999998-08


No 100
>PRK05748 replicative DNA helicase; Provisional
Probab=96.37  E-value=0.031  Score=34.30  Aligned_cols=150  Identities=17%  Similarity=0.171  Sum_probs=71.6

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC-------CCCCCCC--EEEEEEECHHHHHH
Q ss_conf             01148469970787534479999999999856801107999723421000-------1257752--00004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS-------VYDGIPH--LLTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~-------~~~~~ph--~~~~v~~~~~~~~~  479 (744)
                      |.+.--++|||.+|+|||.|...|+..++.+..   ...+++-.-|..-.       ...+++.  +...-.++.++  .
T Consensus       200 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~~~---~~v~~fSlEM~~~~l~~R~la~~s~v~~~~i~~g~l~~~~~--~  274 (448)
T PRK05748        200 LQPNDLIIVAARPSVGKTAFALNIAQNVATKTD---KNVAIFSLEMGAESLVMRMLCAEGRIDQQKLRTGQLTDEDW--P  274 (448)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCC---CEEEEEECCCCHHHHHHHHHHHHHCCCHHHHHCCCCCHHHH--H
T ss_conf             886737999847998768999999999998569---80899817788889999999997467777776289999999--9


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC-------HHHHHH
Q ss_conf             9999998667699999980778679999988642026776665432338679998445687675310-------358999
Q gi|254780606|r  480 ALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG-------KEIEGA  552 (744)
Q Consensus       480 ~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~-------~~~e~~  552 (744)
                      .+..++.+|...--.+.....-++.....+........     .   .  .=+||||=+. ||...+       .++...
T Consensus       275 ~~~~a~~~l~~~~l~i~d~~~~ti~~i~~~~r~~~~~~-----~---~--~~~vviDYlq-li~~~~~~~~~r~~ev~~i  343 (448)
T PRK05748        275 KLTIAVGSLSDAPIYIDDTPGIKVTEIRARCRRLAQEH-----G---G--LGLIVIDYLQ-LIQGSGRSGENRQQEVSEI  343 (448)
T ss_pred             HHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHC-----C---C--CCEEEEEHHH-HCCCCCCCCCCHHHHHHHH
T ss_conf             99999999865983785589886899999999999975-----9---9--8899971686-4477787764399999999


Q ss_pred             HHHHHHHHHCCEEEEEEEECCC
Q ss_conf             9999996420135899985165
Q gi|254780606|r  553 IQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       553 ~~~la~~~ra~GihlilatQrp  574 (744)
                      -..|-++|+.++|.+|+..|=-
T Consensus       344 sr~lK~lAkel~ipvi~lsQLn  365 (448)
T PRK05748        344 SRSLKALAKELKVPVIALSQLS  365 (448)
T ss_pred             HHHHHHHHHHHCCCEEEECCCC
T ss_conf             9999999999699889970268


No 101
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport.  These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2).  No known transmembrane proteins or domains are associated with these proteins.
Probab=96.36  E-value=0.013  Score=36.83  Aligned_cols=35  Identities=20%  Similarity=0.311  Sum_probs=26.0

Q ss_pred             CHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCH
Q ss_conf             20114846997078753447999999999985680
Q gi|254780606|r  408 DLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRP  442 (744)
Q Consensus       408 dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p  442 (744)
                      ++.+.-.++|-|.-|||||++|+++.+-++.....
T Consensus        17 ~l~~g~~~iItGpN~sGKSt~Lr~i~l~~~~a~~~   51 (162)
T cd03227          17 TFGEGSLTIITGPNGSGKSTILDAIGLALGGAQSA   51 (162)
T ss_pred             ECCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             60898689998998775799999999999986326


No 102
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=96.35  E-value=0.038  Score=33.68  Aligned_cols=134  Identities=17%  Similarity=0.210  Sum_probs=76.1

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100012577520000444417876899999986676999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYR  493 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~  493 (744)
                      -++|-|.-.||||++|+++-+..++.+.--     .+--|..++..|+.+-   + -+.+.+.....+-....||.+-..
T Consensus        33 ~~iiTGpN~~GKSt~lk~i~l~~ilaq~G~-----~vpa~~~~~~~~d~i~---~-~i~~~d~~~~~~StF~~e~~~~~~  103 (222)
T cd03287          33 CQIITGPNMGGKSSYIRQVALITIMAQIGS-----FVPASSATLSIFDSVL---T-RMGASDSIQHGMSTFMVELSETSH  103 (222)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHCC-----CCCHHHCEEECCCEEE---E-ECCCCCHHHCCCCHHHHHHHHHHH
T ss_conf             899978998872899999999999997267-----7214563996357599---9-506786234452279999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHH-HHHHHHHHHCCEEEEEEEEC
Q ss_conf             99980778679999988642026776665432338679998445687675310358999-99999964201358999851
Q gi|254780606|r  494 KMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGA-IQRLAQMARAAGIHLIMATQ  572 (744)
Q Consensus       494 ~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~-~~~la~~~ra~GihlilatQ  572 (744)
                      .+....                             ..-+|++||+..  -+...|-... ..-|-.+.+--|.+.|++|-
T Consensus       104 il~~~~-----------------------------~~sLvliDEl~~--GT~~~eg~ala~aile~l~~~~~~~~i~tTH  152 (222)
T cd03287         104 ILSNCT-----------------------------SRSLVILDELGR--GTSTHDGIAIAYATLHYLLEEKKCLVLFVTH  152 (222)
T ss_pred             HHHHCC-----------------------------CCCEEEECCCCC--CCCHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             998678-----------------------------875442322468--9983577999999999998605889999476


Q ss_pred             CCCCCCCHHHHHHCCCCEE
Q ss_conf             6544441467885056305
Q gi|254780606|r  573 RPSVDVITGTIKANFPIRI  591 (744)
Q Consensus       573 rp~~~vi~~~ik~n~~~ri  591 (744)
                      ...   |.. +..+.+.++
T Consensus       153 ~~~---L~~-l~~~~~~~v  167 (222)
T cd03287         153 YPS---LGE-ILRRFEGSI  167 (222)
T ss_pred             CHH---HHH-HHHHCCCCE
T ss_conf             278---999-987587845


No 103
>PRK10875 recD exonuclease V subunit alpha; Provisional
Probab=96.34  E-value=0.068  Score=31.98  Aligned_cols=134  Identities=16%  Similarity=0.212  Sum_probs=64.9

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHH
Q ss_conf             14846997078753447999999999985680110799972342100012577520000444417876899999986676
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEE  490 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~  490 (744)
                      .-+-.+|.|..|.|||..+..||.-|+..+.-..+++.|.=                     -..+|+.-|......--.
T Consensus       161 ~~~~~vIsGGPGTGKTttV~~lLa~l~~~~~~~~l~I~LaA---------------------PTGKAAaRL~Esi~~~~~  219 (607)
T PRK10875        161 TRRISVISGGPGTGKTTTVAKLLAALIQLADGERCRIRLAA---------------------PTGKAAARLTESLGKALR  219 (607)
T ss_pred             HCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEC---------------------CHHHHHHHHHHHHHHHHH
T ss_conf             55778996799987788999999999996458997089988---------------------228999999999987875


Q ss_pred             HHHHH----HH--CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCE
Q ss_conf             99999----98--0778679999988642026776665432338679998445687675310358999999999642013
Q gi|254780606|r  491 RYRKM----SH--LSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAG  564 (744)
Q Consensus       491 r~~~~----~~--~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~G  564 (744)
                      +..+.    ..  .....|+..    -.......+-......|||+=||||||...  .+. .    ++.+|-+ +=.-+
T Consensus       220 ~l~~~~~~~~~~p~~a~TiHRL----Lg~~p~~~~f~~~~~nPL~~DvlIVDEASM--VDl-~----Lm~~LL~-Alp~~  287 (607)
T PRK10875        220 QLPLTDEQKKRIPEDASTLHRL----LGAQPGSQRLRYHAGNPLHLDVLVVDEASM--IDL-P----MMSRLID-ALPDH  287 (607)
T ss_pred             HCCCCHHHHHCCCCCCEEHHHH----CCCCCCCCCCCCCCCCCCCCCEEEEECCHH--HHH-H----HHHHHHH-HCCCC
T ss_conf             3476656663376556658975----296789876565779999889899907336--659-9----9999998-28999


Q ss_pred             EEEEEE---ECCCCCC
Q ss_conf             589998---5165444
Q gi|254780606|r  565 IHLIMA---TQRPSVD  577 (744)
Q Consensus       565 ihlila---tQrp~~~  577 (744)
                      -+|||-   -|=||++
T Consensus       288 aRLILvGD~dQLpSVg  303 (607)
T PRK10875        288 ARVIFLGDRDQLASVE  303 (607)
T ss_pred             CEEEEECCHHHCCCCC
T ss_conf             8899965623247888


No 104
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.30  E-value=0.041  Score=33.48  Aligned_cols=165  Identities=20%  Similarity=0.325  Sum_probs=82.8

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC------------CCEECCCCCCCCEEEEE
Q ss_conf             732112011484699707875344799999999998568011079997234------------21000125775200004
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK------------MLELSVYDGIPHLLTPV  470 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k------------~~~~~~~~~~ph~~~~v  470 (744)
                      +.+-+++.+.--+-|-|-+|||||++|+. |.+|   ..|+.=+++ +|-+            +.-|-.|.-.||+-  |
T Consensus        17 ~~vsl~v~~Ge~~~iiGpSGsGKSTllr~-i~Gl---~~p~~G~I~-~~g~~v~~~~~~~r~ig~VfQ~~~Lfp~lt--V   89 (232)
T cd03300          17 DGVSLDIKEGEFFTLLGPSGCGKTTLLRL-IAGF---ETPTSGEIL-LDGKDITNLPPHKRPVNTVFQNYALFPHLT--V   89 (232)
T ss_pred             CCCEEEECCCCEEEEECCCCCHHHHHHHH-HHCC---CCCCCEEEE-ECCEECCCCCHHHCCEEEEECCCCCCCCCC--H
T ss_conf             76174887998999999999839999999-9779---999853999-999999999954577569914885477891--9


Q ss_pred             EECHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HH
Q ss_conf             4441787689999998667699-9999807786799---------99988642026776665432338679998445-68
Q gi|254780606|r  471 VTNPKKAVMALKWAVREMEERY-RKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MA  539 (744)
Q Consensus       471 ~~~~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a  539 (744)
                      ..|........++-..|.++|. +++...+..+...         -.+|++-.+.-         ..-|. +++.|| ++
T Consensus        90 ~~Nva~~l~~~~~~~~e~~~rv~e~l~~v~l~~~~~~~p~~LSGGqkQRVaiARAl---------~~~P~-llllDEP~s  159 (232)
T cd03300          90 FENIAFGLRLKKLPKAEIKERVAEALDLVQLEGYANRKPSQLSGGQQQRVAIARAL---------VNEPK-VLLLDEPLG  159 (232)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHH---------HCCCC-EEEECCCCC
T ss_conf             99987799876999999999999998758977876199666998999999999998---------65999-999808876


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             7675310358999999999642013589998516544441467885056305720
Q gi|254780606|r  540 DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       540 ~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
                      .|--....   .....|-+.-+..|+-+|+.|-.++ ++.      .+.-||++-
T Consensus       160 ~LD~~~~~---~i~~~l~~l~~~~~~T~i~VTHd~~-ea~------~ladri~vm  204 (232)
T cd03300         160 ALDLKLRK---DMQLELKRLQKELGITFVFVTHDQE-EAL------TMSDRIAVM  204 (232)
T ss_pred             CCCHHHHH---HHHHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEEE
T ss_conf             46999999---9999999999985999999999999-999------969999999


No 105
>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=96.29  E-value=0.07  Score=31.88  Aligned_cols=61  Identities=25%  Similarity=0.429  Sum_probs=33.5

Q ss_pred             EEEEHHHHHHHHHHCCH-------H-HHHHHHHHHHH-HHCCEEEEEEEECCCCCCCCHHHH-HHCCCCEEEE
Q ss_conf             99984456876753103-------5-89999999996-420135899985165444414678-8505630572
Q gi|254780606|r  531 IVIIVDEMADLMMVAGK-------E-IEGAIQRLAQM-ARAAGIHLIMATQRPSVDVITGTI-KANFPIRISF  593 (744)
Q Consensus       531 ivvviDE~a~l~~~~~~-------~-~e~~~~~la~~-~ra~GihlilatQrp~~~vi~~~i-k~n~~~ri~~  593 (744)
                      -|++|||+-.+......       . +...+..|-.. ...-+|.+|.+|.+|+  -|...+ |.-|..+|-|
T Consensus        59 ~Il~iDe~d~l~~~~~~~~~~~~~~~~~~ll~~ld~~~~~~~~v~~I~tTN~~~--~ld~al~r~Rfd~~i~~  129 (131)
T pfam00004        59 CVIFIDEIDALAGSRGSGGDSESRRVVNQLLTELDGFTSSLSKVIVIAATNRPD--KLDPALLRGRFDRIIEF  129 (131)
T ss_pred             CEEEECHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCHH--HCCHHHHCCCCEEEEEE
T ss_conf             189831167775167888887513268789999850224688769999759904--49977962833289980


No 106
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model.
Probab=96.29  E-value=0.03  Score=34.37  Aligned_cols=151  Identities=16%  Similarity=0.181  Sum_probs=74.8

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC-------CCCCC--EEEEEEECHHHHHH
Q ss_conf             0114846997078753447999999999985680110799972342100012-------57752--00004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY-------DGIPH--LLTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~-------~~~ph--~~~~v~~~~~~~~~  479 (744)
                      |.+.--.+|||.+|+|||.|..+|...++.+.   ....+++-.-|.+-...       .+++.  +..+-.++.+  ..
T Consensus       191 l~~g~LiIiaARPsmGKTafalnia~n~A~~~---g~~Vl~fSLEMs~eql~~R~la~~s~i~~~~i~~g~l~~~~--~~  265 (421)
T TIGR03600       191 LVKGDLIVIGARPSMGKTTLALNIAENVALRE---GKPVLFFSLEMSAEQLGERLLASKSGINTGNIRTGRFNDSD--FN  265 (421)
T ss_pred             CCCCCEEEEEEECCCCHHHHHHHHHHHHHHHC---CCEEEEEECCCCHHHHHHHHHHHHCCCCHHHHHCCCCCHHH--HH
T ss_conf             99886899985467874599999999999866---98389992579999999999998548977666528999899--99


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC-----HHHHHHHH
Q ss_conf             9999998667699999980778679999988642026776665432338679998445687675310-----35899999
Q gi|254780606|r  480 ALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG-----KEIEGAIQ  554 (744)
Q Consensus       480 ~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~-----~~~e~~~~  554 (744)
                      .+..++.+|...--.+.....-++.....+.+.......        .+  =+||||=+. ||....     .++...-.
T Consensus       266 ~~~~a~~~l~~~~l~i~d~~~~ti~~ir~~~r~~~~~~~--------~l--~livIDYLq-Li~~~~~~~r~~ei~~Isr  334 (421)
T TIGR03600       266 RLLNAVDRLSEKDLYIDDTGGLTVAQIRSIARRIKRKKG--------GL--DLIVVDYIQ-LMAPTRGRDRNEELGGISR  334 (421)
T ss_pred             HHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHCC--------CC--CEEEECHHH-HCCCCCCCCHHHHHHHHHH
T ss_conf             999999986168789966998876789999999998628--------98--699975786-5378888888999999999


Q ss_pred             HHHHHHHCCEEEEEEEECCCC
Q ss_conf             999964201358999851654
Q gi|254780606|r  555 RLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       555 ~la~~~ra~GihlilatQrp~  575 (744)
                      .|-.+|+.++|.+|+.+|==.
T Consensus       335 ~LK~lAkel~ipVi~lsQLnR  355 (421)
T TIGR03600       335 GLKALAKELDVPVVLLAQLNR  355 (421)
T ss_pred             HHHHHHHHHCCCEEEECCCCC
T ss_conf             999999997997899705786


No 107
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=96.29  E-value=0.0028  Score=41.49  Aligned_cols=86  Identities=28%  Similarity=0.341  Sum_probs=49.1

Q ss_pred             ECCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCE--EEEECCCCCHHHHHHHHHHHHHHHCCH
Q ss_conf             268888870765875128121146783689842057887321120114846--997078753447999999999985680
Q gi|254780606|r  365 ELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHI--LVAGTTGSGKSVAINTMIMSLLYRLRP  442 (744)
Q Consensus       365 ~~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~--lvaG~TgsGKS~~l~~~i~sl~~~~~p  442 (744)
                      .+|...-+.|.+|=+-.... .-.-.    -||.+-.-.-.+..+.+.||.  ||.|.||||||+.|.+++..|   +++
T Consensus       214 tlP~~~GEkvVlRil~~~~~-~l~l~----~Lg~~~~~~~~~~~~~~~p~GliLvTGPTGSGKTTTLY~~L~~l---n~~  285 (500)
T COG2804         214 TLPTFYGEKVVLRILDKDQV-ILDLE----KLGMSPFQLARLLRLLNRPQGLILVTGPTGSGKTTTLYAALSEL---NTP  285 (500)
T ss_pred             CCCCCCCCEEEEEEECCCCC-CCCHH----HHCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHH---CCC
T ss_conf             57887785789998333124-68887----83899889999999972897089996899998899999999986---278


Q ss_pred             HHEEEEEECCCCCEEC
Q ss_conf             1107999723421000
Q gi|254780606|r  443 DECRMIMVDPKMLELS  458 (744)
Q Consensus       443 ~~~~~~liD~k~~~~~  458 (744)
                      +..=+-+=||=...+.
T Consensus       286 ~~nI~TiEDPVE~~~~  301 (500)
T COG2804         286 ERNIITIEDPVEYQLP  301 (500)
T ss_pred             CCEEEEEECCEEEECC
T ss_conf             8508984078045159


No 108
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=96.28  E-value=0.048  Score=33.02  Aligned_cols=53  Identities=23%  Similarity=0.464  Sum_probs=32.3

Q ss_pred             CCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECCCCCEEC
Q ss_conf             87321120----1148469970787534479999999999856801107999--723421000
Q gi|254780606|r  402 GESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDPKMLELS  458 (744)
Q Consensus       402 g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~k~~~~~  458 (744)
                      +++++-|+    .+.-.+.|.|.||||||++++.+.    .-+.|++=++.+  +|-+.....
T Consensus       341 ~~~vl~~is~~i~~Ge~vaiVG~sGsGKSTl~~LL~----r~~~~~~G~I~idg~dI~~i~~~  399 (567)
T COG1132         341 KKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLL----RLYDPTSGEILIDGIDIRDISLD  399 (567)
T ss_pred             CCCCCCCCEEEECCCCEEEEECCCCCCHHHHHHHHH----HHCCCCCCEEEECCEEHHHCCHH
T ss_conf             876110522775489878885588885789999998----61588883698999977753856


No 109
>pfam05729 NACHT NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.
Probab=96.28  E-value=0.017  Score=36.05  Aligned_cols=34  Identities=18%  Similarity=0.416  Sum_probs=26.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             4699707875344799999999998568011079
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      .++|-|..|+|||++++-++..++....+...++
T Consensus         2 ~i~i~G~aG~GKTtll~kl~~~wa~g~~~~~~~~   35 (165)
T pfam05729         2 TVILQGEAGSGKTTLLQKLALLWAQGKLPQDFDF   35 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCE
T ss_conf             8999827989899999999999986984369728


No 110
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=96.27  E-value=0.031  Score=34.28  Aligned_cols=165  Identities=18%  Similarity=0.244  Sum_probs=73.8

Q ss_pred             HHCCC-EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE--CCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             11484-699707875344799999999998568011079997--234210001257752000044441787689999998
Q gi|254780606|r  410 ANMPH-ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV--DPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVR  486 (744)
Q Consensus       410 ~~~PH-~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li--D~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~  486 (744)
                      .++|| .|..|--|.||+.+-+.+...|+-...+......+.  |+..........--|.-.-.+.             +
T Consensus        42 gRl~HA~Lf~GP~GiGKaTlA~~~A~~Ll~~~~~~~~~~~~~~pd~~~~~~r~i~~g~hpdl~~i~-------------r  108 (352)
T PRK09112         42 GRLHHALLFEGPEGIGKATLAFHLANHILSHPDPNEAPETLADPDPASPLWRQIAQGAHPNLLHLT-------------R  108 (352)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEE-------------C
T ss_conf             996524653589980899999999999866998666865567888787789999748999956553-------------4


Q ss_pred             HHHHH-HHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEE
Q ss_conf             66769-99999807786799999886420267766654323386799984456876753103589999999996420135
Q gi|254780606|r  487 EMEER-YRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGI  565 (744)
Q Consensus       487 em~~r-~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gi  565 (744)
                      .++.+ .+.-...++..|......+...   ..        .=.|-|+||||.-+|...    ....+-++--.- ....
T Consensus       109 ~~d~k~~~~~~~I~vd~iR~l~~~~~~~---~~--------~~~~kv~Iid~ad~m~~~----aaNALLK~LEEP-p~~~  172 (352)
T PRK09112        109 PFDEKTGKFKTAITVDEIRRVTHFLSQT---SG--------DGNWRIVIIDPADDMNRN----AANAILKTLEEP-PARA  172 (352)
T ss_pred             CCCHHHHHHHCCCCHHHHHHHHHHHCCC---CC--------CCCEEEEEECCHHHHHHH----HHHHHHHHHHCC-CCCE
T ss_conf             3220214543357779999999984548---86--------688069998187874699----999999985348-9874


Q ss_pred             EEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCC
Q ss_conf             89998516544441467885056305720368111003267
Q gi|254780606|r  566 HLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILG  606 (744)
Q Consensus       566 hlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~  606 (744)
                      .+||.|..|. .+++ .|+.-. -++-|+--+..|=...|.
T Consensus       173 ~fiLit~~~~-~ll~-TI~SRC-q~~~f~pL~~~di~~~L~  210 (352)
T PRK09112        173 LFILISHSSG-RLLP-TIRSRC-QPISLKPLDDDELKKALS  210 (352)
T ss_pred             EEEEEECCHH-HCHH-HHHHHC-CCCCCCCCCHHHHHHHHH
T ss_conf             8998869977-7768-999743-321488939899999999


No 111
>KOG0060 consensus
Probab=96.25  E-value=0.056  Score=32.57  Aligned_cols=155  Identities=19%  Similarity=0.284  Sum_probs=80.4

Q ss_pred             CCCCEEECCHH----HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-CCCCEEC---CCCCCC----CEE
Q ss_conf             78873211201----14846997078753447999999999985680110799972-3421000---125775----200
Q gi|254780606|r  400 ISGESVIADLA----NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-PKMLELS---VYDGIP----HLL  467 (744)
Q Consensus       400 ~~g~~~~~dl~----~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-~k~~~~~---~~~~~p----h~~  467 (744)
                      -+|..++.||.    ..-|+||.|-+|.|||.+++. +.+ ||...-..+.....- +|++-|-   +|..+-    +++
T Consensus       445 t~g~~lie~Ls~~V~~g~~LLItG~sG~GKtSLlRv-lgg-LWp~~~G~l~k~~~~~~~~lfflPQrPYmt~GTLRdQvI  522 (659)
T KOG0060         445 TNGDLLIENLSLEVPSGQNLLITGPSGCGKTSLLRV-LGG-LWPSTGGKLTKPTDGGPKDLFFLPQRPYMTLGTLRDQVI  522 (659)
T ss_pred             CCCCEEEEEEEEEECCCCEEEEECCCCCCHHHHHHH-HHC-CCCCCCCEEEECCCCCCCCEEEECCCCCCCCCCHHHHEE
T ss_conf             998656321005705897599978998763689999-853-251678727605678877558836887766654455033


Q ss_pred             EEEE--------ECHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCHHHH----------HHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             0044--------441787689999998667699999980-77867999----------9988642026776665432338
Q gi|254780606|r  468 TPVV--------TNPKKAVMALKWAVREMEERYRKMSHL-SVRNIKSY----------NERISTMYGEKPQGCGDDMRPM  528 (744)
Q Consensus       468 ~~v~--------~~~~~~~~~l~~~~~em~~r~~~~~~~-~~~~i~~~----------n~~~~~~~~~~~~~~~~~~~~~  528 (744)
                      .|.-        -+.+...+.|.|+.  |.   .++.+. |...-..+          .+|.+-++....         -
T Consensus       523 YP~~~~~~~~~~~~d~~i~r~Le~v~--L~---hl~~r~ggld~~~~~dW~dvLS~GEqQRLa~ARLfy~---------k  588 (659)
T KOG0060         523 YPLKAEDMDSKSASDEDILRILENVQ--LG---HLLEREGGLDQQVDWDWMDVLSPGEQQRLAFARLFYH---------K  588 (659)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHH--HH---HHHHHHCCCCCHHHCCHHHHCCHHHHHHHHHHHHHHC---------C
T ss_conf             25753221013776789999999854--55---5899857888222205776369888889999999860---------8


Q ss_pred             CEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCC
Q ss_conf             6799984456876753103589999999996420135899985165444
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVD  577 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~  577 (744)
                      | -+.|.||.-   .....++|.   .+.++.|+.||-+|--.-|.+-.
T Consensus       589 P-k~AiLDE~T---SAv~~dvE~---~~Yr~~r~~giT~iSVgHRkSL~  630 (659)
T KOG0060         589 P-KFAILDECT---SAVTEDVEG---ALYRKCREMGITFISVGHRKSLW  630 (659)
T ss_pred             C-CEEEEECCH---HHCCHHHHH---HHHHHHHHCCCEEEEECCHHHHH
T ss_conf             8-368760302---223576799---99999998097699963578898


No 112
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=96.19  E-value=0.11  Score=30.56  Aligned_cols=247  Identities=23%  Similarity=0.301  Sum_probs=122.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCEE-EEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEEE
Q ss_conf             7889988999999874035513898676489258-999754888639999859999998714776327751898345442
Q gi|254780606|r  287 HEILEKNAGSLETILEEFGIKGEIINVNPGPVVT-LYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIE  365 (744)
Q Consensus       287 ~~~~~~~~~~l~~~l~~~~~~~~~~~~~~gp~~~-~~~~~~~~g~~~~~~~~~~~d~~~~~~~~~~~~~~~pg~~~~~~~  365 (744)
                      ...++.....|.+-++.+.-..-+++......=. ++=++-..|-+.  +.+....+-+.+-.++.||+.-.-..+|.--
T Consensus        32 ~~~l~~~~~~l~~e~~~l~~~p~~vg~~~~~~~~~~~iv~~~~g~~~--~v~~~~~~~~~~l~pg~~V~l~~~~~~i~~~  109 (390)
T PRK03992         32 NERLERELERLKSELEKLRTPPLIVATVLEVLDDGRVVVKSSTGPQF--VVTVSSFVDRDKLKPGARVALNQQTLAIVEV  109 (390)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCEEEEEECCCCEE--EEECCCCCCHHHCCCCCEEEECCCCCEEEEE
T ss_conf             99999999999999998548994899999983797499997899879--9965787688887999989985353030564


Q ss_pred             CCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCC---------CEEECCH---------H-HCC-CEEEEECCCCCH
Q ss_conf             6888887076587512812114678368984205788---------7321120---------1-148-469970787534
Q gi|254780606|r  366 LPNETRETVYLRQIIESRSFSHSKANLALCLGKTISG---------ESVIADL---------A-NMP-HILVAGTTGSGK  425 (744)
Q Consensus       366 ~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g---------~~~~~dl---------~-~~P-H~lvaG~TgsGK  425 (744)
                      +|...-..|+.-++.+...   ..+       .||.|         +.|.+-|         . +-| -+|..|-.|.||
T Consensus       110 l~~~~d~~v~~m~v~e~P~---v~~-------~dIGGl~~~k~el~E~velPl~~pe~f~~~Gi~pPkGvLLyGPPGtGK  179 (390)
T PRK03992        110 LPSEKDPRVRAMEVIESPD---VTY-------EDIGGLDEQIREVREAVELPLKNPELFEEVGIEPPKGVLLYGPPGTGK  179 (390)
T ss_pred             CCCCCCCCCCCCCCCCCCC---CCH-------HHHCCHHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCCCCCH
T ss_conf             6888786211042147999---984-------661498999999999999986598999976999997278689899978


Q ss_pred             HHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHH
Q ss_conf             4799999999998568011079997234210001257752000044441787689999998667699-999980778679
Q gi|254780606|r  426 SVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERY-RKMSHLSVRNIK  504 (744)
Q Consensus       426 S~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~  504 (744)
                      |.+-+++...+       .+.|+-++.  .+|         +...+              .|-++.. ++|..+      
T Consensus       180 TllAkAvA~e~-------~~~fi~v~~--s~l---------~sk~v--------------Gesek~vr~lF~~A------  221 (390)
T PRK03992        180 TLLAKAVAHET-------NATFIRVVG--SEL---------VQKFI--------------GEGARLVRELFELA------  221 (390)
T ss_pred             HHHHHHHHHHH-------CCCEEEEEH--HHH---------HHCCC--------------CHHHHHHHHHHHHH------
T ss_conf             99999999874-------888799667--997---------52454--------------17999999999999------


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHC-------CHHHHHHH-HHHHHH---HHCCEEEEEEEECC
Q ss_conf             99998864202677666543233867999844568767531-------03589999-999996---42013589998516
Q gi|254780606|r  505 SYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVA-------GKEIEGAI-QRLAQM---ARAAGIHLIMATQR  573 (744)
Q Consensus       505 ~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~-------~~~~e~~~-~~la~~---~ra~GihlilatQr  573 (744)
                          +-                .-| -||+|||+-.+...-       ..++...+ +-|.++   ...-+|.+|.||.|
T Consensus       222 ----r~----------------~aP-~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~emDG~~~~~~V~VIaATNr  280 (390)
T PRK03992        222 ----RE----------------KAP-SIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAEMDGFDPRGNVKIIAATNR  280 (390)
T ss_pred             ----HH----------------HCC-CEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCC
T ss_conf             ----97----------------099-089714325663356778886208899999999997448777788279960698


Q ss_pred             CCCCCCHHHHH--HCCCCEEEEECCCHHHCCHHCC
Q ss_conf             54444146788--5056305720368111003267
Q gi|254780606|r  574 PSVDVITGTIK--ANFPIRISFQVTSKIDSRTILG  606 (744)
Q Consensus       574 p~~~vi~~~ik--~n~~~ri~~~v~~~~dsr~il~  606 (744)
                      |+  .|..-+.  .-|..+|-|...+...-+.||.
T Consensus       281 pd--~LDpAllRpGRFDr~I~iplPd~~~R~~Ilk  313 (390)
T PRK03992        281 PD--ILDPALLRPGRFDRIIEVPLPDEEGRLEILK  313 (390)
T ss_pred             CH--HCCHHHHCCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             10--0597775477652388708949999999999


No 113
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=96.17  E-value=0.06  Score=32.37  Aligned_cols=165  Identities=14%  Similarity=0.266  Sum_probs=85.5

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC-----------CCEECCC
Q ss_conf             68984205788732112011484699707875344799999999998568011079997234-----------2100012
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK-----------MLELSVY  460 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k-----------~~~~~~~  460 (744)
                      |....|....=+-+-+++.+.--+-+-|-.|+|||++|+. |.+|.   .|+.=++++-+-.           +.-|-.|
T Consensus        12 lsk~yg~~~al~~vsl~i~~Ge~~~llGpSG~GKTTlLr~-iaGl~---~p~~G~I~~~g~~v~~~~~~~R~i~~VfQ~~   87 (351)
T PRK11432         12 ITKRFGKNTVIDNLDLTIKQGTMVTLLGPSGCGKTTVLRL-VAGLE---KPTSGQIFIDGEDVTKRSIQQRDICMVFQSY   87 (351)
T ss_pred             EEEEECCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCHHHCCEEEEECCC
T ss_conf             7999899489844574988998999999996499999999-97699---9883699999999999995458869994488


Q ss_pred             CCCCCEEEEEEECHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCE
Q ss_conf             57752000044441787689999998667699-9999807786799---------9998864202677666543233867
Q gi|254780606|r  461 DGIPHLLTPVVTNPKKAVMALKWAVREMEERY-RKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPY  530 (744)
Q Consensus       461 ~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~  530 (744)
                      .-.||+-  |..|........+.-..|..+|- +++...+..++.+         -.+|++-.+.         +-.-|.
T Consensus        88 aLfPh~t--V~eNi~~~l~~~~~~~~e~~~rv~e~l~~v~L~~~~~r~P~~LSGGq~QRValARA---------L~~~P~  156 (351)
T PRK11432         88 ALFPHMS--LGENVGYGLKMLGVPKEERKQRVKEALELVDLAGFEDRYVDQISGGQQQRVALARA---------LVLKPK  156 (351)
T ss_pred             CCCCCCC--HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHCCHHHHHHHHHHHH---------HHCCCC
T ss_conf             7676680--99999779987599999999999999976499661458955789989999999999---------844998


Q ss_pred             EEEEHHH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             9998445-68767531035899999999964201358999851654
Q gi|254780606|r  531 IVIIVDE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       531 ivvviDE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      + ++.|| |+.|-   .+--+.+...|-++-+..|+-.|+.|--..
T Consensus       157 v-lLlDEP~s~LD---~~lR~~~~~~l~~l~~~~~~T~i~VTHD~~  198 (351)
T PRK11432        157 V-LLFDEPLSNLD---ANLRRSMREKIRELQQQFNITSLYVTHDQS  198 (351)
T ss_pred             E-EEECCCCCCCC---HHHHHHHHHHHHHHHHHHCCEEEEECCCHH
T ss_conf             9-99868754369---999999999999999986999999999989


No 114
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=96.16  E-value=0.016  Score=36.24  Aligned_cols=160  Identities=20%  Similarity=0.332  Sum_probs=87.2

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-------CC----CCEECCCCCCCCEEEEEEEC
Q ss_conf             21120114846997078753447999999999985680110799972-------34----21000125775200004444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-------PK----MLELSVYDGIPHLLTPVVTN  473 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-------~k----~~~~~~~~~~ph~~~~v~~~  473 (744)
                      +-+++.+.-.+.+-|-+|+|||++|+ ||.+|.   .|+.=++++-|       |+    ..-|-.|.-.||+-  |.  
T Consensus        22 i~l~i~~Gef~vllGPSGcGKSTlLr-~IAGLe---~p~~G~I~i~g~~vt~l~P~~R~iamVFQ~yALyPhMt--V~--   93 (338)
T COG3839          22 VNLDIEDGEFVVLLGPSGCGKSTLLR-MIAGLE---EPTSGEILIDGRDVTDLPPEKRGIAMVFQNYALYPHMT--VY--   93 (338)
T ss_pred             CEEEECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCCCEEEECCEECCCCCHHHCCEEEEECCCCCCCCCC--HH--
T ss_conf             26897479799998999888899999-996887---78871599999999989955788899937830157876--99--


Q ss_pred             HHHHHHHHHHH---HHHHHHHHHHHHHCCCCCHHH------------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH
Q ss_conf             17876899999---986676999999807786799------------999886420267766654323386799984456
Q gi|254780606|r  474 PKKAVMALKWA---VREMEERYRKMSHLSVRNIKS------------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEM  538 (744)
Q Consensus       474 ~~~~~~~l~~~---~~em~~r~~~~~~~~~~~i~~------------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~  538 (744)
                       +..+--|++.   ..|.++|.+..++  .=+|..            ..+|++-.+.-.         .-|.++ ..||=
T Consensus        94 -~Niaf~Lk~~~~~k~ei~~rV~eva~--~L~l~~lL~r~P~~LSGGQrQRVAlaRAlV---------r~P~v~-L~DEP  160 (338)
T COG3839          94 -ENIAFGLKLRGVPKAEIDKRVKEVAK--LLGLEHLLNRKPLQLSGGQRQRVALARALV---------RKPKVF-LLDEP  160 (338)
T ss_pred             -HHHHHHHHHCCCCHHHHHHHHHHHHH--HCCCHHHHHCCCCCCCHHHHHHHHHHHHHH---------CCCCEE-EECCC
T ss_conf             -97341664479956888999999998--739866773590117725678999987775---------478878-84476


Q ss_pred             -HHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEEC
Q ss_conf             -876753103589999999996420135899985165444414678850563057203
Q gi|254780606|r  539 -ADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQV  595 (744)
Q Consensus       539 -a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v  595 (744)
                       .-|  ++ +--..+...|.++-+.+|+-.|..|.... +.+      .+.-||+.-.
T Consensus       161 lSnL--Da-klR~~mr~eik~l~~~l~~T~IYVTHDq~-EAm------tladri~Vm~  208 (338)
T COG3839         161 LSNL--DA-KLRVLMRSEIKKLHERLGTTTIYVTHDQV-EAM------TLADRIVVMN  208 (338)
T ss_pred             HHHH--HH-HHHHHHHHHHHHHHHHCCCCEEEECCCHH-HHH------HHCCEEEEEE
T ss_conf             4676--59-99999999999999860984899808999-998------4088799996


No 115
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=96.16  E-value=0.038  Score=33.69  Aligned_cols=52  Identities=19%  Similarity=0.263  Sum_probs=33.0

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             68984205788732112011484699707875344799999999998568011079
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      |....|+...=+-+-+++.+.-.+.|.|..|||||+++++ |.+|+   .|+.=++
T Consensus         7 lsk~yg~~~~L~dvs~~i~~Ge~~~liG~nGsGKSTll~~-i~Gl~---~~~~G~i   58 (240)
T PRK09493          7 VSKHFGPTQVLHNIDLNIDQGEVVVIIGPSGSGKSTLLRC-INKLE---EITSGDL   58 (240)
T ss_pred             EEEEECCEEEEECEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEE
T ss_conf             8999999988813078987998999999999809999999-96389---9999748


No 116
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family; InterPro: IPR004346   This family includes the Helicobacter pylori protein CagE (see examples), which together with other proteins from the cag pathogenicity island (PAI), encodes a type IV transporter secretion system. The precise role of CagE is not known, but studies in animal models have shown that it is essential for pathogenesis in Helicobacter pylori induced gastritis and peptic ulceration . Indeed, the expression of the cag PAI has been shown to be essential for stimulating human gastric epithelial cell apoptosis in vitro .    Similar type IV transport systems are also found in other bacteria. This family includes proteins from the trb and Vir conjugal transfer systems in Agrobacterium tumefaciens and homologues of VirB proteins from other species.; GO: 0005524 ATP binding.
Probab=96.16  E-value=0.01  Score=37.60  Aligned_cols=31  Identities=19%  Similarity=0.100  Sum_probs=16.1

Q ss_pred             CHHHHHHHHHHHCC-----C-EEEEEEECCCCCCHHH
Q ss_conf             03899999999749-----8-6232200000100789
Q gi|254780606|r  683 NLYAKAVDLVIDNQ-----R-CSTSFIQRRLQIGYNR  713 (744)
Q Consensus       683 ~~~~~~~~~~~~~~-----~-~s~s~~qr~~~~g~~r  713 (744)
                      ..+..|+..+.+..     . -+.|-+..-|..+|++
T Consensus       634 ~~~~~~i~~~~~~~~~~~~~~r~l~~l~~~l~~~~~~  670 (931)
T TIGR00929       634 NALSSAIDSLYEEDQKEHPAIRSLSDLLNFLPKDSIE  670 (931)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCC
T ss_conf             9999998888731441125522089999972577530


No 117
>TIGR01842 type_I_sec_PrtD type I secretion system ATPase; InterPro: IPR010128   Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0015031 protein transport, 0016021 integral to membrane.
Probab=96.15  E-value=0.0093  Score=37.91  Aligned_cols=150  Identities=24%  Similarity=0.320  Sum_probs=84.4

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCC----CCCC---EEE-EEE---------EC
Q ss_conf             148469970787534479999999999856801107999723421000125----7752---000-044---------44
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYD----GIPH---LLT-PVV---------TN  473 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~----~~ph---~~~-~v~---------~~  473 (744)
                      ..--+-|-|-.|||||.+.+.|+=.  +....-.|||-.-|.|..+.-.|-    -+|+   |+. -|.         -|
T Consensus       355 aGe~laIIGPSgSGKStLaR~~vG~--W~~~~G~VRLDGadl~qWD~e~lG~~iGYLPQdvELF~GTva~NIARF~en~d  432 (556)
T TIGR01842       355 AGEALAIIGPSGSGKSTLARILVGI--WPPASGSVRLDGADLKQWDRETLGKHIGYLPQDVELFSGTVAENIARFGENAD  432 (556)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHC--CCCCCCCEEEEHHHHHCCCHHHCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCC
T ss_conf             7745888747865258898788721--01356533640334402375365880154798505076767640244688788


Q ss_pred             HHHHHHHHHHH-HHHHHHH----HHHHHHCCCCCH-HHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCH
Q ss_conf             17876899999-9866769----999998077867-99999886420267766654323386799984456876753103
Q gi|254780606|r  474 PKKAVMALKWA-VREMEER----YRKMSHLSVRNI-KSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGK  547 (744)
Q Consensus       474 ~~~~~~~l~~~-~~em~~r----~~~~~~~~~~~i-~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~  547 (744)
                      +++..++-+-+ |.||=-|    |+--=-.+-.++ .+=.+|+.-.+.-+         ..|.| ||.||=+-=.   ..
T Consensus       433 ~~~iieAAklAGvHElIl~lP~GYDT~iG~~G~~LSGGQRQRIaLARAly---------G~P~l-vvLDEPNsNL---D~  499 (556)
T TIGR01842       433 PEKIIEAAKLAGVHELILRLPDGYDTDIGEGGATLSGGQRQRIALARALY---------GDPKL-VVLDEPNSNL---DE  499 (556)
T ss_pred             HHHHHHHHHHHCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH---------CCCEE-EEECCCCCCC---CH
T ss_conf             78999999760303575169688544313777778614689999999871---------79837-8732889876---61


Q ss_pred             HHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             5899999999964201358999851654
Q gi|254780606|r  548 EIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       548 ~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      +-|-++.+=-...++.|+=.|+.|+||+
T Consensus       500 ~GE~AL~~Ai~~lK~rg~tvv~itHRp~  527 (556)
T TIGR01842       500 EGEQALANAIKALKARGITVVVITHRPS  527 (556)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEECHHH
T ss_conf             7899999999999867972899841068


No 118
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=96.13  E-value=0.013  Score=37.01  Aligned_cols=162  Identities=17%  Similarity=0.296  Sum_probs=81.4

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHH--HEEEEEECCC-----------CCEECCCCCCCCEEEEEEE
Q ss_conf             11201148469970787534479999999999856801--1079997234-----------2100012577520000444
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPD--ECRMIMVDPK-----------MLELSVYDGIPHLLTPVVT  472 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~--~~~~~liD~k-----------~~~~~~~~~~ph~~~~v~~  472 (744)
                      -+++.+.-.+-+-|-+|+|||++|+. |.+|+   .|+  .-++++-+-.           +.-|-.|.-.||+-  |..
T Consensus        25 sl~i~~GE~~~llGpSG~GKTTlLr~-iaGL~---~p~~~~G~I~~~g~~v~~~~~~~R~ig~VFQ~~aLfPhlt--V~e   98 (362)
T TIGR03258        25 SLEIEAGELLALIGKSGCGKTTLLRA-IAGFV---KAAGLTGRIAIADRDLTHAPPHKRGLALLFQNYALFPHLK--VED   98 (362)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCC--HHH
T ss_conf             71999998999999997459999999-97776---7778817999999999989988899489717985368980--999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHH
Q ss_conf             417876899999986676999-999807786799---------99988642026776665432338679998445-6876
Q gi|254780606|r  473 NPKKAVMALKWAVREMEERYR-KMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADL  541 (744)
Q Consensus       473 ~~~~~~~~l~~~~~em~~r~~-~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l  541 (744)
                      |........++-..|+.+|.. ++...+..+...         -.+|++-.+.         +-.-|.|+ +.|| |+.|
T Consensus        99 Nia~~L~~~~~~~~e~~~rv~e~l~~vgL~~~~~r~P~~LSGGq~QRVAlARA---------L~~~P~il-LlDEP~saL  168 (362)
T TIGR03258        99 NVAFGLRAQKMPKADIAERVADALKLVGLGDAAAHLPAQLSGGMQQRIAIARA---------IAIEPDVL-LLDEPLSAL  168 (362)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCCEE-EECCCCCCC
T ss_conf             99899986599999999999999877899678626966789989999999999---------75599989-981887655


Q ss_pred             HHHCCHHHHHHHHHHHHHHHCC-EEEEEEEECCCCCCCCHHHHHHCCCCEEEE
Q ss_conf             7531035899999999964201-358999851654444146788505630572
Q gi|254780606|r  542 MMVAGKEIEGAIQRLAQMARAA-GIHLIMATQRPSVDVITGTIKANFPIRISF  593 (744)
Q Consensus       542 ~~~~~~~~e~~~~~la~~~ra~-GihlilatQrp~~~vi~~~ik~n~~~ri~~  593 (744)
                      -.....+   +...|.++-+.+ ||-.|+.|-... +.+      .+.-||++
T Consensus       169 D~~~r~~---l~~~l~~l~~~l~~~T~i~VTHD~~-EA~------~laDrI~V  211 (362)
T TIGR03258       169 DANIRAN---MREEIAALHEELPELTILCVTHDQD-DAL------TLADKAGI  211 (362)
T ss_pred             CHHHHHH---HHHHHHHHHHHCCCCEEEEECCCHH-HHH------HHCCEEEE
T ss_conf             9999999---9999999999767988999899989-999------85899999


No 119
>TIGR02673 FtsE cell division ATP-binding protein FtsE; InterPro: IPR005286   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division.
Probab=96.13  E-value=0.037  Score=33.77  Aligned_cols=164  Identities=16%  Similarity=0.202  Sum_probs=94.1

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC--------------CCEECCCCCCCCEEEEE
Q ss_conf             2112011484699707875344799999999998568011079997234--------------21000125775200004
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK--------------MLELSVYDGIPHLLTPV  470 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k--------------~~~~~~~~~~ph~~~~v  470 (744)
                      |-+.+.|.=-+-+-|..|+|||.+|+ ||+..+ .-+--++++.--|..              |+-|-+|.-++|. + |
T Consensus        21 v~l~i~kG~F~FLtG~SGAGKttLLK-Ll~~~~-~P~~G~v~~~G~~~~~l~~~~~P~LRR~iGvvFQDf~LL~~r-T-v   96 (215)
T TIGR02673        21 VSLHIRKGEFLFLTGPSGAGKTTLLK-LLYGAL-TPSRGQVRVAGEDVSRLRGRQLPLLRRRIGVVFQDFRLLPDR-T-V   96 (215)
T ss_pred             CCEEECCCCEEEEECCCCCCHHHHHH-HHHHHC-CCCCCEEEECCEECCCCCCCCCHHHHCCCCEEEECCCCCCCC-C-H
T ss_conf             64475277407887277861789999-998526-987580888874046677564312213154378422110116-6-1


Q ss_pred             EECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHHHH---------HHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH
Q ss_conf             444178768999999866769-9999980778679999---------988642026776665432338679998445687
Q gi|254780606|r  471 VTNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKSYN---------ERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD  540 (744)
Q Consensus       471 ~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~~n---------~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~  540 (744)
                      +.|.--+..+..|...+..+| ++.+...|-.+=..-.         +|++-+++--.         -|-|+ +.||=- 
T Consensus        97 ~eNVAl~L~V~G~~~~~I~~rV~~~L~~vGL~~K~~~~P~~LSGGEQQRvaIARAiv~---------~P~lL-LADEPT-  165 (215)
T TIGR02673        97 YENVALPLEVRGKKKREIQRRVEAALRLVGLEHKADAFPEQLSGGEQQRVAIARAIVN---------SPELL-LADEPT-  165 (215)
T ss_pred             HHHCCHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHCCCCCCCCCHHHHHHHHHHHHC---------CCCEE-EEECCC-
T ss_conf             3411210111388803367899999985286325425721004725788888765304---------89679-877889-


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCC-CCEEE
Q ss_conf             67531035899999999964201358999851654444146788505-63057
Q gi|254780606|r  541 LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANF-PIRIS  592 (744)
Q Consensus       541 l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~-~~ri~  592 (744)
                        -...+..-.-|.+|-+.--..|.=+|+||--.+       +-.|. ..|++
T Consensus       166 --GNLD~~~~~~iL~ll~~~n~~GtTV~vATHD~~-------L~~~~P~~R~~  209 (215)
T TIGR02673       166 --GNLDPALSERILDLLKELNKRGTTVIVATHDLE-------LVERVPAHRVL  209 (215)
T ss_pred             --CCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHH-------HHHCCCCCCEE
T ss_conf             --996876789999999998418987999807879-------98437899778


No 120
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]
Probab=96.12  E-value=0.0098  Score=37.76  Aligned_cols=176  Identities=18%  Similarity=0.257  Sum_probs=85.5

Q ss_pred             CCEEECCHHH--CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCC-----------CCCEEE
Q ss_conf             8732112011--484699707875344799999999998568011079997234210001257-----------752000
Q gi|254780606|r  402 GESVIADLAN--MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDG-----------IPHLLT  468 (744)
Q Consensus       402 g~~~~~dl~~--~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~-----------~ph~~~  468 (744)
                      -.|+.+||+-  .--+-|.|..|||||++|| +|.+..   .|..=.+++-+--......|+.           ..||- 
T Consensus        13 ~~~~~fdl~v~~ge~vAi~GpSGaGKSTLLn-LIAGF~---~P~~G~i~i~g~d~t~~~P~~RPVSmlFQEnNLFaHLt-   87 (231)
T COG3840          13 HLPMRFDLTVPAGEIVAILGPSGAGKSTLLN-LIAGFE---TPASGEILINGVDHTASPPAERPVSMLFQENNLFAHLT-   87 (231)
T ss_pred             CCEEEEEEEECCCCEEEEECCCCCCHHHHHH-HHHHCC---CCCCCEEEECCEECCCCCCCCCCHHHHHHCCCCCHHHH-
T ss_conf             5007888760678579997788865788999-987424---77874589857214768954487311110056421102-


Q ss_pred             EEEECHHHHH-HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCC----CCCCCCCEEEEEHHH-HHHHH
Q ss_conf             0444417876-89999998667699999980778679999988642026776665----432338679998445-68767
Q gi|254780606|r  469 PVVTNPKKAV-MALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCG----DDMRPMPYIVIIVDE-MADLM  542 (744)
Q Consensus       469 ~v~~~~~~~~-~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~----~~~~~~p~ivvviDE-~a~l~  542 (744)
                       |.+|..-.. -.|+.-..+-++.....+..   .|.+|-+|....-+...+...    .-.+.-|  |...|| |+.| 
T Consensus        88 -V~qNigLGl~P~LkL~a~~r~~v~~aa~~v---Gl~~~~~RLP~~LSGGqRQRvALARclvR~~P--ilLLDEPFsAL-  160 (231)
T COG3840          88 -VAQNIGLGLSPGLKLNAEQREKVEAAAAQV---GLAGFLKRLPGELSGGQRQRVALARCLVREQP--ILLLDEPFSAL-  160 (231)
T ss_pred             -HHHHHCCCCCCCCCCCHHHHHHHHHHHHHH---CHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCC--EEEECCCHHHC-
T ss_conf             -655324567866524888999999999985---75557540962247407789999998802687--57754811331-


Q ss_pred             HHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCH
Q ss_conf             53103589999999996420135899985165444414678850563057203681
Q gi|254780606|r  543 MVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSK  598 (744)
Q Consensus       543 ~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~  598 (744)
                        .+.--.+++.-+.+..+--|.-|++-|-.|+ |..      .+..|+.|-..-+
T Consensus       161 --dP~LR~eMl~Lv~~l~~E~~~TllmVTH~~~-Da~------~ia~~~~~l~~Gr  207 (231)
T COG3840         161 --DPALRAEMLALVSQLCDERKMTLLMVTHHPE-DAA------RIADRVVFLDNGR  207 (231)
T ss_pred             --CHHHHHHHHHHHHHHHHHHCCEEEEEECCHH-HHH------HHHHCEEEEECCE
T ss_conf             --9788999999999998842877999957888-999------7652069985777


No 121
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=96.10  E-value=0.084  Score=31.35  Aligned_cols=39  Identities=18%  Similarity=0.242  Sum_probs=27.9

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             1484699707875344799999999998568011079997234
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      ..==.+|+|-.|+|||.+...+..+.+.+    .-+.+.||..
T Consensus        22 ~G~itei~G~pG~GKTtl~lq~a~~~~~~----g~~vlYidtE   60 (224)
T PRK09361         22 RGTITQIYGPPGSGKTNICIQLAVEAARQ----GKKVIYIDTE   60 (224)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHC----CCCEEEECCC
T ss_conf             88799998999985999999999999974----9909996787


No 122
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=96.08  E-value=0.046  Score=33.17  Aligned_cols=154  Identities=18%  Similarity=0.339  Sum_probs=69.8

Q ss_pred             CCCEEE----CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC-EEC---------CCCCCCCE
Q ss_conf             887321----1201148469970787534479999999999856801107999723421-000---------12577520
Q gi|254780606|r  401 SGESVI----ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML-ELS---------VYDGIPHL  466 (744)
Q Consensus       401 ~g~~~~----~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~-~~~---------~~~~~ph~  466 (744)
                      +++.++    +++.+.-.+.|.|.+|||||++++. |++|+   .|+.=++ ++|-+.+ .+.         .....|.+
T Consensus        18 ~~~~iL~~is~~i~~Ge~~~i~G~sGsGKSTLlk~-i~gl~---~p~~G~I-~~~g~~i~~~~~~~~r~~i~~v~Q~~~l   92 (225)
T PRK10247         18 GDTKILNNINFSLRAGEFKLITGPSGCGKSTLLKI-VASLI---SPTSGTL-LFEGEDISTLKPEIYRQQVSYCAQTPTL   92 (225)
T ss_pred             CCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEE-EECCEECCCCCHHHHHHHCCEEECCCCC
T ss_conf             99899945179985996999999999999999999-96466---8887659-9999997749999998527457045543


Q ss_pred             EEEEEECHHHHHHHHHHHHH----HHHHHHHHHHHCCCC---------CHH-HHHHHHHHHHCCCCCCCCCCCCCCCEEE
Q ss_conf             00044441787689999998----667699999980778---------679-9999886420267766654323386799
Q gi|254780606|r  467 LTPVVTNPKKAVMALKWAVR----EMEERYRKMSHLSVR---------NIK-SYNERISTMYGEKPQGCGDDMRPMPYIV  532 (744)
Q Consensus       467 ~~~v~~~~~~~~~~l~~~~~----em~~r~~~~~~~~~~---------~i~-~~n~~~~~~~~~~~~~~~~~~~~~p~iv  532 (744)
                      +...+   .+.. .+.|...    +..+..+.+...+..         ++. +-.+|+.-.+.-.         .-|. +
T Consensus        93 ~~~tv---~eni-~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~~LSGGqkQRv~iARaL~---------~~p~-i  158 (225)
T PRK10247         93 FGDTV---YDNL-IFPWQIRNQQPDPAIFLDDLERFALPDTILTKNIAELSGGEKQRISLIRNLQ---------FMPK-V  158 (225)
T ss_pred             CHHHH---HHHH-HHHHHHCCCCHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHHHHHHHHHHHH---------CCCC-E
T ss_conf             41539---9999-8578766766789999999987599566761881118999999999999986---------0999-9


Q ss_pred             EEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             9844568767531035899999999964201358999851654
Q gi|254780606|r  533 IIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       533 vviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ++.||-.--+..  ...+..+.-|-+..+..|+-+|+.|.+.+
T Consensus       159 LllDEPts~LD~--~~~~~i~~~i~~l~~~~~~tvi~vtHd~~  199 (225)
T PRK10247        159 LLLDEITSALDE--SNKHNVNEIIHRYVREQNIAVLWVTHDKD  199 (225)
T ss_pred             EEEECCCCCCCH--HHHHHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             999597666899--99999999999999838989999903999


No 123
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.07  E-value=0.058  Score=32.45  Aligned_cols=190  Identities=15%  Similarity=0.229  Sum_probs=87.6

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC--------CCCCCC--CEEEE-EEE
Q ss_conf             3211201148469970787534479999999999856801107999723421000--------125775--20000-444
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS--------VYDGIP--HLLTP-VVT  472 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~--------~~~~~p--h~~~~-v~~  472 (744)
                      -+-+++.+.-++.|-|..|||||++++. |.+|+. -.-.++.+.-.|.+.....        .|++ |  +++.. |..
T Consensus        28 ~isl~i~~Ge~vaivG~nGsGKSTLlk~-l~Gll~-p~~G~I~v~G~~i~~~~~~~~~~~ig~VfQ~-Pd~q~~~~tV~e  104 (273)
T PRK13632         28 NVSFTINEGEYVAILGHNGSGKSTISKI-LTGLLK-PQSGEIKIFGITISKENLKYLRKKIGIIFQN-PDNQFIGITVED  104 (273)
T ss_pred             EEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCCC-CCCCEEEECCEECCCCCHHHHHHHEEEEEEC-CCHHCCCCCHHH
T ss_conf             4288984998999999999869999999-973877-8887599999999968989987435699877-102027751788


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHH
Q ss_conf             4178768999999866769999-998077867999---------998864202677666543233867999844568767
Q gi|254780606|r  473 NPKKAVMALKWAVREMEERYRK-MSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLM  542 (744)
Q Consensus       473 ~~~~~~~~l~~~~~em~~r~~~-~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~  542 (744)
                      +..........-.+++.+|... +...|..++.+.         .+|++-...         +..-|.| ++.||=-.-+
T Consensus       105 ~iafgl~~~~~~~~~~~~~v~~~l~~~gl~~~~~~~p~~LSGGqkQRvaiA~a---------La~~P~i-liLDEPTs~L  174 (273)
T PRK13632        105 DIAFGLENKKIPPKKMKDIIDDLAKKVGMEDYLKKEPQNLSGGQKQRVAIASV---------LALNPEI-IIFDESTSML  174 (273)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCHHCCHHHHHHHHHHHH---------HHCCCCE-EEEECCCCCC
T ss_conf             88867866799999999999999998698887747820099999999999999---------9719999-9980775569


Q ss_pred             H-HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEE
Q ss_conf             5-310358999999999642013589998516544441467885056305720368111003267631688568984686
Q gi|254780606|r  543 M-VAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLY  621 (744)
Q Consensus       543 ~-~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~  621 (744)
                      . ....++...   |-++-+..|+-+|+.|.+.+  .    +. + --||.+--    +-+ |+..+-.+.|+.+-+.|.
T Consensus       175 D~~~~~~l~~~---l~~l~~~~g~TvI~iTHd~~--~----~~-~-aDrv~vm~----~G~-iv~~G~p~el~~~~e~l~  238 (273)
T PRK13632        175 DPKGKREIKKI---MVDLRKDRKKTLISITHDMD--E----AI-L-ADKVIVFS----NGK-LIAQGKPKEILNDKEILE  238 (273)
T ss_pred             CHHHHHHHHHH---HHHHHHHCCCEEEEEEECHH--H----HH-C-CCEEEEEE----CCE-EEEECCHHHHHCCHHHHH
T ss_conf             98999999999---99999846989999942888--9----97-1-99999998----999-999769999877999999


Q ss_pred             E
Q ss_conf             4
Q gi|254780606|r  622 M  622 (744)
Q Consensus       622 ~  622 (744)
                      .
T Consensus       239 ~  239 (273)
T PRK13632        239 K  239 (273)
T ss_pred             H
T ss_conf             7


No 124
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=96.07  E-value=0.063  Score=32.23  Aligned_cols=162  Identities=20%  Similarity=0.317  Sum_probs=78.8

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC------------CEECCCCCCCCEEEEEEE
Q ss_conf             21120114846997078753447999999999985680110799972342------------100012577520000444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM------------LELSVYDGIPHLLTPVVT  472 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~------------~~~~~~~~~ph~~~~v~~  472 (744)
                      +-+++.+.-.+-+-|-.|+|||++|+. |.+|.   .|+.=++++ |-+.            .-|-.|.-.||+-  |..
T Consensus        36 vsl~I~~GE~~~llGpSGsGKSTLlr~-iaGl~---~p~sG~I~~-~G~~v~~~~~~~R~ig~VfQ~~aLfp~lT--V~e  108 (378)
T PRK09452         36 LDLTINNGEFLTLLGPSGCGKTTVLRL-IAGFE---TPDSGRIML-DGQDITHVPAENRYVNTVFQSYALFPHMT--VFE  108 (378)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEE-CCEECCCCCHHHCCEEEEECCCCCCCCCC--HHH
T ss_conf             277999998999998999769999999-97699---998469999-99998989978988589922764378986--999


Q ss_pred             CHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHH---------HHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH-HHH
Q ss_conf             4178768999999866769-9999980778679---------9999886420267766654323386799984456-876
Q gi|254780606|r  473 NPKKAVMALKWAVREMEER-YRKMSHLSVRNIK---------SYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEM-ADL  541 (744)
Q Consensus       473 ~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~---------~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~-a~l  541 (744)
                      +..........-..|+.+| .+++...+..++.         +-.+|+.-.+.-         -.-|. |++.||= +.|
T Consensus       109 Nv~~~l~~~~~~~~e~~~rv~e~L~~v~L~~~~~r~p~~LSGGqqQRVaiARAL---------~~~P~-vLLLDEPts~L  178 (378)
T PRK09452        109 NVAFGLRMQKTPAAEITPRVMEALRMVQLEEFAQRKPHQLSGGQQQRVAIARAV---------VNKPK-VLLLDESLSAL  178 (378)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHH---------CCCCC-EEEECCCCCCC
T ss_conf             999899765998799999999998750734354368354998899999999986---------23998-99957864447


Q ss_pred             HHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEE
Q ss_conf             7531035899999999964201358999851654444146788505630572
Q gi|254780606|r  542 MMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISF  593 (744)
Q Consensus       542 ~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~  593 (744)
                         ..+.-+.....|.++-|..||-.|+.|-..+ .++      .+.-||+.
T Consensus       179 ---D~~~r~~~~~~l~~l~~~~g~T~i~VTHD~~-eA~------~laDrI~V  220 (378)
T PRK09452        179 ---DYKLRKQMQNELKALQRKLGITFVFVTHDQE-EAL------TMSDRIVV  220 (378)
T ss_pred             ---CHHHHHHHHHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEE
T ss_conf             ---9999999999999999984998999988999-999------86998999


No 125
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=96.06  E-value=0.13  Score=30.16  Aligned_cols=40  Identities=18%  Similarity=0.179  Sum_probs=26.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCC--HHHEEEEEECCC
Q ss_conf             4699707875344799999999998568--011079997234
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLR--PDECRMIMVDPK  453 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~--p~~~~~~liD~k  453 (744)
                      =..|+|..|+|||.+-..++.+......  ..+-+.+.||-.
T Consensus        21 ItEi~G~~gsGKT~l~lqla~~~q~~~~~~~~~g~vvyIDtE   62 (226)
T cd01393          21 ITEIFGEFGSGKTQLCLQLAVEAQLPGELGGLEGKVVYIDTE   62 (226)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECC
T ss_conf             999999999989999999999985422116999619999557


No 126
>PRK08840 replicative DNA helicase; Provisional
Probab=96.06  E-value=0.039  Score=33.61  Aligned_cols=147  Identities=16%  Similarity=0.170  Sum_probs=71.7

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC-------CCCCC--CEEEEEEECHHH--H
Q ss_conf             011484699707875344799999999998568011079997234210001-------25775--200004444178--7
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV-------YDGIP--HLLTPVVTNPKK--A  477 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~-------~~~~p--h~~~~v~~~~~~--~  477 (744)
                      |...--++|||.+|+|||.|...|+...+.+..   ...+++-.-|..-..       -.+++  ++...-+++.++  .
T Consensus       214 l~~G~LiviaaRPsmGKTalalnia~n~a~~~~---~~v~~fSlEMs~~ql~~Rlls~~s~i~~~~ir~g~l~~~e~~~i  290 (464)
T PRK08840        214 LQGSDLIIVAARPSMGKTTFAMNLCENAAMDQD---KPVLIFSLEMPAEQLMMRMLASLSRVDQTKIRTGQLDDEDWARI  290 (464)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCC---CCEEEECCCCCHHHHHHHHHHHHCCCCCCHHHCCCCCHHHHHHH
T ss_conf             875767999837987368999999999999659---96799767799899999999985389820111488899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHH
Q ss_conf             689999998667699999980778679999988642026776665432338679998445687675310------35899
Q gi|254780606|r  478 VMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEG  551 (744)
Q Consensus       478 ~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~  551 (744)
                      ..++.++   |+..--.+.....-++.....+.+......        ..+  =+||||=+. ||...+      .++..
T Consensus       291 ~~a~~~~---~~~~~l~idd~~~~t~~~i~a~~r~~~~~~--------~~l--~lvvIDYLq-L~~~~~~~~~r~~~i~~  356 (464)
T PRK08840        291 SSTMGIL---MEKKNMYIDDSSGLTPTEVRSRARRVAREH--------GGL--SMIMVDYLQ-LMRVPALQDNRTLEIAE  356 (464)
T ss_pred             HHHHHHH---HHCCCEEEECCCCCCHHHHHHHHHHHHHHC--------CCC--CEEEEEHHH-HCCCCCCCCHHHHHHHH
T ss_conf             9999999---847995885699875799999999999864--------898--789961886-60678864036789999


Q ss_pred             HHHHHHHHHHCCEEEEEEEEC
Q ss_conf             999999964201358999851
Q gi|254780606|r  552 AIQRLAQMARAAGIHLIMATQ  572 (744)
Q Consensus       552 ~~~~la~~~ra~GihlilatQ  572 (744)
                      .-..|-++|+.++|.+|+.+|
T Consensus       357 isr~lK~lAkel~vpVv~lsQ  377 (464)
T PRK08840        357 ISRSLKALAKELNVPVVALSQ  377 (464)
T ss_pred             HHHHHHHHHHHHCCCEEEECC
T ss_conf             999999999996998999631


No 127
>PRK13767 ATP-dependent helicase; Provisional
Probab=96.05  E-value=0.048  Score=32.99  Aligned_cols=12  Identities=25%  Similarity=0.454  Sum_probs=4.8

Q ss_pred             CEEEEEEECCCC
Q ss_conf             862322000001
Q gi|254780606|r  697 RCSTSFIQRRLQ  708 (744)
Q Consensus       697 ~~s~s~~qr~~~  708 (744)
                      -..+.+++||||
T Consensus       739 L~~S~l~krrFR  750 (878)
T PRK13767        739 LDRTELLKRRFR  750 (878)
T ss_pred             HCCCHHHHHHHH
T ss_conf             745899999999


No 128
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.05  E-value=0.091  Score=31.11  Aligned_cols=47  Identities=19%  Similarity=0.353  Sum_probs=31.6

Q ss_pred             ECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             057887321120----114846997078753447999999999985680110799
Q gi|254780606|r  398 KTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       398 ~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      +..++++++-|+    .+.-.+.|.|..|||||++|+. |++++   .|+.=++.
T Consensus         9 ~~~g~~~vl~~vs~~i~~Ge~~~l~G~NGaGKSTLl~~-l~Gl~---~p~~G~i~   59 (204)
T PRK13538          9 CERDERILFEGLSFTLNAGELVQIEGPNGAGKTSLLRI-LAGLA---RPDAGEVL   59 (204)
T ss_pred             EEECCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEE
T ss_conf             99899999805177987998999999999859999999-97688---88873799


No 129
>pfam07693 KAP_NTPase KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.
Probab=96.04  E-value=0.043  Score=33.35  Aligned_cols=88  Identities=17%  Similarity=0.230  Sum_probs=54.7

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCC
Q ss_conf             79998445687675310358999999999642013589998516544441467885056305720368111003267631
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHG  609 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~g  609 (744)
                      .|||+||++--+   .+.++-..+..|--.+.--+++.|||..+   ++|...|+.++..-               +..|
T Consensus       161 ~iVviIDDLDRc---~p~~~v~~Le~Ik~~~d~~n~vfVLa~D~---~~v~~al~~~~~~~---------------~~~~  219 (301)
T pfam07693       161 RIVVIIDDLDRC---EPEEAVELLEAVRLLFDFPNVVFILAYDE---EIIKKAIEHNYGGG---------------EIDG  219 (301)
T ss_pred             CEEEEECCCCCC---CHHHHHHHHHHHHHHHCCCCEEEEEECCH---HHHHHHHHHHCCCC---------------CCCH
T ss_conf             789997365548---87899999999999726798189997589---99999999873878---------------7418


Q ss_pred             HHHHCCCCCEEEECCCCCEEEEEECCCCHHHHHHHHHHH
Q ss_conf             688568984686468984389993438988999999999
Q gi|254780606|r  610 AEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHL  648 (744)
Q Consensus       610 ae~l~g~gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~  648 (744)
                      -++|---    +      -+++.=|-.+..+++....-.
T Consensus       220 ~~YLeKi----I------q~p~~lP~~~~~~~~~~l~~~  248 (301)
T pfam07693       220 QDYLEKI----I------QLPFKLPPLGLRELRRFLMTL  248 (301)
T ss_pred             HHHHHHH----E------ECEEECCCCCHHHHHHHHHHH
T ss_conf             9999854----1------024767998789999999999


No 130
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.04  E-value=0.0049  Score=39.80  Aligned_cols=163  Identities=18%  Similarity=0.357  Sum_probs=82.5

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC--------------CEECCCCCCCCEEEE
Q ss_conf             321120114846997078753447999999999985680110799972342--------------100012577520000
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM--------------LELSVYDGIPHLLTP  469 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~--------------~~~~~~~~~ph~~~~  469 (744)
                      -+-+++.+.--+-|-|-.|||||++|+ +|.+|+   .|+.=+++ +|-+.              .-|-.|.-.||+-  
T Consensus        19 ~vsl~i~~Ge~~~ilGpSG~GKSTllr-~i~gl~---~p~~G~I~-i~g~~i~~~~~~~lrr~ig~vfQ~~~Lfp~lt--   91 (242)
T cd03295          19 NLNLEIAKGEFLVLIGPSGSGKTTTMK-MINRLI---EPTSGEIF-IDGEDIREQDPVELRRKIGYVIQQIGLFPHMT--   91 (242)
T ss_pred             EEEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCEEEE-ECCEECCCCCHHHHHCCCEEEECCCCCCCCCC--
T ss_conf             027688699899999999956999999-997599---99815999-99999999997897388679917997588882--


Q ss_pred             EEECHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCHHHHH------------HHHHHHHCCCCCCCCCCCCCCCEEEEEHH
Q ss_conf             444417876899999986676999-99980778679999------------98864202677666543233867999844
Q gi|254780606|r  470 VVTNPKKAVMALKWAVREMEERYR-KMSHLSVRNIKSYN------------ERISTMYGEKPQGCGDDMRPMPYIVIIVD  536 (744)
Q Consensus       470 v~~~~~~~~~~l~~~~~em~~r~~-~~~~~~~~~i~~~n------------~~~~~~~~~~~~~~~~~~~~~p~ivvviD  536 (744)
                      |..+.........|-..+.++|.. ++...+.. ...|-            +|++-.+.-         ..-|.|+ +.|
T Consensus        92 V~eNi~~~~~~~~~~~~~~~~rv~ell~~v~L~-~~~~~~~~p~~LSGGqkQRvaiARAl---------~~~P~il-LlD  160 (242)
T cd03295          92 VEENIALVPKLLKWPKEKIRERADELLALVGLD-PAEFADRYPHELSGGQQQRVGVARAL---------AADPPLL-LMD  160 (242)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCC-CHHHCCCCHHHCCHHHHHHHHHHHHH---------HCCCCEE-EEC
T ss_conf             999999999975999999999999999874999-30110079566899999999999999---------6299999-981


Q ss_pred             H-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             5-687675310358999999999642013589998516544441467885056305720
Q gi|254780606|r  537 E-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       537 E-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
                      | ++.|-.....++   ...|.++-+..|+-+|+.|...+ .++      .+.-||++-
T Consensus       161 EP~saLD~~~~~~i---~~~l~~l~~~~~~T~i~vTHd~~-ea~------~~aDri~vm  209 (242)
T cd03295         161 EPFGALDPITRDQL---QEEFKRLQQELGKTIVFVTHDID-EAF------RLADRIAIM  209 (242)
T ss_pred             CCCCCCCHHHHHHH---HHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEEE
T ss_conf             87654698999999---99999999975999999998999-999------969989999


No 131
>PRK13897 type IV secretion system component VirD4; Provisional
Probab=96.03  E-value=0.0026  Score=41.72  Aligned_cols=66  Identities=17%  Similarity=0.266  Sum_probs=41.7

Q ss_pred             EEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC--CCCC----HHHHHHCCCCEEEEECCCHHHCC
Q ss_conf             999844568767531035899999999964201358999851654--4441----46788505630572036811100
Q gi|254780606|r  531 IVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS--VDVI----TGTIKANFPIRISFQVTSKIDSR  602 (744)
Q Consensus       531 ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~--~~vi----~~~ik~n~~~ri~~~v~~~~dsr  602 (744)
                      +.++.|||+-|-.     ++ .+.+....-|+.||++.+-.|-.+  .+.-    -..|.+|..+||.|...+..+.+
T Consensus       407 VLfLLDEFanLGk-----Ip-~fekaiA~mrGYGIrl~lIiQslsQLk~~YG~~~a~tIl~Nc~~~I~f~~nD~eTAk  478 (628)
T PRK13897        407 VLFLMDEFPTLGK-----ME-QFKTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETAN  478 (628)
T ss_pred             EEEEECCCCCCCC-----HH-HHHHHHHHHHCCCCEEEEEEECHHHHHHHHCCCHHHHHHHCCCEEEEECCCCHHHHH
T ss_conf             8998510021487-----48-899999987036878999997699999885734477898558637986689753499


No 132
>pfam05970 DUF889 PIF1 helicase. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated.
Probab=96.02  E-value=0.0091  Score=37.98  Aligned_cols=41  Identities=22%  Similarity=0.199  Sum_probs=25.2

Q ss_pred             EEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHC-------CEEEEEEEE---CCCC
Q ss_conf             99984456876753103589999999996420-------135899985---1654
Q gi|254780606|r  531 IVIIVDEMADLMMVAGKEIEGAIQRLAQMARA-------AGIHLIMAT---QRPS  575 (744)
Q Consensus       531 ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra-------~Gihlilat---Qrp~  575 (744)
                      -++||||..   |...+ .-+.|.+++|.-|.       -||.+||+-   |=|-
T Consensus        76 ~vLIIDEiS---Mv~~~-lfd~id~~lr~i~~~~~~~PFGGiqvIl~GDf~QLPP  126 (418)
T pfam05970        76 SLIIWDEAP---MTHRH-CFEALDRTLRDILKNTDDKPFGGKTVVLGGDFRQILP  126 (418)
T ss_pred             CEEEEECCC---CCCHH-HHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCCC
T ss_conf             799985411---35789-9999999999987127876779747998244765587


No 133
>PRK10908 cell division protein FtsE; Provisional
Probab=95.99  E-value=0.035  Score=33.92  Aligned_cols=155  Identities=18%  Similarity=0.306  Sum_probs=69.1

Q ss_pred             CCEEEC----CHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECCCC---CEE--------CCCCCCC
Q ss_conf             873211----201148469970787534479999999999856801107999--72342---100--------0125775
Q gi|254780606|r  402 GESVIA----DLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDPKM---LEL--------SVYDGIP  464 (744)
Q Consensus       402 g~~~~~----dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~k~---~~~--------~~~~~~p  464 (744)
                      |++++-    ++.+.-.+.+.|..|||||++++. |.+|+   .|+.=++++  .|...   .+.        ..|++ +
T Consensus        14 ~~~~L~~vsl~i~~Ge~~~liG~nGsGKSTLl~~-i~Gl~---~p~~G~i~~~g~~i~~~~~~~~~~~r~~ig~v~Q~-~   88 (222)
T PRK10908         14 GRQALQGVTFHMRPGEMAFLTGHSGAGKSTLLKL-ICGIE---RPSAGKIWFSGHDITRLKNREVPFLRRQIGMIFQD-H   88 (222)
T ss_pred             CCEEEECCEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCHHHHHHHHHCCEEECCC-C
T ss_conf             9879864387996998999999998079999999-96599---99862999999998756666779987302477468-3


Q ss_pred             CEEE--EEEECHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHH--------H-HHHHHHHHHCCCCCCCCCCCCCCCEEE
Q ss_conf             2000--044441787689999998667699-999980778679--------9-999886420267766654323386799
Q gi|254780606|r  465 HLLT--PVVTNPKKAVMALKWAVREMEERY-RKMSHLSVRNIK--------S-YNERISTMYGEKPQGCGDDMRPMPYIV  532 (744)
Q Consensus       465 h~~~--~v~~~~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~--------~-~n~~~~~~~~~~~~~~~~~~~~~p~iv  532 (744)
                      +++.  .|..+.........+-..++.+|. ..+...+..+..        + -.+|+.-.+.-.         .-|.| 
T Consensus        89 ~l~~~~tv~eni~~~~~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~p~~LSGGq~QRvaiAraL~---------~~P~i-  158 (222)
T PRK10908         89 HLLMDRTVYDNVAIPLIIAGASGDDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVV---------NKPAV-  158 (222)
T ss_pred             CCCCCCEEEHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHH---------CCCCE-
T ss_conf             01689770045657898849998999999999998748765764887668968999999999997---------69999-


Q ss_pred             EEHHHHH-HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             9844568-767531035899999999964201358999851654
Q gi|254780606|r  533 IIVDEMA-DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       533 vviDE~a-~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ++.||=. .|-....+++...|.++.   + .|+-+|+.|...+
T Consensus       159 LllDEPt~~LD~~~~~~v~~~l~~l~---~-~g~tvl~vtHd~~  198 (222)
T PRK10908        159 LLADEPTGNLDDALSEGILRLFEEFN---R-VGVTVLMATHDIG  198 (222)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHH---H-CCCEEEEECCCHH
T ss_conf             99909876679999999999999998---6-1999999947999


No 134
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=95.99  E-value=0.015  Score=36.46  Aligned_cols=39  Identities=23%  Similarity=0.388  Sum_probs=29.8

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             732112011484699707875344799999999998568
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLR  441 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~  441 (744)
                      +.-+..+...|=.||.|.||||||..|.+|..+|.-...
T Consensus        16 ~~~~~~~f~~gi~lI~G~nGsGKSSIldAI~~ALyG~~~   54 (908)
T COG0419          16 DIDIEKLFDSGIFLIVGPNGAGKSSILDAITFALYGKTP   54 (908)
T ss_pred             CCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             562231578883799899999788999999999828987


No 135
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=95.97  E-value=0.047  Score=33.05  Aligned_cols=158  Identities=17%  Similarity=0.264  Sum_probs=72.9

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC-------CCCCCEEEE
Q ss_conf             887321120----114846997078753447999999999985680110799972342100012-------577520000
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY-------DGIPHLLTP  469 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~-------~~~ph~~~~  469 (744)
                      ..+++.-|+    .+.=++.|.|.||||||++++ +|+.+ |.....++.+--+|-+......+       ..-|+++..
T Consensus       326 ~~~~vL~~isl~I~~Ge~vaIVG~SGsGKSTLl~-LL~g~-y~p~~G~I~idg~di~~i~~~~lR~~I~~V~Q~~~LF~~  403 (569)
T PRK10789        326 TDHPALENVNFTLKPGQMLGICGPTGSGKSTLLS-LIQRH-FDVSEGDIRFHDIPLTKLQLDSWRSRLAVVSQTPFLFSD  403 (569)
T ss_pred             CCCCHHCCCCCEECCCCEEEEECCCCCCHHHHHH-HHHHH-HHCCCCCEEEECEECCCCCHHHHHHCCCCCCCCCCCCCC
T ss_conf             9842230765688899789987999998799999-99977-642678746501013425768886314765887502566


Q ss_pred             EEE-C---------HHHHHHHHHH-----HHHHHHHHHHHH-HHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEE
Q ss_conf             444-4---------1787689999-----998667699999-98077867999998864202677666543233867999
Q gi|254780606|r  470 VVT-N---------PKKAVMALKW-----AVREMEERYRKM-SHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVI  533 (744)
Q Consensus       470 v~~-~---------~~~~~~~l~~-----~~~em~~r~~~~-~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivv  533 (744)
                      -+. |         .++...+++.     .+..|...|+.+ .+.|.+-=.+=.+|++-.+.-..         -|. ++
T Consensus       404 TI~eNI~lg~~~~~~eei~~a~~~a~l~~~i~~lp~G~dT~ige~G~~LSGGQrQRialARAll~---------~p~-il  473 (569)
T PRK10789        404 TVANNIALGRPDATQQEIEHVARLASVHEDILRLPQGYDTEVGERGVMLSGGQKQRISIARALLL---------NAE-IL  473 (569)
T ss_pred             CHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC---------CCC-EE
T ss_conf             29999865797765458999999855568764375532371268889969999999999999954---------999-89


Q ss_pred             EHHHHHHHHH-HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             8445687675-31035899999999964201358999851654
Q gi|254780606|r  534 IVDEMADLMM-VAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       534 viDE~a~l~~-~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      +.||----+. ...+.+...+.++     ..|--+|+-|.|++
T Consensus       474 iLDEaTSaLD~~tE~~i~~~l~~~-----~~~~T~i~IaHRls  511 (569)
T PRK10789        474 ILDDALSAVDGRTEHQILHNLRQW-----GEGRTVIISAHRLS  511 (569)
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHH-----CCCCEEEEECCCHH
T ss_conf             980876668999999999999997-----49998999715888


No 136
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=95.95  E-value=0.07  Score=31.91  Aligned_cols=161  Identities=20%  Similarity=0.284  Sum_probs=83.3

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC----CC----------CCEECCCCCCCCEEEEEEE
Q ss_conf             120114846997078753447999999999985680110799972----34----------2100012577520000444
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD----PK----------MLELSVYDGIPHLLTPVVT  472 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD----~k----------~~~~~~~~~~ph~~~~v~~  472 (744)
                      +++.+.--+.|.|-.|||||++|++|-    .--.|+.=.+++-+    .+          |.-|-.|+-.||+-  +..
T Consensus        23 l~v~~Gevv~iiGpSGSGKSTlLRclN----~LE~~~~G~I~i~g~~~~~~~~~~~~R~~vGmVFQ~fnLFPH~T--vle   96 (240)
T COG1126          23 LSVEKGEVVVIIGPSGSGKSTLLRCLN----GLEEPDSGSITVDGEDVGDKKDILKLRRKVGMVFQQFNLFPHLT--VLE   96 (240)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHHHHH----CCCCCCCCEEEECCEECCCHHHHHHHHHHCCEECCCCCCCCCCH--HHH
T ss_conf             167389789998999998889999997----78688786499998722545469999985576624665465532--988


Q ss_pred             CHHHHHH-HHHHHHHHHH-HHHHHHHHCCCCCH-HHHH--------HHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH-
Q ss_conf             4178768-9999998667-69999998077867-9999--------988642026776665432338679998445687-
Q gi|254780606|r  473 NPKKAVM-ALKWAVREME-ERYRKMSHLSVRNI-KSYN--------ERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD-  540 (744)
Q Consensus       473 ~~~~~~~-~l~~~~~em~-~r~~~~~~~~~~~i-~~~n--------~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~-  540 (744)
                      |.-.+.. ++++-..|-+ +-.+++.+.|..+- +.|-        +|++..+.-.         --| -++.+||--- 
T Consensus        97 Nv~lap~~v~~~~k~eA~~~A~~lL~~VGL~dka~~yP~qLSGGQqQRVAIARALa---------M~P-~vmLFDEPTSA  166 (240)
T COG1126          97 NVTLAPVKVKKLSKAEAREKALELLEKVGLADKADAYPAQLSGGQQQRVAIARALA---------MDP-KVMLFDEPTSA  166 (240)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHCCCCCCCHHHHHHHHHHHHC---------CCC-CEEEECCCCCC
T ss_conf             87775399729899999999999999869556665395104807889999999871---------799-88863697543


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             675310358999999999642013589998516544441467885056305720
Q gi|254780606|r  541 LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       541 l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
                      |--..-.|+...+..||+.    |+-+|+-|---.       .--++..||.|-
T Consensus       167 LDPElv~EVL~vm~~LA~e----GmTMivVTHEM~-------FAr~VadrviFm  209 (240)
T COG1126         167 LDPELVGEVLDVMKDLAEE----GMTMIIVTHEMG-------FAREVADRVIFM  209 (240)
T ss_pred             CCHHHHHHHHHHHHHHHHC----CCEEEEEECHHH-------HHHHHHHEEEEE
T ss_conf             7988999999999999976----986999950367-------999862228995


No 137
>PRK13407 bchI magnesium chelatase subunit I; Provisional
Probab=95.95  E-value=0.0046  Score=40.03  Aligned_cols=62  Identities=11%  Similarity=0.186  Sum_probs=39.3

Q ss_pred             EEEEHHHHHHHHHHCCHHHHHHHHHHH--------HHHHCCEE---EEEEEECCCCCCCCHHHHHHCCCCEEEEECC
Q ss_conf             999844568767531035899999999--------96420135---8999851654444146788505630572036
Q gi|254780606|r  531 IVIIVDEMADLMMVAGKEIEGAIQRLA--------QMARAAGI---HLIMATQRPSVDVITGTIKANFPIRISFQVT  596 (744)
Q Consensus       531 ivvviDE~a~l~~~~~~~~e~~~~~la--------~~~ra~Gi---hlilatQrp~~~vi~~~ik~n~~~ri~~~v~  596 (744)
                      =|+.+||+..|-    +.+-+.|..-+        +-|.+.-.   ++++||+.|..+-+.+++-+-|...+...-.
T Consensus       130 GVLylDEinll~----~~vld~Ll~~~e~G~~~IeReg~s~~~ParF~LVatmNPeEg~Lrp~lLDRf~l~v~v~~~  202 (334)
T PRK13407        130 GYLYIDEVNLLE----DHIVDLLLDVAQSGENVVEREGLSIRHPARFVLVGSGNPEEGELRPQLLDRFGLSVEVRSP  202 (334)
T ss_pred             CEEEEECHHHCC----HHHHHHHHHHHHCCCEEEEECCEEEECCCCCEEEEEECCCCCCCCHHHHHHHCEEEEECCC
T ss_conf             867872053333----8899999988716957999776346036626589820888777598998361006871487


No 138
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=95.94  E-value=0.043  Score=33.33  Aligned_cols=195  Identities=12%  Similarity=0.130  Sum_probs=83.9

Q ss_pred             EEECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCC-------CCC
Q ss_conf             42057887321120----1148469970787534479999999999856801107999723421000125-------775
Q gi|254780606|r  396 LGKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYD-------GIP  464 (744)
Q Consensus       396 ~g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~-------~~p  464 (744)
                      ...+-.+++++-|+    .+.=.+.|.|.+|||||++++.|+ +|+.  ..-.+.+--+|........+.       .-+
T Consensus        10 ~~Y~~~~~~vL~~isf~I~~Ge~vaIvG~sGsGKSTLl~lL~-gl~~--~~G~I~idg~~i~~~~~~~~r~~i~~vpQ~~   86 (275)
T cd03289          10 AKYTEGGNAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFL-RLLN--TEGDIQIDGVSWNSVPLQKWRKAFGVIPQKV   86 (275)
T ss_pred             EEECCCCCCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHH-HHCC--CCCEEEECCEECCCCCHHHHHHHEEEECCCC
T ss_conf             996899966242507998799999999999997999999996-0357--8953999988067368999976389966556


Q ss_pred             CEEEEEE-ECH--------HHHHHHHHHH-----HHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             2000044-441--------7876899999-----9866769999998077867-99999886420267766654323386
Q gi|254780606|r  465 HLLTPVV-TNP--------KKAVMALKWA-----VREMEERYRKMSHLSVRNI-KSYNERISTMYGEKPQGCGDDMRPMP  529 (744)
Q Consensus       465 h~~~~v~-~~~--------~~~~~~l~~~-----~~em~~r~~~~~~~~~~~i-~~~n~~~~~~~~~~~~~~~~~~~~~p  529 (744)
                      .++..-+ .+.        ++...+++.+     +..+...+...-..+..++ .+-.+|+.-.+.-..         -|
T Consensus        87 ~lf~~Ti~eNl~~~~~~~~~~i~~~~~~~~l~~~i~~lp~~ld~~~~~~g~~LSgGqkQrl~lARaLl~---------~p  157 (275)
T cd03289          87 FIFSGTFRKNLDPYGKWSDEEIWKVAEEVGLKSVIEQFPGQLDFVLVDGGCVLSHGHKQLMCLARSVLS---------KA  157 (275)
T ss_pred             CCCCCCHHHHCCCCCCCCHHHHHHHHHHHCHHHHHHHCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHC---------CC
T ss_conf             326741999703212228899999999976699998573667403268887239999999999999951---------99


Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCC
Q ss_conf             79998445687675310358999999999642013589998516544441467885056305720368111003267631
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHG  609 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~g  609 (744)
                      . |++.||-.--+..   .-+..|.+.-+. ...|.-+|+.|.|.+      .++. + -||.+=     |.=.|...+-
T Consensus       158 ~-IllLDEpTs~LD~---~te~~i~~~l~~-~~~~~TvI~itHrl~------~~~~-~-DrIlvl-----d~G~Ive~Gt  219 (275)
T cd03289         158 K-ILLLDEPSAHLDP---ITYQVIRKTLKQ-AFADCTVILSEHRIE------AMLE-C-QRFLVI-----EENKVRQYDS  219 (275)
T ss_pred             C-EEEEECCCCCCCH---HHHHHHHHHHHH-HCCCCEEEEEECCHH------HHHH-C-CEEEEE-----ECCEEEEECC
T ss_conf             9-8999797668999---999999999999-729998999943888------8986-9-999999-----8999999789


Q ss_pred             HHHHCCCCCEE
Q ss_conf             68856898468
Q gi|254780606|r  610 AEQLLGRGDML  620 (744)
Q Consensus       610 ae~l~g~gd~l  620 (744)
                      -+.||.++-+.
T Consensus       220 ~eeLl~~~~~y  230 (275)
T cd03289         220 IQKLLNEKSHF  230 (275)
T ss_pred             HHHHHHCCCCH
T ss_conf             89998678915


No 139
>PRK10744 phosphate transporter subunit; Provisional
Probab=95.93  E-value=0.11  Score=30.43  Aligned_cols=44  Identities=25%  Similarity=0.345  Sum_probs=28.9

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             689842057887321120114846997078753447999999999
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      |.+..|+...=+-|-+++.+.=-+-+.|..|+|||++++. |.+|
T Consensus        16 ls~~yg~~~aL~~vsl~i~~Ge~~~liG~nGaGKSTLlk~-i~gl   59 (257)
T PRK10744         16 LNFYYGKFHALKNINLDIAKNQVTAFIGPSGCGKSTLLRT-FNKM   59 (257)
T ss_pred             EEEEECCEEEECCCEEEECCCCEEEEECCCCCCHHHHHHH-HHHH
T ss_conf             8999699767814289988998999999999819999999-9876


No 140
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]
Probab=95.93  E-value=0.018  Score=35.91  Aligned_cols=158  Identities=20%  Similarity=0.283  Sum_probs=82.4

Q ss_pred             CEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC----CCCCC---EEEE-E
Q ss_conf             7321120----114846997078753447999999999985680110799972342100012----57752---0000-4
Q gi|254780606|r  403 ESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY----DGIPH---LLTP-V  470 (744)
Q Consensus       403 ~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~----~~~ph---~~~~-v  470 (744)
                      +|++-|+    ...--+-|-|-.|||||.+.+.++-.  +......|+|-.-|.+.-+...+    --+|+   |+.. |
T Consensus       349 ~pil~~isF~l~~G~~lgIIGPSgSGKSTLaR~lvG~--w~p~~G~VRLDga~l~qWd~e~lG~hiGYLPQdVeLF~GTI  426 (580)
T COG4618         349 KPILKGISFALQAGEALGIIGPSGSGKSTLARLLVGI--WPPTSGSVRLDGADLRQWDREQLGRHIGYLPQDVELFDGTI  426 (580)
T ss_pred             CCCEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCC--CCCCCCCEEECCHHHHCCCHHHHCCCCCCCCCCCEECCCCH
T ss_conf             7612062367658866788788876577899999811--35678737756264512798885113172765430057719


Q ss_pred             ---------EECHHHHHHHHHHH-HHHHHHHH----HHHHHCCCCCH-HHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEH
Q ss_conf             ---------44417876899999-98667699----99998077867-99999886420267766654323386799984
Q gi|254780606|r  471 ---------VTNPKKAVMALKWA-VREMEERY----RKMSHLSVRNI-KSYNERISTMYGEKPQGCGDDMRPMPYIVIIV  535 (744)
Q Consensus       471 ---------~~~~~~~~~~l~~~-~~em~~r~----~~~~~~~~~~i-~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvvi  535 (744)
                               -.|.++...+-+.+ +.||--|.    +..--.+-..+ .+-.+|+.-.+.-+         ..|++| |.
T Consensus       427 aeNIaRf~~~~d~~kIieAA~lAgvHelIl~lP~GYdT~iG~~G~~LSgGQRQRIaLARAlY---------G~P~lv-VL  496 (580)
T COG4618         427 AENIARFGEEADPEKVIEAARLAGVHELILRLPQGYDTRIGEGGATLSGGQRQRIALARALY---------GDPFLV-VL  496 (580)
T ss_pred             HHHHHHCCCCCCHHHHHHHHHHCCHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC---------CCCCEE-EE
T ss_conf             99987316668879999999873758999717687667657898877723789999999970---------897089-95


Q ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             4568767531035899999999964201358999851654
Q gi|254780606|r  536 DEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       536 DE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ||=+.=.   ..+-|.++.+--.-.|+.|+-.|+.|+||+
T Consensus       497 DEPNsNL---D~~GE~AL~~Ai~~~k~rG~~vvviaHRPs  533 (580)
T COG4618         497 DEPNSNL---DSEGEAALAAAILAAKARGGTVVVIAHRPS  533 (580)
T ss_pred             CCCCCCC---CHHHHHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             5898776---526799999999999976987999926777


No 141
>PRK08506 replicative DNA helicase; Provisional
Probab=95.91  E-value=0.074  Score=31.74  Aligned_cols=148  Identities=19%  Similarity=0.234  Sum_probs=77.3

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE-------CCCCCCC--CEEEEEEECHHHHHH
Q ss_conf             0114846997078753447999999999985680110799972342100-------0125775--200004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL-------SVYDGIP--HLLTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~-------~~~~~~p--h~~~~v~~~~~~~~~  479 (744)
                      |.+.--++|||.+|+|||.|..+|....+....    ..+++-.-|..-       +...+++  .+...-.++.+  ..
T Consensus       190 l~~gdLiIIAARPsmGKTAfAlniA~~~a~~~~----~V~~FSLEMs~~ql~~Rlls~~s~V~~~~lr~g~l~~~e--~~  263 (473)
T PRK08506        190 FNKGDLIIIAARPSMGKTTLVLNMVLKALNQGK----GVAFFSLEMPAEQLMLRMLSAKTSIPLQNLRTGDLDDDE--WE  263 (473)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC----CEEEEECCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHH--HH
T ss_conf             985627999507998678999999999996599----658982247999999999997288783100068999999--99


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHHHH
Q ss_conf             9999998667699999980778679999988642026776665432338679998445687675310------3589999
Q gi|254780606|r  480 ALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEGAI  553 (744)
Q Consensus       480 ~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~~~  553 (744)
                      .+.+++.+|...--.+.....-++.+..++.+.......        .+-  +||||=+. ||...+      .++...-
T Consensus       264 ~~~~a~~~l~~~~l~IdD~~~lti~~Ira~~Rr~k~~~~--------~l~--livIDYLQ-Lm~~~~~~~~R~~ev~~IS  332 (473)
T PRK08506        264 NLSDACDELSQKKLFVYDSGYVNIHQVRAQLRKLKSQHP--------EIG--LAVIDYLQ-LMSGSKNFKDRHLQISEIS  332 (473)
T ss_pred             HHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHCC--------CCC--EEEEEHHH-HCCCCCCCCCHHHHHHHHH
T ss_conf             999999998659889988999999999999999999769--------987--89963675-5468887530889999999


Q ss_pred             HHHHHHHHCCEEEEEEEECC
Q ss_conf             99999642013589998516
Q gi|254780606|r  554 QRLAQMARAAGIHLIMATQR  573 (744)
Q Consensus       554 ~~la~~~ra~GihlilatQr  573 (744)
                      ..|-++|+-++|-+|+-+|=
T Consensus       333 r~LK~lAkEl~vPViaLSQL  352 (473)
T PRK08506        333 RGLKLLARELDIPIIALSQL  352 (473)
T ss_pred             HHHHHHHHHHCCCEEEECCC
T ss_conf             99999999969979997036


No 142
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=95.89  E-value=0.01  Score=37.65  Aligned_cols=148  Identities=21%  Similarity=0.296  Sum_probs=74.6

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC---------------CCEECCCCCCCCEEEE
Q ss_conf             2112011484699707875344799999999998568011079997234---------------2100012577520000
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK---------------MLELSVYDGIPHLLTP  469 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k---------------~~~~~~~~~~ph~~~~  469 (744)
                      +-+++.+.--+.|-|..|||||++|+. |.+|.   .|+.=++++-+-.               +.-|-.|.-+||+   
T Consensus        19 vsl~i~~Ge~~~ivGpSGsGKSTLL~~-i~gL~---~p~~G~i~i~g~~i~~~~~~~~~~rr~iG~VFQ~~~L~p~l---   91 (213)
T cd03262          19 IDLTVKKGEVVVIIGPSGSGKSTLLRC-INLLE---EPDSGTIIIDGLKLTDDKKNINELRQKVGMVFQQFNLFPHL---   91 (213)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCHHHHHHHHCCCEEEECCCCCCCCC---
T ss_conf             075988998999999998449999999-98199---99864999999999998156999867827996798758999---


Q ss_pred             EEECHHHHHHHHHHH----HHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEH
Q ss_conf             444417876899999----9866769-99999807786799---------999886420267766654323386799984
Q gi|254780606|r  470 VVTNPKKAVMALKWA----VREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIV  535 (744)
Q Consensus       470 v~~~~~~~~~~l~~~----~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvvi  535 (744)
                        |-.+.....+.+.    ..|..+| .+++...|..+...         -.+|++-.+.-.         .-|.| ++.
T Consensus        92 --tv~eNV~~~l~~~~~~~~~e~~~~a~~~L~~vgL~~~~~~~P~~LSGGqqQRVAIARALa---------~~P~i-lL~  159 (213)
T cd03262          92 --TVLENITLAPIKVKGMSKAEAEERALELLEKVGLADKADAYPAQLSGGQQQRVAIARALA---------MNPKV-MLF  159 (213)
T ss_pred             --CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCCHHHHHHHHHHHHC---------CCCCE-EEE
T ss_conf             --199999999999769999999999999998689978874994446929999999999963---------79999-997


Q ss_pred             HH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             45-68767531035899999999964201358999851654
Q gi|254780606|r  536 DE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       536 DE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      || ++.|-.....++.+.|.+|.   +. |+-+|+.|.-+.
T Consensus       160 DEPts~LD~~~~~~i~~ll~~l~---~~-g~T~i~VTHD~~  196 (213)
T cd03262         160 DEPTSALDPELVGEVLDVMKDLA---EE-GMTMVVVTHEMG  196 (213)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHH---HC-CCEEEEECCCHH
T ss_conf             08888779899999999999998---62-999999998999


No 143
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369    GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway. ; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=95.85  E-value=0.0029  Score=41.34  Aligned_cols=228  Identities=25%  Similarity=0.398  Sum_probs=119.3

Q ss_pred             EE-EEECCCCEEEE---ECCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCE--EEEECCCCCH
Q ss_conf             27-75189834544---268888870765875128121146783689842057887321120114846--9970787534
Q gi|254780606|r  352 RV-AVIPKRNAIGI---ELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHI--LVAGTTGSGK  425 (744)
Q Consensus       352 ~~-~~~pg~~~~~~---~~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~--lvaG~TgsGK  425 (744)
                      || ..+-||. |-|   .||-..=+=|-|| ||+.+.-.   ..|. .||.+-+.---+-.|-++||+  ||-|=|||||
T Consensus       185 RI~Lrv~Gr~-~DiRVSt~Pt~fGERvVMR-LLDK~~~~---l~L~-~LGm~~~~l~~~~~li~rpHGIiLVTGPTGSGK  258 (495)
T TIGR02533       185 RISLRVAGRD-IDIRVSTVPTSFGERVVMR-LLDKDAVR---LDLE-ALGMSPELLSSLERLIKRPHGIILVTGPTGSGK  258 (495)
T ss_pred             CEEEEECCEE-EEEEEEECCCCCCCEEEHH-HHCHHHHH---HHHH-HCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCH
T ss_conf             2666673744-6678853058997100000-11204777---7588-648888899999999718896188417789852


Q ss_pred             HHHHHHHHHHHHHHCCHHHEEEEEE-CCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             4799999999998568011079997-234210001257752000044441787689999998667699999980778679
Q gi|254780606|r  426 SVAINTMIMSLLYRLRPDECRMIMV-DPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIK  504 (744)
Q Consensus       426 S~~l~~~i~sl~~~~~p~~~~~~li-D~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~  504 (744)
                      |+-|.+-+.-   -|++ +.+++=| ||  +|+.. .||-+....-=-++..| ..|+..    -|              
T Consensus       259 tTTLYaaL~~---LN~~-~~NIlTvEDP--VEY~i-~GIgQ~Qvn~kIglTFA-~GLRaI----LR--------------  312 (495)
T TIGR02533       259 TTTLYAALSR---LNTP-ERNILTVEDP--VEYQI-EGIGQIQVNPKIGLTFA-AGLRAI----LR--------------  312 (495)
T ss_pred             HHHHHHHHHH---HCCC-CCCEEEEECC--EEEEE-CCCCEEEECCCCCHHHH-HHHHHH----HC--------------
T ss_conf             5889999986---3589-9715686578--24762-48763651465430388-887886----42--------------


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC--CC-----
Q ss_conf             99998864202677666543233867999844568767531035899999999964201358999851654--44-----
Q gi|254780606|r  505 SYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS--VD-----  577 (744)
Q Consensus       505 ~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~--~~-----  577 (744)
                             .           |    | =||.|-|..|+ .++         +||-+|==.| ||||+|=-=.  +.     
T Consensus       313 -------Q-----------D----P-DiiMvGEIRD~-ETA---------~IAiQASLTG-HLVLSTLHTNDAAgAvtRL  358 (495)
T TIGR02533       313 -------Q-----------D----P-DIIMVGEIRDL-ETA---------QIAIQASLTG-HLVLSTLHTNDAAGAVTRL  358 (495)
T ss_pred             -------C-----------C----C-CEEEEECCCCH-HHH---------HHHHHHHHHH-HHHHHHHHHHHHHHHHHHH
T ss_conf             -------7-----------9----9-88998231606-899---------9999876432-5765565540154466555


Q ss_pred             ------------CCHHHHHHCCCCEEEEECCCHHHC----CHHCCCCCHHHHCCCC-CEEEECCC-CCE--------EEE
Q ss_conf             ------------414678850563057203681110----0326763168856898-46864689-843--------899
Q gi|254780606|r  578 ------------VITGTIKANFPIRISFQVTSKIDS----RTILGEHGAEQLLGRG-DMLYMSGG-GRI--------QRV  631 (744)
Q Consensus       578 ------------vi~~~ik~n~~~ri~~~v~~~~ds----r~il~~~gae~l~g~g-d~l~~~~~-~~~--------~r~  631 (744)
                                  .|.|.|=+=+==|||=.|.....-    +.-+|-.-.+-.-++| |.||.+-| ++.        +=+
T Consensus       359 ~DMGvEPFL~aSsl~GVLAQRLVRrlCp~Cke~y~a~~~~~~~~G~~~~~~~~~nGv~~lyr~~GC~~C~~~GY~GRtGI  438 (495)
T TIGR02533       359 IDMGVEPFLLASSLLGVLAQRLVRRLCPHCKEPYEATDEELALLGISKKEPKKDNGVIILYRPVGCPACNHTGYRGRTGI  438 (495)
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHCCCCCEEEEECCCCCHHHCCCCCCCCEEE
T ss_conf             32586404899999999986334331514688899897999854884021035776489977876421278888355036


Q ss_pred             EECCCCHHHHHHHH
Q ss_conf             93438988999999
Q gi|254780606|r  632 HGPLVSDIEIEKVV  645 (744)
Q Consensus       632 ~~~~~~~~~~~~~~  645 (744)
                      +=.++=|++|.+.+
T Consensus       439 yElL~vDD~lr~lI  452 (495)
T TIGR02533       439 YELLLVDDDLRSLI  452 (495)
T ss_pred             EEEEEECHHHHHHH
T ss_conf             88674355899876


No 144
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=95.82  E-value=0.034  Score=34.03  Aligned_cols=52  Identities=21%  Similarity=0.325  Sum_probs=31.8

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC
Q ss_conf             211201148469970787534479999999999856801107999723421000
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS  458 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~  458 (744)
                      +-+++.+.-.+-|-|.||||||++++ +|+.+ |.-...++.+--+|-+...+.
T Consensus       354 isl~i~~Ge~vaiVG~SGsGKSTL~~-LL~gl-y~p~~G~I~idg~di~~i~~~  405 (585)
T PRK13657        354 VSFEAKPGQTVAIVGPTGAGKSTLIN-LLHRV-FDPQSGRIRIDGTDIRTVTRA  405 (585)
T ss_pred             CEEEECCCCEEEEECCCCCCHHHHHH-HHHHH-CCCCCCCEEECCEECHHCCHH
T ss_conf             03897599889998898986999999-98601-578879675898961016899


No 145
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=95.80  E-value=0.1  Score=30.78  Aligned_cols=39  Identities=33%  Similarity=0.523  Sum_probs=26.0

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             84699707875344799999999998568011079997234
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      .++||.+-||||||...-..+...+.+.  ...+.+++-|.
T Consensus         1 ~~~lv~~ptGsGKT~~~~~~~~~~~~~~--~~~~~lil~Pt   39 (144)
T cd00046           1 RDVLLAAPTGSGKTLAALLPILELLDSL--KGGQVLVLAPT   39 (144)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHHHC--CCCEEEEECCH
T ss_conf             9999988997179999999999999756--89769997467


No 146
>pfam00735 Septin Septin. Members of this family include CDC3, CDC10, CDC11 and CDC12/Septin. Members of this family bind GTP. As regards the septins, these are polypeptides of 30-65kDa with three characteristic GTPase motifs (G-1, G-3 and G-4) that are similar to those of the Ras family. The G-4 motif is strictly conserved with a unique septin consensus of AKAD. Most septins are thought to have at least one coiled-coil region, which in some cases is necessary for intermolecular interactions that allow septins to polymerize to form rod-shaped complexes. In turn, these are arranged into tandem arrays to form filaments. They are multifunctional proteins, with roles in cytokinesis, sporulation, germ cell development, exocytosis and apoptosis.
Probab=95.79  E-value=0.0066  Score=38.91  Aligned_cols=27  Identities=37%  Similarity=0.666  Sum_probs=23.2

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             469970787534479999999999856
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRL  440 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~  440 (744)
                      -+||+|.+|+|||.|||+|+.+-++..
T Consensus         6 nimvvG~sGlGKTTfiNtL~~~~~~~~   32 (280)
T pfam00735         6 TLMVVGESGLGKTTLINTLFLTDLYPE   32 (280)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCC
T ss_conf             999977999978999999857857786


No 147
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=95.78  E-value=0.028  Score=34.64  Aligned_cols=163  Identities=20%  Similarity=0.307  Sum_probs=76.4

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE-------------C-CCCCCCCEEE--
Q ss_conf             21120114846997078753447999999999985680110799972342100-------------0-1257752000--
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL-------------S-VYDGIPHLLT--  468 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~-------------~-~~~~~ph~~~--  468 (744)
                      +-+++.+.-.+.+.|..|||||++|+ +|.+|+   .|+.=++++-+-.....             + .|+. +.++.  
T Consensus        23 isl~i~~Ge~~~iiG~sGsGKTTll~-~i~Gl~---~p~~G~I~~~g~~i~~~~~~~~~~~rr~~Ig~v~Q~-~~L~~~l   97 (218)
T cd03255          23 VSLSIEKGEFVAIVGPSGSGKSTLLN-ILGGLD---RPTSGEVRVDGTDISKLSEKELAAFRRRHIGFVFQS-FNLLPDL   97 (218)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCEEEEECCEECCCCCHHHHHHHHHCCEEEECCC-CCCCCCC
T ss_conf             28998699899999999986999999-996699---999649999999988799899999865047898667-5215564


Q ss_pred             EEEECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH
Q ss_conf             04444178768999999866769-99999807786799---------999886420267766654323386799984456
Q gi|254780606|r  469 PVVTNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEM  538 (744)
Q Consensus       469 ~v~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~  538 (744)
                      .|..+.............+.++| .+++...+..++..         -.+|+.-.+.-         -.-|- |++.||=
T Consensus        98 tV~eni~~~~~~~~~~~~~~~~~v~~~l~~l~l~~~~~~~~~~LSGG~kQRv~iAraL---------~~~P~-llllDEP  167 (218)
T cd03255          98 TALENVELPLLLAGVPKKERRERAEELLERVGLGDRLNHYPSELSGGQQQRVAIARAL---------ANDPK-IILADEP  167 (218)
T ss_pred             CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHH---------HCCCC-EEEEECC
T ss_conf             3999999999984999899999999876767937887388763899999999999998---------55999-9998188


Q ss_pred             HH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEE
Q ss_conf             87-67531035899999999964201358999851654444146788505630572
Q gi|254780606|r  539 AD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISF  593 (744)
Q Consensus       539 a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~  593 (744)
                      .- |-...   ....+.-|.++.+..|+-+|++|-.++  ++      .+--||.+
T Consensus       168 Ts~LD~~~---~~~i~~~l~~l~~~~~~tii~itHd~~--~~------~~aDrv~~  212 (218)
T cd03255         168 TGNLDSET---GKEVMELLRELNKEAGTTIVVVTHDPE--LA------EYADRIIE  212 (218)
T ss_pred             CCCCCHHH---HHHHHHHHHHHHHHCCCEEEEECCCHH--HH------HHCCEEEE
T ss_conf             87689999---999999999999962989999896889--99------86998999


No 148
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=95.76  E-value=0.07  Score=31.88  Aligned_cols=82  Identities=21%  Similarity=0.379  Sum_probs=58.4

Q ss_pred             EEEEHHHHHHHHHHCC---------HHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHC
Q ss_conf             9998445687675310---------3589999999996420135899985165444414678850563057203681110
Q gi|254780606|r  531 IVIIVDEMADLMMVAG---------KEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDS  601 (744)
Q Consensus       531 ivvviDE~a~l~~~~~---------~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~ds  601 (744)
                      -+|+|||+..+.++-.         .-+..++..|-..--.-|+-.|.||.||.  .+...||+-|-.-|-|+..+...-
T Consensus       212 civFiDE~DAiaLdRryQelRGDVsEiVNALLTelDgi~eneGVvtIaaTN~p~--~LD~aiRsRFEeEIEF~LP~~eEr  289 (368)
T COG1223         212 CIVFIDELDAIALDRRYQELRGDVSEIVNALLTELDGIKENEGVVTIAATNRPE--LLDPAIRSRFEEEIEFKLPNDEER  289 (368)
T ss_pred             EEEEEHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCEEEEEECCCHH--HCCHHHHHHHHHEEEEECCCHHHH
T ss_conf             499840024555304578864549999999998501744577569995059846--507888865565065648885899


Q ss_pred             CHHCCCCCHHHHCC
Q ss_conf             03267631688568
Q gi|254780606|r  602 RTILGEHGAEQLLG  615 (744)
Q Consensus       602 r~il~~~gae~l~g  615 (744)
                      -.|| +.-|+++.-
T Consensus       290 ~~il-e~y~k~~Pl  302 (368)
T COG1223         290 LEIL-EYYAKKFPL  302 (368)
T ss_pred             HHHH-HHHHHHCCC
T ss_conf             9999-998985897


No 149
>PTZ00301 uridine kinase; Provisional
Probab=95.76  E-value=0.017  Score=36.19  Aligned_cols=38  Identities=29%  Similarity=0.386  Sum_probs=32.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC
Q ss_conf             69970787534479999999999856801107999723
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP  452 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~  452 (744)
                      +-|||.+|||||.+-+.|+-.|..+..+..+.++.-|.
T Consensus         6 IgIaGgSgSGKTT~a~~i~~~l~~~~~~~~v~ii~~D~   43 (210)
T PTZ00301          6 IGISGASGSGKSSLSTNIVSELMAHCGPVSIGVICEDF   43 (210)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             99968876789999999999987614998079983676


No 150
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=95.75  E-value=0.038  Score=33.75  Aligned_cols=62  Identities=16%  Similarity=0.259  Sum_probs=33.3

Q ss_pred             EEECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC
Q ss_conf             42057887321120----11484699707875344799999999998568011079997234210001
Q gi|254780606|r  396 LGKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV  459 (744)
Q Consensus       396 ~g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~  459 (744)
                      ....-..++++-|+    .+.-++.|.|.+|||||++++. |++| |.-....+.+--+|-+......
T Consensus       471 f~y~~~~~~vl~~vsl~i~~Ge~vaIvG~sGsGKSTL~kl-l~Gl-~~p~~G~i~idg~~~~~~~~~~  536 (694)
T TIGR03375       471 FAYPGQETPALDNVSLTIRPGEKVAIIGRIGSGKSTLLKL-LLGL-YQPTEGSVLLDGVDIRQIDPAD  536 (694)
T ss_pred             EECCCCCCHHHCCHHHEECCCCEEEEEECCCCCHHHHHHH-HCCC-CCCCCCEEEECCEECCCCCHHH
T ss_conf             9879889222136311887997899980589878899998-5567-5899887998985425499999


No 151
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=95.74  E-value=0.087  Score=31.23  Aligned_cols=54  Identities=17%  Similarity=0.239  Sum_probs=33.5

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             6898420578873211201148469970787534479999999999856801107999
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      |....|....=+-|-+++.+.=.+-|.|..|||||++++. |.+|.   .|+.=++.+
T Consensus         8 ls~~yg~~~aL~dvsl~i~~Ge~~~iiG~nGaGKSTLl~~-l~gl~---~p~~G~i~i   61 (242)
T PRK11124          8 INCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRV-LNLLE---MPRSGTLNI   61 (242)
T ss_pred             EEEEECCEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEEE
T ss_conf             9999899998942077887998999999999719999999-96588---888608999


No 152
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=95.73  E-value=0.017  Score=36.19  Aligned_cols=206  Identities=18%  Similarity=0.308  Sum_probs=96.5

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECCCCC-EE--------CCCCCCC-CEEEEEEE
Q ss_conf             211201148469970787534479999999999856801107999--723421-00--------0125775-20000444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDPKML-EL--------SVYDGIP-HLLTPVVT  472 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~k~~-~~--------~~~~~~p-h~~~~v~~  472 (744)
                      +-+++.+.=-+.|.|..|||||++++. |.+|+   .|..=++++  .|.+.. .+        ..|++.- +++...+ 
T Consensus        30 Isl~i~~GE~v~iiG~nGsGKSTL~r~-l~gl~---~P~~G~I~i~G~~~~~~~~~~~~r~~ig~vfQ~P~~~l~~~tV-  104 (281)
T PRK13633         30 VNLEVKKGEFLVILGHNGSGKSTIAKH-MNALL---LPSEGKVYVDGLDTSDEENLWDIRNKAGMVFQNPDNQIVATIV-  104 (281)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEECCEECCCHHHHHHHHHCEEEEEECCCCCCCHHHH-
T ss_conf             076887998999999999849999999-97588---7888569999998788566999873608986688642028899-


Q ss_pred             CHHHHHHHHHH---HHHHHHHH-HHHHHHCCCCCHHHHH---------HHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH
Q ss_conf             41787689999---99866769-9999980778679999---------98864202677666543233867999844568
Q gi|254780606|r  473 NPKKAVMALKW---AVREMEER-YRKMSHLSVRNIKSYN---------ERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA  539 (744)
Q Consensus       473 ~~~~~~~~l~~---~~~em~~r-~~~~~~~~~~~i~~~n---------~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a  539 (744)
                       .+..+-.+..   -..++++| .+.+...|..++.+..         +|++-...         +.--|- +++.||=.
T Consensus       105 -~e~i~fg~~~~g~~~~e~~~rv~~~l~~~gL~~~~~~~p~~LSGGqkQRvaiA~a---------La~~P~-iLilDEPT  173 (281)
T PRK13633        105 -EEDVAFGPENLGIPPEEIRERVDESLKKVGMYEYRRHAPHLLSGGQKQRVAIAGI---------LAMRPE-CIIFDEPT  173 (281)
T ss_pred             -HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCHHCCHHHHHHHHHHHH---------HHCCCC-EEEEECCC
T ss_conf             -9999988988699999999999999986794876638910089859999999999---------985999-99981873


Q ss_pred             H-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCC
Q ss_conf             7-675310358999999999642013589998516544441467885056305720368111003267631688568984
Q gi|254780606|r  540 D-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGD  618 (744)
Q Consensus       540 ~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd  618 (744)
                      . |-.....++   +.-|-++.+..|+-+|+.|.+.+  .    + +. ..||.+--    +-++|.+ +-.+.++.+-+
T Consensus       174 s~LDp~~~~~i---~~~l~~l~~e~g~Tii~vTHdl~--~----~-~~-aDrv~vm~----~G~Iv~~-G~p~evf~~~~  237 (281)
T PRK13633        174 AMLDPSGRREV---VNTIKELNKKYGITIILITHYME--E----A-VE-ADRIIVMD----KGKVVME-GTPKEIFKEVE  237 (281)
T ss_pred             CCCCHHHHHHH---HHHHHHHHHHCCCEEEEECCCHH--H----H-HC-CCEEEEEE----CCEEEEE-CCHHHHHCCHH
T ss_conf             43898999999---99999999840989999867889--9----9-73-99899998----9999997-79999976988


Q ss_pred             EEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCC
Q ss_conf             68646898438999343898899999999984088
Q gi|254780606|r  619 MLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGC  653 (744)
Q Consensus       619 ~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~  653 (744)
                      .|...+           +.-.++-++...++..|-
T Consensus       238 ~L~~~~-----------l~~P~~~~l~~~L~~~g~  261 (281)
T PRK13633        238 MMKKIG-----------LDVPQVTELAYELRKEGV  261 (281)
T ss_pred             HHHHCC-----------CCCCCHHHHHHHHHHCCC
T ss_conf             999779-----------999919999999997499


No 153
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=95.73  E-value=0.068  Score=31.99  Aligned_cols=29  Identities=31%  Similarity=0.437  Sum_probs=19.9

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             21120114846997078753447999999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMI  433 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i  433 (744)
                      +-+++.+.==+.|.|..|||||+++..+|
T Consensus        14 Vsl~i~~Ge~~aIvG~nGsGKSTL~~~~l   42 (226)
T cd03270          14 VDVDIPRNKLVVITGVSGSGKSSLAFDTI   42 (226)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             48998599899998789960989836166


No 154
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=95.73  E-value=0.098  Score=30.89  Aligned_cols=38  Identities=29%  Similarity=0.251  Sum_probs=26.1

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             112011484699707875344799999999998568011079
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      -+++.+.--+-+.|..|||||++++. |++++   .|+.=++
T Consensus        44 sf~i~~GEivgllG~NGaGKSTLlk~-I~Gl~---~P~~G~I   81 (264)
T PRK13546         44 SLKAYEGDVIGLVGINGSGKSTLSNI-IGGSL---SPTVGKV   81 (264)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEE
T ss_conf             78885998999998998619999999-96798---8887479


No 155
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=95.71  E-value=0.1  Score=30.75  Aligned_cols=38  Identities=16%  Similarity=0.200  Sum_probs=26.2

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             484699707875344799999999998568011079997234
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      .==.+|+|..|+|||.++..+....+    -..-+.+.||-.
T Consensus        19 G~it~i~G~pG~GKStl~lq~a~~~~----~~g~~v~YidtE   56 (218)
T cd01394          19 GTVTQVYGPPGTGKTNIAIQLAVETA----GQGKKVAYIDTE   56 (218)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHH----HCCCEEEEEECC
T ss_conf             87999989999849999999999986----369869999665


No 156
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.71  E-value=0.039  Score=33.61  Aligned_cols=206  Identities=18%  Similarity=0.288  Sum_probs=95.1

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--CC-------------CCEECCCCCCC--CEE
Q ss_conf             21120114846997078753447999999999985680110799972--34-------------21000125775--200
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--PK-------------MLELSVYDGIP--HLL  467 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~k-------------~~~~~~~~~~p--h~~  467 (744)
                      +-+++.+.--+.|-|.+|||||++++ +|.+|+   .|..=++.+-+  ..             .+.+ .|+. |  .++
T Consensus        26 vsl~I~~Ge~~~iiG~nGsGKSTLl~-~l~Gll---~P~sG~V~i~G~~i~~~~~~~~~~~~r~~vg~-vfQ~-p~~ql~   99 (286)
T PRK13641         26 ISFELEDGSFVALIGHTGSGKSTLMQ-HFNALL---KPSSGKITIAGYHITPETSNKNLKDLRKKVGL-VFQF-PEAQLF   99 (286)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCEEEEECCEECCCCCCHHHHHHHHHHEEE-EEEC-CCCCCC
T ss_conf             06798699999999999839999999-996598---98854999998999766655579999851548-9766-510126


Q ss_pred             EE-EEECHHHHHHHHHHHHHHHHHH-HHHHHHCCCC-CHHH-H--------HHHHHHHHCCCCCCCCCCCCCCCEEEEEH
Q ss_conf             00-4444178768999999866769-9999980778-6799-9--------99886420267766654323386799984
Q gi|254780606|r  468 TP-VVTNPKKAVMALKWAVREMEER-YRKMSHLSVR-NIKS-Y--------NERISTMYGEKPQGCGDDMRPMPYIVIIV  535 (744)
Q Consensus       468 ~~-v~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~-~i~~-~--------n~~~~~~~~~~~~~~~~~~~~~p~ivvvi  535 (744)
                      .. |..+.......+.+-..++.+| .+.+...+.. ++.+ |        .+|++-...         +.--|. +++.
T Consensus       100 ~~tV~eev~~g~~~~g~~~~e~~~~~~~~l~~vgl~~~~~~~~p~~LSGGqkqRvaiA~a---------La~~P~-iLlL  169 (286)
T PRK13641        100 ENTVLKDVEFGPKNFGFSEQEAKEKALKWLKKVGLSEDLISKSPFELSGGQMRRVAIAGV---------MAYEPE-ILCL  169 (286)
T ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCC-EEEE
T ss_conf             112999999999986999899999999999976996455542913299999999999999---------974999-9997


Q ss_pred             HHHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHC
Q ss_conf             45687-67531035899999999964201358999851654444146788505630572036811100326763168856
Q gi|254780606|r  536 DEMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLL  614 (744)
Q Consensus       536 DE~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~  614 (744)
                      ||=.. |-....+++...|.+|.    ..|.-+|++|...+  .+     +.+-.||.+=    .+-|+|.+.. .+.++
T Consensus       170 DEPTsgLDp~~~~~i~~ll~~l~----~~G~Tii~vtHd~~--~v-----~~~adrv~vm----~~G~iv~~G~-p~evf  233 (286)
T PRK13641        170 DEPAAGLDPEGRKEMMQIFKDYQ----KAGHTVILVTHNMD--DV-----AEYADDVLVL----EHGKLIKHAS-PKEIF  233 (286)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHH----HCCCEEEEECCCHH--HH-----HHHCCEEEEE----ECCEEEEECC-HHHHH
T ss_conf             39734389999999999999999----63999999915999--99-----9979999999----8999999779-99996


Q ss_pred             CCCCEEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCC
Q ss_conf             898468646898438999343898899999999984088
Q gi|254780606|r  615 GRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGC  653 (744)
Q Consensus       615 g~gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~  653 (744)
                      .+=|.|.           .+++...++-+++..+++.|-
T Consensus       234 ~~~~~l~-----------~~~l~~P~~~~~~~~L~~~g~  261 (286)
T PRK13641        234 SDSEWLK-----------KHYLDEPATSRFASKLEKGGF  261 (286)
T ss_pred             CCHHHHH-----------HCCCCCCHHHHHHHHHHHCCC
T ss_conf             5999999-----------779999939999999997599


No 157
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.69  E-value=0.02  Score=35.58  Aligned_cols=154  Identities=17%  Similarity=0.271  Sum_probs=71.3

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC--------CCCCCC--CEEEEEE-EC
Q ss_conf             211201148469970787534479999999999856801107999723421000--------125775--2000044-44
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS--------VYDGIP--HLLTPVV-TN  473 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~--------~~~~~p--h~~~~v~-~~  473 (744)
                      +-+.+.+.-.+.|.|..|||||++++. |.+|+ +-+-.++.+.-.|.......        .|++ |  +++...+ .+
T Consensus        24 vs~~i~~Ge~~aiiG~NGsGKSTLl~~-l~Gl~-~p~~G~I~i~G~~i~~~~~~~lr~~iG~vfQ~-p~~ql~~~tV~e~  100 (273)
T PRK13647         24 VSLVIPEGSKTAILGPNGAGKSTLLLH-LNGIY-TAQRGRVKVMGKVVNEENIRWIRKKVGLVFQD-PDDQLFSSTVWDD  100 (273)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC-CCCCEEEEECCEECCCCCHHHHHHHCEEEECC-CHHHHCCCHHHHH
T ss_conf             178988998999999999759999999-96698-88861999999999968989998752488107-0243052419999


Q ss_pred             HHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH-HH
Q ss_conf             1787689999998667699-99998077867999---------9988642026776665432338679998445687-67
Q gi|254780606|r  474 PKKAVMALKWAVREMEERY-RKMSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD-LM  542 (744)
Q Consensus       474 ~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~-l~  542 (744)
                      .......+..-.+++++|. +.+...+..++.+.         .+|++-...         +-.-|. +++.||=.. |-
T Consensus       101 v~fg~~~~g~~~~e~~~rv~~~L~~~~l~~~~~~~p~~LSGGqkqRvaiA~a---------L~~~P~-lliLDEPtagLD  170 (273)
T PRK13647        101 VAFGPQNLELDKKEILRRVEEALKAVDMWDLREKAPYHLSYGQKKRVAIAGV---------LAMEPD-IIVLDEPMAYLD  170 (273)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHHCCC-EEEEECCCCCCC
T ss_conf             9999988599999999999999987795876647933399989999999999---------981999-999979765799


Q ss_pred             HHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             531035899999999964201358999851654
Q gi|254780606|r  543 MVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       543 ~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .....++...|.+|.+    -|+-+|++|.+.+
T Consensus       171 p~~~~~l~~~l~~L~~----~G~Tvi~vtHdl~  199 (273)
T PRK13647        171 PRGKEELTAILNRLNN----EGKTVIVATHDVD  199 (273)
T ss_pred             HHHHHHHHHHHHHHHH----CCCEEEEEECCHH
T ss_conf             9999999999999984----8999999941789


No 158
>PRK10418 nikD nickel transporter ATP-binding protein; Provisional
Probab=95.69  E-value=0.021  Score=35.46  Aligned_cols=157  Identities=17%  Similarity=0.236  Sum_probs=71.1

Q ss_pred             CCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHH-CCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHH-
Q ss_conf             87321120----114846997078753447999999999985-680110799972342100012577520000444417-
Q gi|254780606|r  402 GESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYR-LRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPK-  475 (744)
Q Consensus       402 g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~-~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~-  475 (744)
                      +++++-|+    .+.-.+-|-|..|||||+++++++ +++.. ..+.. --+++|-+.+....+.+  +.+.-|.-++. 
T Consensus        15 ~~~vL~~Isl~v~~Ge~~aiiG~SGsGKStl~k~ll-gll~~~~~~~~-G~i~~dg~~~~~~~~r~--r~i~~v~Q~p~~   90 (254)
T PRK10418         15 AQPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAAAL-GILPAGVRQTA-GRVLADGKPVAPCALRG--RKIATIMQNPRS   90 (254)
T ss_pred             CCEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHH-CCCCCCCCEEC-CEEEECCEECCHHHHCC--CCEEEEEECCHH
T ss_conf             970886607289899999999999878999999995-79988984157-89999999996034305--508999837522


Q ss_pred             ----------HHHHHHHHH-HHHHHHH-HHHHHHCCCCCHHHHHH------------HHHHHHCCCCCCCCCCCCCCCEE
Q ss_conf             ----------876899999-9866769-99999807786799999------------88642026776665432338679
Q gi|254780606|r  476 ----------KAVMALKWA-VREMEER-YRKMSHLSVRNIKSYNE------------RISTMYGEKPQGCGDDMRPMPYI  531 (744)
Q Consensus       476 ----------~~~~~l~~~-~~em~~r-~~~~~~~~~~~i~~~n~------------~~~~~~~~~~~~~~~~~~~~p~i  531 (744)
                                .....+... ..+.+.+ .+.+...|..+...+-.            |+.-.+.-         -.-|. 
T Consensus        91 ~~~p~~~v~~~~~~~~~~~~~~~~~~~~~~~l~~vgL~~~~~~l~~~P~qLSGGq~QRvaiArAL---------~~~P~-  160 (254)
T PRK10418         91 AFNPLHTMHTHARETCLALGKPADDATLTAAIEAVGLENAARVLKLYPFEMSGGMLQRMMIALAL---------LCEAP-  160 (254)
T ss_pred             HCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHCHHHCCHHHHHHHHHHHHH---------HCCCC-
T ss_conf             13768899999999998658205999999999983999868876419263487999999999998---------54999-


Q ss_pred             EEEHHHHH-HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             99844568-767531035899999999964201358999851654
Q gi|254780606|r  532 VIIVDEMA-DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       532 vvviDE~a-~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      +++.||=- .|-.....++.+.|.+   +.+..|+-+|+.|....
T Consensus       161 lLilDEPTs~LD~~~~~~il~ll~~---l~~~~g~tii~vTHDl~  202 (254)
T PRK10418        161 FIIADEPTTDLDVVAQARILDLLES---IVQKRALGMLLVTHDMG  202 (254)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHHH---HHHHHCCEEEEEECCHH
T ss_conf             8985587543799999999999999---99970997999969999


No 159
>pfam06414 Zeta_toxin Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.
Probab=95.68  E-value=0.082  Score=31.41  Aligned_cols=34  Identities=24%  Similarity=0.502  Sum_probs=24.8

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             4699707875344799999999998568011079997234
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      =+++||..|||||.+.+.++-.+.      ...++.||+-
T Consensus        14 ai~laG~pGAGKS~~~~~~~~~~~------~~~~v~In~D   47 (191)
T pfam06414        14 AVLLGGQPGAGKTELARALLEELG------GGNVVRIDPD   47 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCC------CCCCEEECCH
T ss_conf             999957998888999999987537------8993897135


No 160
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=95.67  E-value=0.18  Score=29.07  Aligned_cols=25  Identities=28%  Similarity=0.436  Sum_probs=21.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             6997078753447999999999985
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYR  439 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~  439 (744)
                      .||+|.+|+|||.|-..++...+.+
T Consensus         2 tLi~G~pGsGKT~~a~qfl~~~a~~   26 (187)
T cd01124           2 TLLSGGPGTGKTTFALQFLYAGLAR   26 (187)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             1587689999999999999999876


No 161
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=95.66  E-value=0.046  Score=33.12  Aligned_cols=170  Identities=23%  Similarity=0.320  Sum_probs=78.4

Q ss_pred             HCCC-EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-CCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             1484-699707875344799999999998568011079997-23421000125775200004444178768999999866
Q gi|254780606|r  411 NMPH-ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-DPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREM  488 (744)
Q Consensus       411 ~~PH-~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-D~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em  488 (744)
                      ++|| +|+.|-.|.||+.+...+.-.|.-......-..... .++......+   +.++.-...|..... .....++++
T Consensus        22 ~~~halL~~Gp~G~Gktt~a~~lA~~l~~~~~~~~~~~~~~~~~~~~~~~~~---~d~lel~~s~~~~~~-i~~~~vr~~   97 (325)
T COG0470          22 RLPHALLFYGPPGVGKTTAALALAKELLCENPTGLLPCGHCRSCKLIPAGNH---PDFLELNPSDLRKID-IIVEQVREL   97 (325)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCC---CCEEEECCCCCCCCC-CHHHHHHHH
T ss_conf             8876100379999978999999999965866433455200224443202568---865997732133330-069999999


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             76999999807786799999886420267766654323386799984456876753103589999999996420135899
Q gi|254780606|r  489 EERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLI  568 (744)
Q Consensus       489 ~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihli  568 (744)
                      .+-                  .....           ..-++-||+|||.-.+..    +....+.+.-..-......++
T Consensus        98 ~~~------------------~~~~~-----------~~~~~kviiidead~mt~----~A~nallk~lEep~~~~~~il  144 (325)
T COG0470          98 AEF------------------LSESP-----------LEGGYKVVIIDEADKLTE----DAANALLKTLEEPPKNTRFIL  144 (325)
T ss_pred             HHH------------------CCCCC-----------CCCCCEEEEEECCCCCCH----HHHHHHHHHCCCCCCCEEEEE
T ss_conf             986------------------04465-----------667726999732032698----888767543324888716999


Q ss_pred             EEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHC--CCCCEEE
Q ss_conf             9851654444146788505630572036811100326763168856--8984686
Q gi|254780606|r  569 MATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLL--GRGDMLY  621 (744)
Q Consensus       569 latQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~--g~gd~l~  621 (744)
                      +| -+|+ .+++ .|+.. -.+|-|+..+....-..+-..+-+.+.  -.|||..
T Consensus       145 ~~-n~~~-~il~-tI~SR-c~~i~f~~~~~~~~i~~~e~~~l~~i~~~~~gd~r~  195 (325)
T COG0470         145 IT-NDPS-KILP-TIRSR-CQRIRFKPPSRLEAIAWLEDQGLEEIAAVAEGDARK  195 (325)
T ss_pred             EE-CCHH-HCHH-HHHHH-EEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             74-9855-5647-87756-078876774188999985075799999870406887


No 162
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion. These proteins aid the transfer of DNA from the plasmid into the host bacterial chromosome. They contain an ATP binding domain. VirD4 is involved in DNA transfer to plant cells and is required for virulence.
Probab=95.62  E-value=0.021  Score=35.51  Aligned_cols=35  Identities=43%  Similarity=0.674  Sum_probs=27.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC
Q ss_conf             46997078753447999999999985680110799972342
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM  454 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~  454 (744)
                      |+||.|.||||||+.+  +|-.|+. + ++  .++++|+|+
T Consensus         1 H~lvig~tGsGKt~~~--vip~ll~-~-~~--s~vv~D~Kg   35 (384)
T cd01126           1 HVLVFAPTRSGKGVGF--VIPNLLT-W-PG--SVVVLDPKG   35 (384)
T ss_pred             CEEEECCCCCCHHHHH--HHHHHHH-C-CC--CEEEEECCH
T ss_conf             9799889999731899--9999981-8-99--889994878


No 163
>KOG0924 consensus
Probab=95.59  E-value=0.15  Score=29.67  Aligned_cols=243  Identities=23%  Similarity=0.340  Sum_probs=123.5

Q ss_pred             CCCEEEEECCCCCCCEEEHHHHHC-CHHHCCCCCCEEEEEEECCCCC----EEEC---CH----HHCCCEEEEECCCCCH
Q ss_conf             983454426888887076587512-8121146783689842057887----3211---20----1148469970787534
Q gi|254780606|r  358 KRNAIGIELPNETRETVYLRQIIE-SRSFSHSKANLALCLGKTISGE----SVIA---DL----ANMPHILVAGTTGSGK  425 (744)
Q Consensus       358 g~~~~~~~~p~~~~~~v~~~~~~~-~~~~~~~~~~l~~~~g~~~~g~----~~~~---dl----~~~PH~lvaG~TgsGK  425 (744)
                      -.+.+|||-+|..-..|.+|.-.. ....+.+.+...++-+|++.-.    |++.   +|    .+.--++|.|.|||||
T Consensus       305 lgn~~glek~~~ed~~~~~~~~~~~a~h~k~~~a~~~fa~~k~i~eqrq~LPvf~~R~~ll~~ir~n~vvvivgETGSGK  384 (1042)
T KOG0924         305 LGNVMGLEKKNDEDGKVAYRGSVKFASHMKKSEAVSEFASKKSIREQRQYLPVFACRDQLLSVIRENQVVVIVGETGSGK  384 (1042)
T ss_pred             HCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHCCEEEEEECCCCCC
T ss_conf             31331325676533322333322454220013331001331108988750655788999999986385799993588985


Q ss_pred             HHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHH--HHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             479999999999856801107999723421000125775200004444178--768999999866769999998077867
Q gi|254780606|r  426 SVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKK--AVMALKWAVREMEERYRKMSHLSVRNI  503 (744)
Q Consensus       426 S~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~--~~~~l~~~~~em~~r~~~~~~~~~~~i  503 (744)
                      |.-|--.    ||..                  .|.+ ..  .-.+|.+..  |..+-+.+..||.-+.        ..-
T Consensus       385 TTQl~Qy----L~ed------------------GY~~-~G--mIGcTQPRRvAAiSVAkrVa~EM~~~l--------G~~  431 (1042)
T KOG0924         385 TTQLAQY----LYED------------------GYAD-NG--MIGCTQPRRVAAISVAKRVAEEMGVTL--------GDT  431 (1042)
T ss_pred             HHHHHHH----HHHC------------------CCCC-CC--EEEECCCHHHHHHHHHHHHHHHHCCCC--------CCC
T ss_conf             0166799----9862------------------2455-87--154357227899999999999858764--------531


Q ss_pred             HHHHHHHHHHHCCCCC-----------CCC--CCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEE
Q ss_conf             9999988642026776-----------665--432338679998445687675310358999999999642013589998
Q gi|254780606|r  504 KSYNERISTMYGEKPQ-----------GCG--DDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMA  570 (744)
Q Consensus       504 ~~~n~~~~~~~~~~~~-----------~~~--~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlila  570 (744)
                      .+|--|+...-....+           ...  ..|  .-|-|||+||-.+-..  ..++-.-|.++++.-|. -+.||+.
T Consensus       432 VGYsIRFEdvT~~~T~IkymTDGiLLrEsL~d~~L--~kYSviImDEAHERsl--NtDilfGllk~~larRr-dlKliVt  506 (1042)
T KOG0924         432 VGYSIRFEDVTSEDTKIKYMTDGILLRESLKDRDL--DKYSVIIMDEAHERSL--NTDILFGLLKKVLARRR-DLKLIVT  506 (1042)
T ss_pred             CCEEEEEEECCCCCEEEEEECCCHHHHHHHHHHHH--HHEEEEEECHHHHCCC--CHHHHHHHHHHHHHHHC-CCEEEEE
T ss_conf             12488852047876057874230577977633004--4401788511433030--05899999999987422-6359976


Q ss_pred             ECCCCCCCCHHHHH---------HCCCCEEEEECCCHHHCCH-HCCCCCHHHHCC-CCCEE-EECCCCCEEEEEECCCCH
Q ss_conf             51654444146788---------5056305720368111003-267631688568-98468-646898438999343898
Q gi|254780606|r  571 TQRPSVDVITGTIK---------ANFPIRISFQVTSKIDSRT-ILGEHGAEQLLG-RGDML-YMSGGGRIQRVHGPLVSD  638 (744)
Q Consensus       571 tQrp~~~vi~~~ik---------~n~~~ri~~~v~~~~dsr~-il~~~gae~l~g-~gd~l-~~~~~~~~~r~~~~~~~~  638 (744)
                      +-.-+++-+....-         --||.+|-|.-.-..|.-. .+-+.=-=+|-| .||.| |+.|-             
T Consensus       507 SATm~a~kf~nfFgn~p~f~IpGRTyPV~~~~~k~p~eDYVeaavkq~v~Ihl~~~~GdilIfmtGq-------------  573 (1042)
T KOG0924         507 SATMDAQKFSNFFGNCPQFTIPGRTYPVEIMYTKTPVEDYVEAAVKQAVQIHLSGPPGDILIFMTGQ-------------  573 (1042)
T ss_pred             ECCCCHHHHHHHHCCCCEEEECCCCCCEEEEECCCCHHHHHHHHHHHHEEEECCCCCCCEEEECCCC-------------
T ss_conf             2202489998872788601015876423777526855889999876545854468988779952787-------------


Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             8999999999840
Q gi|254780606|r  639 IEIEKVVQHLKKQ  651 (744)
Q Consensus       639 ~~~~~~~~~~~~~  651 (744)
                      ++|+..++-++..
T Consensus       574 ediE~t~~~i~~~  586 (1042)
T KOG0924         574 EDIECTCDIIKEK  586 (1042)
T ss_pred             CCHHHHHHHHHHH
T ss_conf             6326789999999


No 164
>PRK10419 nikE nickel transporter ATP-binding protein; Provisional
Probab=95.59  E-value=0.18  Score=29.04  Aligned_cols=156  Identities=15%  Similarity=0.170  Sum_probs=69.4

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC---EEC--------CCCCCCCEEEEEEEC
Q ss_conf             211201148469970787534479999999999856801107999723421---000--------125775200004444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML---ELS--------VYDGIPHLLTPVVTN  473 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~---~~~--------~~~~~ph~~~~v~~~  473 (744)
                      |-+++.+.-.+-|.|..|||||++++.| ++|. +-+..++.|--.|....   ++.        .|++-...+.|..+=
T Consensus        31 vs~~i~~GE~l~ivGeSGsGKSTL~r~i-~gl~-~p~sG~I~~~g~~l~~~~~~~~~~~rr~i~~VfQ~~~~slnP~~tv  108 (266)
T PRK10419         31 VSLTLKSGETVALLGRSGCGKSTLARLL-VGLE-SPSQGNISWRGEPLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTV  108 (266)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHHH-HCCC-CCCCEEEEECCEECCCCCHHHHHHHHCCCEEEEECCHHHCCHHHHH
T ss_conf             1758889989999999997799999999-6699-9996299889995675899999997547389973913636816489


Q ss_pred             HHHHHHHHHHH----HHHHH-HHHHHHHHCCCCC--HHHHH--------HHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH
Q ss_conf             17876899999----98667-6999999807786--79999--------9886420267766654323386799984456
Q gi|254780606|r  474 PKKAVMALKWA----VREME-ERYRKMSHLSVRN--IKSYN--------ERISTMYGEKPQGCGDDMRPMPYIVIIVDEM  538 (744)
Q Consensus       474 ~~~~~~~l~~~----~~em~-~r~~~~~~~~~~~--i~~~n--------~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~  538 (744)
                      .+.....|+..    ..+.. +-.+++...|...  ++.|-        +|+...+.         +-.-|.| +|.||-
T Consensus       109 ~~~i~epl~~~~~~~~~~~~~~~~~~L~~vgL~~~~~~~yP~eLSGGq~QRVaIArA---------L~~~P~l-Li~DEP  178 (266)
T PRK10419        109 REILREPLRHLLSLDKAERLARASEMLKAVDLDDSVLDKRPPQLSGGQLQRVCLARA---------LAVEPKL-LILDEA  178 (266)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HCCCCCE-EEEECC
T ss_conf             999999999814999999999999999874998898717843379278777898666---------4069878-999688


Q ss_pred             H-HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             8-767531035899999999964201358999851654
Q gi|254780606|r  539 A-DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       539 a-~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      - .|-.....++.+.   |...-+..|+-+|+-|...+
T Consensus       179 tsaLD~~~q~~il~l---l~~l~~~~g~t~i~ITHDl~  213 (266)
T PRK10419        179 VSNLDLVLQAGVIRL---LKKLQQQFGTACLFITHDLR  213 (266)
T ss_pred             CCCCCHHHHHHHHHH---HHHHHHHHCCEEEEECCCHH
T ss_conf             653699999999999---99999975989999889999


No 165
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=95.58  E-value=0.0051  Score=39.72  Aligned_cols=28  Identities=39%  Similarity=0.536  Sum_probs=24.1

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             4699707875344799999999998568
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLR  441 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~  441 (744)
                      -+||+|.+|+|||.|||+|+.+-++...
T Consensus         6 nimVvG~sGlGKsTfiNtLf~~~~~~~~   33 (276)
T cd01850           6 NIMVVGESGLGKSTFINTLFNTKLIPSD   33 (276)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCC
T ss_conf             9999768999889999997478577877


No 166
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=95.57  E-value=0.038  Score=33.69  Aligned_cols=163  Identities=20%  Similarity=0.273  Sum_probs=80.0

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-------CC----CCEECCCCCCCCEEEEEEEC
Q ss_conf             21120114846997078753447999999999985680110799972-------34----21000125775200004444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-------PK----MLELSVYDGIPHLLTPVVTN  473 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-------~k----~~~~~~~~~~ph~~~~v~~~  473 (744)
                      +-+++.+.--+-+-|-.|||||++|+ +|.+|.   .|+.=++.+-+       ++    +.-|-.|.-.||+-  |..+
T Consensus        23 vsl~i~~Ge~~~llGpsG~GKTTllr-~iaGl~---~p~~G~I~~~g~~v~~~~~~~R~i~~vfQ~~~L~p~lt--V~en   96 (358)
T PRK11650         23 IDLDVADGEFIVLVGPSGCGKSTLLR-MVAGLE---RITSGEIWIGGRVVNELEPADRDIAMVFQNYALYPHMS--VREN   96 (358)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCC--HHHH
T ss_conf             27798899899999998636999999-997699---98862999999999999977875767725554487874--8786


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH-HHHH
Q ss_conf             178768999999866769999-99807786799---------999886420267766654323386799984456-8767
Q gi|254780606|r  474 PKKAVMALKWAVREMEERYRK-MSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEM-ADLM  542 (744)
Q Consensus       474 ~~~~~~~l~~~~~em~~r~~~-~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~-a~l~  542 (744)
                      ........++-..++++|-.. +...+..++.+         -.+|++-.+.         +-.-|.+ ++.||= +-|-
T Consensus        97 i~~~l~~~~~~~~~~~~rv~~~l~~l~l~~~~~r~p~~LSGGq~QRvalARA---------L~~~P~v-lllDEP~s~LD  166 (358)
T PRK11650         97 MAYGLKIRGMPKAEIEERVAEAARILELEPLLDRKPRELSGGQRQRVAMGRA---------IVREPAV-FLFDEPLSNLD  166 (358)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHCCHHHCCHHHHHHHHHHHH---------HHCCCCE-EEECCCCCCCC
T ss_conf             6557876288646788999999875226242248974789567899998357---------5049986-88738877679


Q ss_pred             HHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEE
Q ss_conf             531035899999999964201358999851654444146788505630572
Q gi|254780606|r  543 MVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISF  593 (744)
Q Consensus       543 ~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~  593 (744)
                      .   +--......|.++-|..|+-.|+.|-... +++      .+.-||+.
T Consensus       167 ~---~~r~~~~~~l~~l~~~~g~T~i~vTHd~~-eA~------~laDri~v  207 (358)
T PRK11650        167 A---KLRVQMRLEIQRLHRRLGTTSLYVTHDQV-EAM------TLADRVVV  207 (358)
T ss_pred             H---HHHHHHHHHHHHHHHHHCCEEEEEECCHH-HHH------HHCCEEEE
T ss_conf             9---89999999999999975977999989999-999------86999999


No 167
>PRK08006 replicative DNA helicase; Provisional
Probab=95.57  E-value=0.14  Score=29.73  Aligned_cols=150  Identities=16%  Similarity=0.190  Sum_probs=71.5

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE--E-----CCCCCCCC--EEEEEEECHHHHHH
Q ss_conf             011484699707875344799999999998568011079997234210--0-----01257752--00004444178768
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE--L-----SVYDGIPH--LLTPVVTNPKKAVM  479 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~--~-----~~~~~~ph--~~~~v~~~~~~~~~  479 (744)
                      |...--++|||.+|+|||.|...|+...+.+.   ....+++-.-|..  +     +...+++.  +...-+++.++. .
T Consensus       221 l~~G~LiviaaRPsmGKTalalnia~~~a~~~---~~~V~~fSlEMs~~ql~~Rlla~~s~v~~~~i~~g~l~~~e~~-~  296 (471)
T PRK08006        221 LQPSDLIIVAARPSMGKTTFAMNLCENAAMLQ---DKPVLIFSLEMPGEQIMMRMLASLSRVDQTRIRTGQLDDEDWA-R  296 (471)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHC---CCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHH-H
T ss_conf             82173899994699876999999999999866---9957998167999999999999744777554536887999999-9


Q ss_pred             HHHHHHH-HHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC------HHHHHH
Q ss_conf             9999998-667699999980778679999988642026776665432338679998445687675310------358999
Q gi|254780606|r  480 ALKWAVR-EMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG------KEIEGA  552 (744)
Q Consensus       480 ~l~~~~~-em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~------~~~e~~  552 (744)
                       +..++. .|+..--.+.....-++....++.+......     .   .+  =+||||=+. ||...+      .++...
T Consensus       297 -l~~~~~~~~~~~~l~idd~~~~t~~~i~a~~r~~~~~~-----~---gl--~lvvIDYLq-L~~~~~~~~~r~~ei~~i  364 (471)
T PRK08006        297 -ISGTMGILLEKRNMYIDDSSGLTPTEVRSRARRIFREH-----G---GL--SLIMIDYLQ-LMRVPSLSDNRTLEIAEI  364 (471)
T ss_pred             -HHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHC-----C---CC--CEEEEEHHH-HCCCCCCCCCHHHHHHHH
T ss_conf             -99999999751885773689998999999999999864-----8---98--689963886-616787441066899999


Q ss_pred             HHHHHHHHHCCEEEEEEEECCC
Q ss_conf             9999996420135899985165
Q gi|254780606|r  553 IQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       553 ~~~la~~~ra~GihlilatQrp  574 (744)
                      -..|-++|+-++|.+|+.+|--
T Consensus       365 sr~lK~lAkel~ipVi~LsQLn  386 (471)
T PRK08006        365 SRSLKALAKELQVPVVALSQLN  386 (471)
T ss_pred             HHHHHHHHHHHCCCEEEECCCC
T ss_conf             9999999999699689970168


No 168
>PRK06305 DNA polymerase III subunits gamma and tau; Validated
Probab=95.57  E-value=0.15  Score=29.54  Aligned_cols=145  Identities=19%  Similarity=0.312  Sum_probs=68.6

Q ss_pred             HHCCC-EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC-EE--CCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             11484-69970787534479999999999856801107999723421-00--0125775200004444178768999999
Q gi|254780606|r  410 ANMPH-ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML-EL--SVYDGIPHLLTPVVTNPKKAVMALKWAV  485 (744)
Q Consensus       410 ~~~PH-~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~-~~--~~~~~~ph~~~~v~~~~~~~~~~l~~~~  485 (744)
                      .+.+| .|-.|.-|.||+.+-+.+..+|.-.+.-.+.     +|-+. +.  .+..+ .|.-  |+              
T Consensus        36 ~ri~HAyLF~GprGtGKTT~ArilAkaLnC~~~~~~~-----~pCg~C~~C~~I~~g-~~~D--Vi--------------   93 (462)
T PRK06305         36 NRAAHAYLFSGIRGTGKTTLARIFAKALNCQNPTEDQ-----EPCNQCAICKEISSG-TSLD--VI--------------   93 (462)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCC-----CCCCCCHHHHHHHCC-CCCC--EE--------------
T ss_conf             9976234303899859999999999996799998888-----988766888998638-9998--68--------------


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEE
Q ss_conf             86676999999807786799999886420267766654323386799984456876753103589999999996420135
Q gi|254780606|r  486 REMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGI  565 (744)
Q Consensus       486 ~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gi  565 (744)
                       |++.    -...|+.+|.+.+..+   .+....        -.|-|+||||...|...+   . .++-+.-- --...+
T Consensus        94 -EiDa----As~~gVddIRel~e~v---~~~P~~--------~~yKVyIIDEvhmLs~~A---f-NALLKtLE-EPP~~v  152 (462)
T PRK06305         94 -EIDG----ASHRGIEDIRQINETV---LFTPSK--------SQYKIYIIDEVHMLTKEA---F-NSLLKTLE-EPPQHV  152 (462)
T ss_pred             -EECC----CCCCCHHHHHHHHHHH---CCCCCC--------CCEEEEEEECHHHCCHHH---H-HHHHHHHH-CCCCCE
T ss_conf             -6435----5344668999999771---008867--------750599981521179999---9-99999861-898774


Q ss_pred             EEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHH
Q ss_conf             89998516544441467885056305720368111
Q gi|254780606|r  566 HLIMATQRPSVDVITGTIKANFPIRISFQVTSKID  600 (744)
Q Consensus       566 hlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~d  600 (744)
                      -.||||-.|. +++. .|..-.- |+-|+--+..|
T Consensus       153 ~FILaTTe~~-KIp~-TIlSRCQ-rf~F~~i~~~~  184 (462)
T PRK06305        153 KFFLATTEIH-KIPG-TILSRCQ-KMHLKRIPEET  184 (462)
T ss_pred             EEEEEECCHH-HCCH-HHHHHHH-EEECCCCCHHH
T ss_conf             9999818814-2854-7876540-23325799999


No 169
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=95.54  E-value=0.066  Score=32.08  Aligned_cols=141  Identities=18%  Similarity=0.199  Sum_probs=66.5

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE------ECCCCC-CCCEEEEEEECHHHHHHHHHHH
Q ss_conf             484699707875344799999999998568011079997234210------001257-7520000444417876899999
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE------LSVYDG-IPHLLTPVVTNPKKAVMALKWA  484 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~------~~~~~~-~ph~~~~v~~~~~~~~~~l~~~  484 (744)
                      .--.|+.|.||||||...-.+|...|....  + -|+|+=-....      |..+.+ -..++..-.++.   .....|.
T Consensus       217 ~~~~Ll~GvTGSGKTEvYl~~i~~~L~~Gk--q-vLvLVPEI~Ltpq~~~rf~~rFg~~v~vlHS~Ls~~---er~~~W~  290 (730)
T COG1198         217 FAPFLLDGVTGSGKTEVYLEAIAKVLAQGK--Q-VLVLVPEIALTPQLLARFKARFGAKVAVLHSGLSPG---ERYRVWR  290 (730)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHCCC--E-EEEEECCCCCHHHHHHHHHHHHCCCHHHHCCCCCHH---HHHHHHH
T ss_conf             665367677788589999999999997598--7-999956534569999999998678745314657927---8999999


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCE-EEEEHHHHHHHHHHCCHHHHHHHHHHHH-HHHC
Q ss_conf             9866769999998077867999998864202677666543233867-9998445687675310358999999999-6420
Q gi|254780606|r  485 VREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPY-IVIIVDEMADLMMVAGKEIEGAIQRLAQ-MARA  562 (744)
Q Consensus       485 ~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~-ivvviDE~a~l~~~~~~~~e~~~~~la~-~~ra  562 (744)
                      ..         ....++-+.+              ....-+-|++. =+|||||-.|-........--..-++|. +|+.
T Consensus       291 ~~---------~~G~~~vVIG--------------tRSAlF~Pf~~LGLIIvDEEHD~sYKq~~~prYhARdvA~~Ra~~  347 (730)
T COG1198         291 RA---------RRGEARVVIG--------------TRSALFLPFKNLGLIIVDEEHDSSYKQEDGPRYHARDVAVLRAKK  347 (730)
T ss_pred             HH---------HCCCCEEEEE--------------ECHHHCCCHHHCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             98---------5597159997--------------122330723125769970245643247777776789999999886


Q ss_pred             CEEEEEEEECCCCCCCCHH
Q ss_conf             1358999851654444146
Q gi|254780606|r  563 AGIHLIMATQRPSVDVITG  581 (744)
Q Consensus       563 ~GihlilatQrp~~~vi~~  581 (744)
                      .++-+||++=.||......
T Consensus       348 ~~~pvvLgSATPSLES~~~  366 (730)
T COG1198         348 ENAPVVLGSATPSLESYAN  366 (730)
T ss_pred             CCCCEEEECCCCCHHHHHH
T ss_conf             0998898268877899986


No 170
>pfam02456 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can interact with the adenoviral packaging signal and that this interaction involves DNA sequences that have previously been demonstrated to be required for packaging. During the course of lytic infection, the adenovirus major late promoter (MLP) is induced to high levels after replication of viral DNA has started. IVa2 is a transcriptional activator of the major late promoter.
Probab=95.54  E-value=0.0098  Score=37.74  Aligned_cols=40  Identities=28%  Similarity=0.373  Sum_probs=31.0

Q ss_pred             HHHCC-CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             01148-46997078753447999999999985680110799
Q gi|254780606|r  409 LANMP-HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       409 l~~~P-H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      ...-| -.+|.|-||+|||.+|+.+|.+=+..=.|+.|=|+
T Consensus        83 y~~qP~I~vVYGPTG~GKSQLlRNlis~~lI~P~PETVfFI  123 (370)
T pfam02456        83 YGLQPVIGVVYGPTGCGKSQLLRNLLSCQLIQPIPETVFFI  123 (370)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCEEEEE
T ss_conf             67874499998899877899999987346677999728997


No 171
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IPR013364    Proteins in this entry are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase (IPR013363 from INTERPRO) of a type-IV secretion-like system of the obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii..
Probab=95.53  E-value=0.0068  Score=38.83  Aligned_cols=70  Identities=23%  Similarity=0.310  Sum_probs=35.9

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE-ECCCCCEECCCCC-CC-CEEEEEEECHHHHHHHHH
Q ss_conf             148469970787534479999999999856801107999-7234210001257-75-200004444178768999
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM-VDPKMLELSVYDG-IP-HLLTPVVTNPKKAVMALK  482 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l-iD~k~~~~~~~~~-~p-h~~~~v~~~~~~~~~~l~  482 (744)
                      +.-=.||+|-||||||+++-+|--- +..+-||- |++= =||=..-|.--+. +| .....|=.|.+..+..|+
T Consensus       148 ~~GLGLiCG~TGSGKSTl~AaiY~~-~l~t~pdR-KivT~EDPvEY~L~~~~~~l~ap~Q~~IGRDv~sFa~Glr  220 (374)
T TIGR02525       148 KAGLGLICGETGSGKSTLAAAIYRH-CLETYPDR-KIVTYEDPVEYILGSPDDLLPAPAQSEIGRDVESFAEGLR  220 (374)
T ss_pred             CCCCEEECCCCCCCHHHHHHHHHHH-HCCCCCCC-EEEEEECCEEEECCCCCCHHCCCCCHHCCCCHHHHHHHHH
T ss_conf             0378022177897289999999998-50748897-0798657721231885201027630110687678862320


No 172
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=95.52  E-value=0.0076  Score=38.49  Aligned_cols=51  Identities=18%  Similarity=0.324  Sum_probs=30.5

Q ss_pred             CCEEECC----HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHH--EEEEEECCCCCE
Q ss_conf             8732112----011484699707875344799999999998568011--079997234210
Q gi|254780606|r  402 GESVIAD----LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDE--CRMIMVDPKMLE  456 (744)
Q Consensus       402 g~~~~~d----l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~--~~~~liD~k~~~  456 (744)
                      +.+++-|    +.+.-++.|.|.+|||||++++. |+.|   +.|+.  +.+--+|.+...
T Consensus        15 ~~~vL~~isl~i~~G~~iaIvG~sGsGKSTLl~l-l~gl---~~p~~G~I~idg~~i~~~~   71 (238)
T cd03249          15 DVPILKGLSLTIPPGKTVALVGSSGCGKSTVVSL-LERF---YDPTSGEILLDGVDIRDLN   71 (238)
T ss_pred             CCEEECCEEEEECCCCEEEEECCCCCCHHHHHHH-HHHC---CCCCCCEEEECCEECCCCC
T ss_conf             9952225589976999999999999989999999-8238---6188518999999923189


No 173
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=95.51  E-value=0.015  Score=36.58  Aligned_cols=209  Identities=20%  Similarity=0.243  Sum_probs=96.9

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE---------------------------
Q ss_conf             21120114846997078753447999999999985680110799972342100---------------------------
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL---------------------------  457 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~---------------------------  457 (744)
                      +-+++.+.=.+.|.|.+|||||++++. |.+|+ .-+...+++...|.+...-                           
T Consensus        26 vsl~I~~GE~v~IiG~nGsGKSTL~k~-l~Gll-~P~~G~V~~~g~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~lr~~v  103 (304)
T PRK13651         26 VSTEINQGEFIAIIGQTGSGKTTFIEH-LNALL-LPDTGTIEWIYFDEKNKEKKKVVEDPVIKLKFRKKLKKIKEIRRRV  103 (304)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC-CCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCE
T ss_conf             057985998999987999859999999-96699-9887169994245434554311343022134566666689877337


Q ss_pred             C-CCCCCC-CEEEE-EEECHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCHHHHHH------------HHHHHHCCCCCCC
Q ss_conf             0-125775-20000-444417876899999986676999-999807786799999------------8864202677666
Q gi|254780606|r  458 S-VYDGIP-HLLTP-VVTNPKKAVMALKWAVREMEERYR-KMSHLSVRNIKSYNE------------RISTMYGEKPQGC  521 (744)
Q Consensus       458 ~-~~~~~p-h~~~~-v~~~~~~~~~~l~~~~~em~~r~~-~~~~~~~~~i~~~n~------------~~~~~~~~~~~~~  521 (744)
                      . .|+..- +++.. |..|.......+.+-.+|+.+|-. .+...|..  ..|..            |++-...      
T Consensus       104 G~vfQ~p~~ql~~~tV~e~i~fg~~~~g~~~~e~~~rv~~~l~~vgL~--~~~~~~~p~~LSGGqkqRVaIA~~------  175 (304)
T PRK13651        104 GVVFQFAEYQLFEQTIEKDIIFGPVSMGVSKEEAKKRAAKYIELVGLP--EEFLQKSPFELSGGQKRRVALAGI------  175 (304)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCC--HHHHHCCCCCCCHHHHHHHHHHHH------
T ss_conf             999517854556505999999999984999999999999999986998--567518954289999999999998------


Q ss_pred             CCCCCCCCEEEEEHHHHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHH
Q ss_conf             5432338679998445687-675310358999999999642013589998516544441467885056305720368111
Q gi|254780606|r  522 GDDMRPMPYIVIIVDEMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKID  600 (744)
Q Consensus       522 ~~~~~~~p~ivvviDE~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~d  600 (744)
                         +.--|. +++.||=.. |--....++.+.|.+|.    .-|+-+|+.|..-+  .+     +.+-.||.+=    .+
T Consensus       176 ---La~~P~-iLlLDEPTagLDp~~~~~i~~~l~~L~----~~G~TVI~vTHdm~--~v-----~~~adRvivl----~~  236 (304)
T PRK13651        176 ---LAMEPD-FLVFDEPTAGLDPQGVKEILEIFDTLN----KKGKTIILVTHDLD--NV-----LEWTKRTIFF----KD  236 (304)
T ss_pred             ---HHCCCC-EEEECCCCCCCCHHHHHHHHHHHHHHH----HCCCEEEEECCCHH--HH-----HHHCCEEEEE----EC
T ss_conf             ---845999-999729866589899999999999999----77999999867899--99-----9979999999----89


Q ss_pred             CCHHCCCCCHHHHCCCCCEEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCCC
Q ss_conf             003267631688568984686468984389993438988999999999840887
Q gi|254780606|r  601 SRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCP  654 (744)
Q Consensus       601 sr~il~~~gae~l~g~gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~  654 (744)
                      -++|.+.. .+.++.+-+.|..           ..+.-..+-++...++.+|-+
T Consensus       237 G~Iv~~G~-p~evf~~~~~l~~-----------~~l~~P~~~~l~~~L~~~g~~  278 (304)
T PRK13651        237 GKIIKDGD-TYEILNDEKFLIE-----------NKMLPPKLLNFVNKLIKKGIP  278 (304)
T ss_pred             CEEEEECC-HHHHHCCHHHHHH-----------CCCCCCHHHHHHHHHHHCCCC
T ss_conf             98999868-8998679889987-----------799998199999999976999


No 174
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=95.50  E-value=0.032  Score=34.18  Aligned_cols=190  Identities=18%  Similarity=0.276  Sum_probs=93.2

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-------C-C---CCEECCCCCCCCEEEEEEEC
Q ss_conf             21120114846997078753447999999999985680110799972-------3-4---21000125775200004444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-------P-K---MLELSVYDGIPHLLTPVVTN  473 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-------~-k---~~~~~~~~~~ph~~~~v~~~  473 (744)
                      +-+++.+.--+-+-|-+|+|||++|+. |.+|.   .|+.=++++-+       | |   +.-|-.|.-.||+-  |..|
T Consensus        23 v~l~v~~Ge~~~llGpSG~GKtTlLr~-iaGl~---~p~~G~I~~~g~~v~~~~p~~R~ig~VfQ~~aLfPh~t--V~eN   96 (353)
T TIGR03265        23 ISLSVKKGEFVCLLGPSGCGKTTLLRI-IAGLE---RQTAGTIYQGGRDITRLPPQKRDYGIVFQSYALFPNLT--VADN   96 (353)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCC--HHHH
T ss_conf             486998999999999995359999999-97699---99873999999999999952588599978885467892--9999


Q ss_pred             HHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHHH
Q ss_conf             1787689999998667699-9999807786799---------99988642026776665432338679998445-68767
Q gi|254780606|r  474 PKKAVMALKWAVREMEERY-RKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADLM  542 (744)
Q Consensus       474 ~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l~  542 (744)
                      ........++-..|..+|. +++...+..++.+         -.+|++-.+.         +-.-|.++ ..|| |+.|-
T Consensus        97 iafgl~~~~~~~~e~~~rv~~~l~~~~l~~~~~r~p~~LSGGq~QRVAlARA---------L~~~P~vl-LlDEPlsaLD  166 (353)
T TIGR03265        97 IAYGLKNRGMGRAEVAERVAELLDLVGLPGSERKYPGQLSGGQQQRVALARA---------LATSPGLL-LLDEPLSALD  166 (353)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCCEE-EEECCCCCCC
T ss_conf             9889987699999999999999987699557656964689888799999999---------85499899-9908765359


Q ss_pred             HHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE----CCCHHHCCHHCCCCCH---HHHCC
Q ss_conf             5310358999999999642013589998516544441467885056305720----3681110032676316---88568
Q gi|254780606|r  543 MVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ----VTSKIDSRTILGEHGA---EQLLG  615 (744)
Q Consensus       543 ~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~----v~~~~dsr~il~~~ga---e~l~g  615 (744)
                      .   +--+.+...|.++-+..|+-.|+.|--.+ +++      .+.-||+.-    +.....-+.|...+.-   -.++|
T Consensus       167 ~---~lr~~l~~~l~~l~~~~~~T~i~VTHD~~-EA~------~laDri~Vm~~G~i~q~G~p~eiy~~P~~~fVA~FiG  236 (353)
T TIGR03265       167 A---RVREHLRTEIRQLQRRLGVTTIMVTHDQE-EAL------SMADRIVVMNHGVIEQVGTPQEIYRHPATPFVADFVG  236 (353)
T ss_pred             H---HHHHHHHHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEEEECCEEEEEECHHHHHHCCCCHHHHHHCC
T ss_conf             9---99999999999999986998999998989-999------8699899998999999828899986899869997469


Q ss_pred             CCCEE
Q ss_conf             98468
Q gi|254780606|r  616 RGDML  620 (744)
Q Consensus       616 ~gd~l  620 (744)
                      ...+|
T Consensus       237 ~~N~l  241 (353)
T TIGR03265       237 EVNWL  241 (353)
T ss_pred             CCEEE
T ss_conf             25378


No 175
>COG0433 HerA helicase [Replication, recombination, and repair]
Probab=95.49  E-value=0.025  Score=35.00  Aligned_cols=63  Identities=33%  Similarity=0.531  Sum_probs=47.4

Q ss_pred             EEEEEECCCC--CEEECCHHHC---CCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC
Q ss_conf             8984205788--7321120114---84699707875344799999999998568011079997234210001
Q gi|254780606|r  393 ALCLGKTISG--ESVIADLANM---PHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV  459 (744)
Q Consensus       393 ~~~~g~~~~g--~~~~~dl~~~---PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~  459 (744)
                      .+.+|.-..+  -++..|+.+.   -|++|.|+||+|||.++..++..+.-..   ...++++|+.+ +...
T Consensus       144 ~l~lg~l~~~~~~~~~~~~~~~~~~~h~~i~~~tgsgks~~~~~l~~~l~~~~---~~~~~~~d~~~-e~~~  211 (520)
T COG0433         144 GLLLGALLDGGEVPVYLDLNKLVLARHIAILGSTGSGKSNLAKVLLEELLGKD---GATVVIFDPHG-EYDL  211 (520)
T ss_pred             CEECCCCCCCCCEEEEECCCCCCHHHHHEEEEECCCCHHHHHHHHHHHHHCCC---CCEEEEECCCC-HHHH
T ss_conf             50120202677503663476320112322441026622899999999863347---87199978876-0666


No 176
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.48  E-value=0.057  Score=32.49  Aligned_cols=169  Identities=20%  Similarity=0.308  Sum_probs=82.9

Q ss_pred             CCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--C-------------
Q ss_conf             6783689842057887321120114846997078753447999999999985680110799972--3-------------
Q gi|254780606|r  388 SKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--P-------------  452 (744)
Q Consensus       388 ~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~-------------  452 (744)
                      ++..+.=-.|....=+-+-+++.+.--+-|-|.+|||||++|+ +|.+|+   .|+.=++++-+  .             
T Consensus        26 ~~e~v~K~fG~~~aL~~vsl~i~~GE~~~ivG~SGsGKSTLLr-~i~GL~---~p~~G~I~~~G~~i~~~~~~~l~~~r~  101 (269)
T cd03294          26 SKEEILKKTGQTVGVNDVSLDVREGEIFVIMGLSGSGKSTLLR-CINRLI---EPTSGKVLIDGQDIAAMSRKELRELRR  101 (269)
T ss_pred             CHHHEEEECCCEEEECCCEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCEEEEECCEECCCCCHHHHHHHHC
T ss_conf             8788588509927977747588899999999899848999999-997599---999759999999999999899988525


Q ss_pred             C--CCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHH-H--------HHHHHHHHCCCCCC
Q ss_conf             4--21000125775200004444178768999999866769-99999807786799-9--------99886420267766
Q gi|254780606|r  453 K--MLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKS-Y--------NERISTMYGEKPQG  520 (744)
Q Consensus       453 k--~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~-~--------n~~~~~~~~~~~~~  520 (744)
                      +  +.-|-.|.-.||+-  |..|.........+-..|..+| .+++...|..+... |        .+|++-.+.     
T Consensus       102 ~~igmVFQ~~aL~P~lt--V~eNV~~~L~~~~~~~~e~~~rv~e~L~~vgL~~~~~~~P~qLSGGq~QRVaIARA-----  174 (269)
T cd03294         102 KKISMVFQSFALLPHRT--VLENVAFGLEVQGVPRAEREERAAEALELVGLEGWEHKYPDELSGGMQQRVGLARA-----  174 (269)
T ss_pred             CCEEEEEECCCCCCCCC--HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHHCHHHHHHHHHHHH-----
T ss_conf             64699961575476787--99998688885289978999999999986798677756967849488889999999-----


Q ss_pred             CCCCCCCCCEEEEEHHH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             65432338679998445-68767531035899999999964201358999851654
Q gi|254780606|r  521 CGDDMRPMPYIVIIVDE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       521 ~~~~~~~~p~ivvviDE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                          +..-|.|+ +.|| ++.|--....++..   .|-++-+..|+-+|+-|-...
T Consensus       175 ----La~~P~iL-LlDEPtsaLD~~~~~~i~~---~l~~l~~~~~~T~i~VTHD~~  222 (269)
T cd03294         175 ----LAVDPDIL-LMDEAFSALDPLIRREMQD---ELLRLQAELQKTIVFITHDLD  222 (269)
T ss_pred             ----HHCCCCEE-EECCCCCCCCHHHHHHHHH---HHHHHHHHHCCEEEEECCCHH
T ss_conf             ----86399899-9758754259999999999---999999974999999999899


No 177
>PRK12337 2-phosphoglycerate kinase; Provisional
Probab=95.48  E-value=0.055  Score=32.60  Aligned_cols=281  Identities=22%  Similarity=0.267  Sum_probs=117.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEEECCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEE
Q ss_conf             88863999985999999871477632775189834544268888870765875128121146783689842057887321
Q gi|254780606|r  327 APGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVI  406 (744)
Q Consensus       327 ~~g~~~~~~~~~~~d~~~~~~~~~~~~~~~pg~~~~~~~~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~  406 (744)
                      +.|++...--.++-++-..|...++++                    |.-.+|.+ ..+    ..|-=-.|.++..+...
T Consensus       198 aaG~~P~~Ay~iA~eie~~L~~~~~~~--------------------i~~~elr~-~v~----~~L~~~~~~~~A~rY~l  252 (492)
T PRK12337        198 AAGVAPDVARKVARVTQRDLRGSGDRV--------------------VRRDEIRE-KVE----ALLRDEVGPDVSARYRL  252 (492)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHCCCEE--------------------EEHHHHHH-HHH----HHHHHHCCHHHHHHHHH
T ss_conf             805888899999999999998658879--------------------70999999-999----99987303889999999


Q ss_pred             CCHH---HCC-CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHH
Q ss_conf             1201---148-469970787534479999999999856801107999723421000125775200004444178768999
Q gi|254780606|r  407 ADLA---NMP-HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALK  482 (744)
Q Consensus       407 ~dl~---~~P-H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~  482 (744)
                      |-.-   +-| |+||+|+||-|||+    |-..|+++.                     +|.++.+   ||         
T Consensus       253 wR~ir~~~~PiiILIGGaSGvGKST----lAseLA~RL---------------------GI~~VIs---TD---------  295 (492)
T PRK12337        253 LRVLRKPPRPLHVLLGGVSGTGKSV----LAAELAYRL---------------------GITRVVP---TD---------  295 (492)
T ss_pred             HHHHHCCCCCEEEEEECCCCCCHHH----HHHHHHHHH---------------------CCCCCCC---CH---------
T ss_conf             9997356887699960788866888----999999960---------------------9881025---44---------


Q ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHC
Q ss_conf             99986676999999807786799999886420267766654323386799984456876753103589999999996420
Q gi|254780606|r  483 WAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARA  562 (744)
Q Consensus       483 ~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra  562 (744)
                       .++||-|.+---...=.=.-..|++--.-    ...+.+.  +.-|.---++.=|-+-...+..-++..+.|-.+.|.+
T Consensus       296 -sIREVMR~~is~el~P~Lh~SSy~Awk~L----~~~~~~~--~~~~~~~~vi~GF~~Qv~~V~vGl~aVieRa~~EG~S  368 (492)
T PRK12337        296 -AIREVMRAMVSKDLLPTLHASTFNAWEAL----VPPGLGL--PGEPTRVELLAGFRDQVQQVSVGLKAVVRRSILEGTS  368 (492)
T ss_pred             -HHHHHHHHHCCHHHCCHHHHHHHHHHHHC----CCCCCCC--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             -79999998459764845777556888860----8734577--7786076899899999999999999999999972886


Q ss_pred             C---EEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCC-CHHHHC--CCCCEEEECCCCCEEEEEECCC
Q ss_conf             1---358999851654444146788505630572036811100326763-168856--8984686468984389993438
Q gi|254780606|r  563 A---GIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEH-GAEQLL--GRGDMLYMSGGGRIQRVHGPLV  636 (744)
Q Consensus       563 ~---GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~-gae~l~--g~gd~l~~~~~~~~~r~~~~~~  636 (744)
                      +   |+||+.       +.|.+.. ..-++=|-|-|.-.       |+. --+.+.  +++ |-       .-|--+.|+
T Consensus       369 vVIEGVHLvP-------g~i~~~~-~e~~~vIp~mV~i~-------dEe~Hr~RF~~R~r~-t~-------~~Rp~ekYL  425 (492)
T PRK12337        369 LVLEGVHLVP-------GYLQHAY-QDGALTVPMLVALP-------DEEEHRRHFELRDRE-TA-------ASRPLHRYM  425 (492)
T ss_pred             EEEEEEEECH-------HHHHHHH-CCCCEEEEEEEEEC-------CHHHHHHHHHHHHHH-HC-------CCCCHHHHH
T ss_conf             7998333070-------6666664-15873899999847-------679999999987514-10-------368601799


Q ss_pred             C-HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHH
Q ss_conf             9-889999999998408875311112455554444566777777766038999999997498623220000010078999
Q gi|254780606|r  637 S-DIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAA  715 (744)
Q Consensus       637 ~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~s~~qr~~~~g~~ra~  715 (744)
                      . =++|..|-+|+....+-.-+. +               -+.++.|+-.++|+++|++.=.+       -|- --.|.+
T Consensus       426 k~F~eIR~IQdyLv~rAre~gVP-V---------------I~n~~ldesvd~~~evi~~r~~~-------a~~-~e~~~~  481 (492)
T PRK12337        426 RHFEEIRLMQDHLLRLAREEDVP-V---------------LDGETLDESADKAVEVVLRYVMV-------ALT-PEERGQ  481 (492)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCC-C---------------CCCCCHHHHHHHHHHHHHHHHHH-------HCC-HHHHHH
T ss_conf             97999999999999999874998-2---------------07876677999999999999998-------459-899998


Q ss_pred             HHHHHHHH
Q ss_conf             99999998
Q gi|254780606|r  716 LLVERMEQ  723 (744)
Q Consensus       716 ~~~~~~e~  723 (744)
                      +|=|.++.
T Consensus       482 ~l~~~~~~  489 (492)
T PRK12337        482 RLGEAHAA  489 (492)
T ss_pred             HHHHHHHH
T ss_conf             87677776


No 178
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=95.47  E-value=0.079  Score=31.54  Aligned_cols=41  Identities=22%  Similarity=0.242  Sum_probs=28.1

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             211201148469970787534479999999999856801107999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      +-+++.+.=.+-|.|..|||||++|+. |.+|+   .|+.=++.+
T Consensus        29 isl~i~~GE~v~ivG~sGsGKSTLl~~-i~Gl~---~p~~G~I~~   69 (228)
T PRK10584         29 VELVVKRGETIALIGESGSGKSTLLAI-LAGLD---DGSSGEVSL   69 (228)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEE
T ss_conf             388999998999999998589999999-96699---999679999


No 179
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=95.46  E-value=0.14  Score=29.85  Aligned_cols=159  Identities=14%  Similarity=0.256  Sum_probs=72.8

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE--CCC-CCE-----------EC-CCCCCCCEE
Q ss_conf             732112011484699707875344799999999998568011079997--234-210-----------00-125775200
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV--DPK-MLE-----------LS-VYDGIPHLL  467 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li--D~k-~~~-----------~~-~~~~~ph~~  467 (744)
                      +-+-+++.+.=.+-|-|.-|||||++|++ |.+|+...++..-++.+.  +.. ...           .. .|+. ..++
T Consensus        21 ~~isl~i~~GE~~~iiGpNGaGKSTLlk~-i~Gll~~d~~~~g~i~~~g~~i~~~~~~~~~~~~~r~~ig~v~Q~-~~l~   98 (262)
T PRK09984         21 HAVDLNIHHGEMVALLGPSGSGKSTLLRH-LSGLITGDKSAGSHIELLGRTVQREGRLARDIRKSRANTGYIFQQ-FNLV   98 (262)
T ss_pred             CCEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCCCCCCCCCEEEEECCEECCCCCHHHHHHHHHHCCEEEECCC-CCCC
T ss_conf             45278987998999998999609999999-975677798984179988998665763355789864576997478-7679


Q ss_pred             E--EEEECHHH--------HHHHHHHHHHHHHHH-HHHHHHCCCCCHH---------HHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             0--04444178--------768999999866769-9999980778679---------99998864202677666543233
Q gi|254780606|r  468 T--PVVTNPKK--------AVMALKWAVREMEER-YRKMSHLSVRNIK---------SYNERISTMYGEKPQGCGDDMRP  527 (744)
Q Consensus       468 ~--~v~~~~~~--------~~~~l~~~~~em~~r-~~~~~~~~~~~i~---------~~n~~~~~~~~~~~~~~~~~~~~  527 (744)
                      .  .|..+..-        ....+.|...+...| .+.+...|..+..         +-.+|+.-.+.-         -.
T Consensus        99 ~~~tV~env~~g~l~~~~~~~~~~~~~~~~~~~~~~~~L~~vgl~~~~~~~~~~LSGGqkQRv~IArAL---------~~  169 (262)
T PRK09984         99 NRLSVLENVLIGALGSTPFWRTCFSWFTREQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAIARAL---------MQ  169 (262)
T ss_pred             CCCCHHHHHHHHHHCCCCHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHH---------HC
T ss_conf             988799998546512673033330437599999999999877996565098534899999999999999---------71


Q ss_pred             CCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             867999844568767531035899999999964201358999851654
Q gi|254780606|r  528 MPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       528 ~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      -|. |++.||=..=+  .....+..+..|.++.+..|+-+|+.|...+
T Consensus       170 ~P~-iLllDEPta~L--Dp~~~~~i~~~l~~l~~~~g~Til~vtHdl~  214 (262)
T PRK09984        170 QAK-VILADEPIASL--DPESARIVMDTLRDINQNDGITVVVTLHQVD  214 (262)
T ss_pred             CCC-EEEECCCCCCC--CHHHHHHHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             999-99983886779--9999999999999999854979999888989


No 180
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.46  E-value=0.017  Score=36.08  Aligned_cols=212  Identities=18%  Similarity=0.207  Sum_probs=102.0

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC--------CCCCCCCEEEEEEECHHH
Q ss_conf             211201148469970787534479999999999856801107999723421000--------125775200004444178
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS--------VYDGIPHLLTPVVTNPKK  476 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~--------~~~~~ph~~~~v~~~~~~  476 (744)
                      +-+++.+.-.+.|.|.+|||||++++. |.+|+ .-..-++.+.-.|.+.....        .|++--+.+. -.|=.+.
T Consensus        26 isl~i~~GE~vaivG~nGsGKSTL~k~-l~Gl~-~p~~G~I~i~G~~i~~~~~~~lr~~ig~VfQ~P~~~l~-~~tV~e~  102 (279)
T PRK13635         26 VSFSVYEGEWVAIVGHNGSGKSTLAKL-LNGLL-LPEAGTITVGGMVLSEETVWDVRKQIGMVFQNPDNQFV-GTTVQDD  102 (279)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC-CCCCCEEEECCEECCCCCHHHHHHHEEEEECCHHHHCC-CCHHHHH
T ss_conf             076887998999999999659999999-97288-88896499999999857879997436688218565257-6268999


Q ss_pred             HHHHHH---HHHHHHHHHHH-HHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHH
Q ss_conf             768999---99986676999-999807786799---------99988642026776665432338679998445687675
Q gi|254780606|r  477 AVMALK---WAVREMEERYR-KMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMM  543 (744)
Q Consensus       477 ~~~~l~---~~~~em~~r~~-~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~  543 (744)
                      .+..+.   .-..++.+|.. .+...|..++.+         -.+|++-.+.         +-.-|.| ++.||=---+.
T Consensus       103 iafgl~~~g~~~~e~~~rv~~~l~~~gl~~~~~~~p~~LSGGQrQRvaIAra---------L~~~P~i-LilDEPTs~LD  172 (279)
T PRK13635        103 VAFGLENIGVPREEMVERVDQALRQVGMEDFLNREPHRLSGGQKQRVAIAGV---------LALQPDI-LILDEATSMLD  172 (279)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCCE-EEECCCCCCCC
T ss_conf             9889987799999999999999987799788617934399999999999999---------9709998-99738745489


Q ss_pred             HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEEEC
Q ss_conf             31035899999999964201358999851654444146788505630572036811100326763168856898468646
Q gi|254780606|r  544 VAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMS  623 (744)
Q Consensus       544 ~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~~~  623 (744)
                        ..-....+..|-++.+..|+-+|+.|.+.+  .    +. + .-||.+==    +-+ |+-++-.+.|+...+.|...
T Consensus       173 --~~~~~~i~~~l~~L~~~~g~TvI~itHdl~--~----~~-~-aDRiivm~----~G~-Iv~~Gtp~elf~~~~~l~~~  237 (279)
T PRK13635        173 --PQGRREVLETVRQLKEQKGITVLSITHDLD--E----AA-Q-ADRVIVMN----KGE-ILEEGTPEEIFKSGHMLQEI  237 (279)
T ss_pred             --HHHHHHHHHHHHHHHHCCCCEEEEEEECHH--H----HH-C-CCEEEEEE----CCE-EEEECCHHHHHCCHHHHHHC
T ss_conf             --899999999999999837989999976789--9----96-3-99899998----999-99986999997798899977


Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             89843899934389889999999998408875
Q gi|254780606|r  624 GGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPE  655 (744)
Q Consensus       624 ~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~  655 (744)
                      +           +.-..+-++.+.++.+|-..
T Consensus       238 ~-----------l~~P~~~~l~~~l~~~g~~~  258 (279)
T PRK13635        238 G-----------LDVPFSVKLKELLKRNGILL  258 (279)
T ss_pred             C-----------CCCCHHHHHHHHHHHCCCCC
T ss_conf             9-----------99994999999999759999


No 181
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.45  E-value=0.017  Score=36.03  Aligned_cols=208  Identities=23%  Similarity=0.356  Sum_probs=95.9

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECC--CCCEEC--------CCCCCC--CEEEE-
Q ss_conf             211201148469970787534479999999999856801107999--723--421000--------125775--20000-
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDP--KMLELS--------VYDGIP--HLLTP-  469 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~--k~~~~~--------~~~~~p--h~~~~-  469 (744)
                      +-+++.+.=.+.|-|..|||||++++. |.+|+   .|+.=++++  .|.  +...+.        .|++ |  .++.. 
T Consensus        26 isl~i~~GE~v~iiG~nGsGKSTLl~~-l~GLl---~p~~G~V~i~G~~i~~~~~~~~~~r~~iG~VfQ~-P~~~l~~~t  100 (287)
T PRK13637         26 VNIEIEDGEFVALIGHTGSGKSTLIQH-LNGLL---KPTSGKIIIDGVDITDKKVKLSDIRKKVGLVFQY-PEYQLFEET  100 (287)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEECCEECCCCCCCHHHHHHCEEEEEEC-CCCCCCCCC
T ss_conf             076987998999999999399999999-97399---8887269999999878886778887417899617-520237030


Q ss_pred             EEECHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCHHHHH------------HHHHHHHCCCCCCCCCCCCCCCEEEEEHH
Q ss_conf             4444178768999999866769999-9980778679999------------98864202677666543233867999844
Q gi|254780606|r  470 VVTNPKKAVMALKWAVREMEERYRK-MSHLSVRNIKSYN------------ERISTMYGEKPQGCGDDMRPMPYIVIIVD  536 (744)
Q Consensus       470 v~~~~~~~~~~l~~~~~em~~r~~~-~~~~~~~~i~~~n------------~~~~~~~~~~~~~~~~~~~~~p~ivvviD  536 (744)
                      |..+.......+.+-..++.+|... +...|.. ...|.            +|++-...         +.--|. +++.|
T Consensus       101 V~e~i~fg~~~~g~~~~e~~~rv~~~l~~vgL~-~~~~~~~~p~~LSGGqkQRvaiA~a---------L~~~P~-iLllD  169 (287)
T PRK13637        101 IEKDIAFGPINLGLSEEEIENRVKEAMNIVGLD-YEVYKDKSPFELSGGQKRRVAIAGV---------VAMEPK-VLILD  169 (287)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCC-HHHHHCCCHHHCCHHHHHHHHHHHH---------HHCCCC-EEEEE
T ss_conf             999998689886999999999999999766998-4887068911299889999999999---------983999-99983


Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCC
Q ss_conf             56876753103589999999996420135899985165444414678850563057203681110032676316885689
Q gi|254780606|r  537 EMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGR  616 (744)
Q Consensus       537 E~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~  616 (744)
                      |=..-+  ........+..|.++-+..|+-+|++|...+ .     + +.+--||.+=-    +-++|.+.. .+.++.+
T Consensus       170 EPTs~L--Dp~~~~~i~~~l~~L~~e~g~Tvi~vTHdl~-~-----v-~~~aDRvivl~----~G~Iv~~Gt-p~evf~~  235 (287)
T PRK13637        170 EPTAGL--DPKGRDDILEKIKALHKEYNMTIILVSHSME-D-----V-AKIADRIIVMN----KGRCELQGT-PREVFKE  235 (287)
T ss_pred             CCCCCC--CHHHHHHHHHHHHHHHHHCCCEEEEECCCHH-H-----H-HHHCCEEEEEE----CCEEEEECC-HHHHHCC
T ss_conf             886648--9999999999999999850989999957999-9-----9-99699999998----999999878-8998769


Q ss_pred             CCEEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCC
Q ss_conf             8468646898438999343898899999999984088
Q gi|254780606|r  617 GDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGC  653 (744)
Q Consensus       617 gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~  653 (744)
                      -+.|..           +-+.-..+-++...++++|-
T Consensus       236 ~~~l~~-----------~~l~~P~~~~l~~~L~~~g~  261 (287)
T PRK13637        236 VDTLES-----------IGLAVPQVTYLVRKLRKKGF  261 (287)
T ss_pred             HHHHHH-----------CCCCCCHHHHHHHHHHHCCC
T ss_conf             889987-----------69999919999999997599


No 182
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.45  E-value=0.085  Score=31.30  Aligned_cols=152  Identities=24%  Similarity=0.360  Sum_probs=73.3

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE--CCCC---CEE--------CCCCCCCCEEEEEE
Q ss_conf             2112011484699707875344799999999998568011079997--2342---100--------01257752000044
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV--DPKM---LEL--------SVYDGIPHLLTPVV  471 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li--D~k~---~~~--------~~~~~~ph~~~~v~  471 (744)
                      +-+++.+.--+-|-|..|||||++|++ |.+|+   .|+.=++++-  |...   .++        ..|++ +.|+ +-.
T Consensus        19 isl~i~~Ge~~~iiG~SGsGKSTll~~-i~gL~---~p~~G~I~~~g~~i~~~~~~~~~~~r~~ig~vfQ~-~~Lf-~~l   92 (235)
T cd03261          19 VDLDVRRGEILAIIGPSGSGKSTLLRL-IVGLL---RPDSGEVLIDGEDISGLSEAELYRLRRRMGMLFQS-GALF-DSL   92 (235)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEECCEECCCCCHHHHHHHHCCEEEEECC-CCCC-CCC
T ss_conf             064887998999999999729999999-97599---98985899999999989988999975782997049-8658-999


Q ss_pred             ECHHHHHHHHH----HHHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH
Q ss_conf             44178768999----999866769-99999807786799---------99988642026776665432338679998445
Q gi|254780606|r  472 TNPKKAVMALK----WAVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE  537 (744)
Q Consensus       472 ~~~~~~~~~l~----~~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE  537 (744)
                      |-.+.....|+    +-..++++| ..++...|..+...         -.+|++-.+.-.         .-|.| ++.||
T Consensus        93 Tv~eNv~~~l~~~~~~~~~~~~~r~~~~L~~vgL~~~~~~~p~~LSGGq~QRvaIARALv---------~~P~i-lllDE  162 (235)
T cd03261          93 TVFENVAFPLREHTRLSEEEIREIVLEKLEAVGLRGAEDLYPAELSGGMKKRVALARALA---------LDPEL-LLYDE  162 (235)
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHCCCCCCCHHHHHHHHHHHHHH---------CCCCE-EEEEC
T ss_conf             699999999999579999999999999998679925764784106999999999999985---------48998-99808


Q ss_pred             -HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             -68767531035899999999964201358999851654
Q gi|254780606|r  538 -MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       538 -~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                       ++.|--....++...|   -.+-+..|+-+|+.|-..+
T Consensus       163 Pts~LDp~~~~~i~~li---~~l~~~~g~T~i~vTHd~~  198 (235)
T cd03261         163 PTAGLDPIASGVIDDLI---RSLKKELGLTSIMVTHDLD  198 (235)
T ss_pred             CCCCCCHHHHHHHHHHH---HHHHHHHCCEEEEECCCHH
T ss_conf             86647989999999999---9999972999999898989


No 183
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=95.45  E-value=0.026  Score=34.87  Aligned_cols=58  Identities=17%  Similarity=0.265  Sum_probs=34.4

Q ss_pred             EEECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC
Q ss_conf             42057887321120----1148469970787534479999999999856801107999723421
Q gi|254780606|r  396 LGKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML  455 (744)
Q Consensus       396 ~g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~  455 (744)
                      ...+-...+++-|+    .+.-.+.|.|.+|||||++++. |++| |...--++.+--+|.+..
T Consensus        10 f~Y~~~~~~~L~~isl~i~~G~~v~ivG~sGsGKSTLl~l-l~gl-~~p~~G~I~i~g~~~~~~   71 (220)
T cd03245          10 FSYPNQEIPALDNVSLTIRAGEKVAIIGRVGSGKSTLLKL-LAGL-YKPTSGSVLLDGTDIRQL   71 (220)
T ss_pred             EEECCCCCCCEECEEEEECCCCEEEEECCCCCHHHHHHHH-HHCC-CCCCCCEEEECCEEHHHH
T ss_conf             9969899851534599987999999999999859999999-9672-547865899999995772


No 184
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=95.44  E-value=0.22  Score=28.52  Aligned_cols=53  Identities=19%  Similarity=0.293  Sum_probs=31.5

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             689842057887321120114846997078753447999999999985680110799
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      |..-.|....=+-+-+++.+.=.+-+.|..|||||++++. |+++   ..|+.=++.
T Consensus        11 ls~~yg~~~~L~~isl~i~~Gei~~liG~NGaGKSTLl~~-i~G~---~~~~~G~I~   63 (237)
T PRK11614         11 VSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGT-LCGD---PRATSGRIV   63 (237)
T ss_pred             EEEEECCEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHH-HHCC---CCCCCEEEE
T ss_conf             8999899888811278986997999987999759999999-9679---988962899


No 185
>KOG1514 consensus
Probab=95.41  E-value=0.12  Score=30.29  Aligned_cols=158  Identities=15%  Similarity=0.223  Sum_probs=73.1

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHH-HHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100012577520000444417876899999-98667699
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWA-VREMEERY  492 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~-~~em~~r~  492 (744)
                      -+-|.|+.|+||+-.++.+|-.|..-..-.++            ..|.. -|+-+-..+.+..+-..+... ..+-..+.
T Consensus       424 ~mYIsGvPGtGKT~tV~~Vm~~Lq~~s~~~e~------------p~f~y-veINgm~l~~~~~~Y~~I~~~lsg~~~~~~  490 (767)
T KOG1514         424 CMYISGVPGTGKTATVLEVMKELQTSSAQKEL------------PKFDY-VEINGLRLASPREIYEKIWEALSGERVTWD  490 (767)
T ss_pred             EEEEECCCCCCCEEHHHHHHHHHHHHHHHCCC------------CCCCE-EEECCEEECCHHHHHHHHHHHCCCCCCCHH
T ss_conf             79984699988321299999999987750578------------98607-987144615889999999997555743077


Q ss_pred             HHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEEC
Q ss_conf             99998077867999998864202677666543233867999844568767531035899999999964201358999851
Q gi|254780606|r  493 RKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQ  572 (744)
Q Consensus       493 ~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQ  572 (744)
                      .-        +...|.++..           +-++-+-+||.|||+- ++.+..++|--.|-.+--+--|-   |++-+=
T Consensus       491 ~a--------l~~L~~~f~~-----------~k~~~~~~VvLiDElD-~Lvtr~QdVlYn~fdWpt~~~sK---Lvvi~I  547 (767)
T KOG1514         491 AA--------LEALNFRFTV-----------PKPKRSTTVVLIDELD-ILVTRSQDVLYNIFDWPTLKNSK---LVVIAI  547 (767)
T ss_pred             HH--------HHHHHHHHCC-----------CCCCCCCEEEEECCHH-HHHCCCHHHHHHHHCCCCCCCCC---EEEEEE
T ss_conf             88--------9999865416-----------7878787799963578-77352098897774077678986---699995


Q ss_pred             CCCCCCCHHHHHHCCC-----CEEEEECCCHHHCCHHCCC
Q ss_conf             6544441467885056-----3057203681110032676
Q gi|254780606|r  573 RPSVDVITGTIKANFP-----IRISFQVTSKIDSRTILGE  607 (744)
Q Consensus       573 rp~~~vi~~~ik~n~~-----~ri~~~v~~~~dsr~il~~  607 (744)
                      -=+.|..-.+|-.-+.     +||+|.--+...=+.|++.
T Consensus       548 aNTmdlPEr~l~nrvsSRlg~tRi~F~pYth~qLq~Ii~~  587 (767)
T KOG1514         548 ANTMDLPERLLMNRVSSRLGLTRICFQPYTHEQLQEIISA  587 (767)
T ss_pred             CCCCCCHHHHHCCCHHHHCCCEEEECCCCCHHHHHHHHHH
T ss_conf             1656477988543112330650551377889999999998


No 186
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.41  E-value=0.12  Score=30.27  Aligned_cols=208  Identities=18%  Similarity=0.247  Sum_probs=96.3

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC------CCCEEC--------CCCCCC--CEEE
Q ss_conf             211201148469970787534479999999999856801107999723------421000--------125775--2000
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP------KMLELS--------VYDGIP--HLLT  468 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~------k~~~~~--------~~~~~p--h~~~  468 (744)
                      +-+++.+.-.+-|-|.+|||||++++. |.+|+   .|+.=++.+-|-      +..++.        .|+ .|  +++.
T Consensus        25 Isl~I~~Ge~vaiiG~nGsGKSTLl~~-l~Gll---~p~~G~V~~~~~~i~~~~~~~~~~~~~~~vG~VfQ-~p~~ql~~   99 (288)
T PRK13643         25 IDLEVKKGSYTALIGHTGSGKSTLLQH-LNGLL---QPTEGKVTVGDIVVSSTSKQKEIKPVRKKVGVVFQ-FPESQLFE   99 (288)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEECCEECCCCCHHHHHHHHHHCEEEEEE-CCCCCCCH
T ss_conf             367985998999999999479999999-97488---88885699999985687735447987751799997-77320243


Q ss_pred             EEEECHHHHHHHHHH---HHHHHHHHHH-HHHHCCCCC-HHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEE
Q ss_conf             044441787689999---9986676999-999807786-799---------99988642026776665432338679998
Q gi|254780606|r  469 PVVTNPKKAVMALKW---AVREMEERYR-KMSHLSVRN-IKS---------YNERISTMYGEKPQGCGDDMRPMPYIVII  534 (744)
Q Consensus       469 ~v~~~~~~~~~~l~~---~~~em~~r~~-~~~~~~~~~-i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvv  534 (744)
                      .  |-.+..+..++.   -..++++|.. .+...|..+ +.+         -.+|++-...         +.--|. |++
T Consensus       100 ~--tV~e~vafg~~n~g~~~~e~~~~v~~~l~~vgl~d~~~~r~p~~LSGGqkqRvaiA~a---------La~~P~-vLl  167 (288)
T PRK13643        100 E--TVLKDVAFGPQNFGIPKEKAEKIAAEKLEMVGLADEFWEKSPFELSGGQMRRVAIAGI---------LAMEPE-VLV  167 (288)
T ss_pred             H--HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHCCCCCCCHHHHHHHHHHHH---------HHCCCC-EEE
T ss_conf             3--6999999899986999899999999999975993667527976399999999999999---------974999-999


Q ss_pred             HHHHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHH
Q ss_conf             445687-6753103589999999996420135899985165444414678850563057203681110032676316885
Q gi|254780606|r  535 VDEMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQL  613 (744)
Q Consensus       535 iDE~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l  613 (744)
                      .||=.. |--....++...|.+|.    ..|+-+|+.|...+  .+     +.+-.||.+=    .+-++|.+..-.| +
T Consensus       168 LDEPTs~LDp~~~~~i~~ll~~l~----~~G~TiI~vtHd~~--~v-----~~~adrvivl----~~G~Iv~~Gtp~e-v  231 (288)
T PRK13643        168 LDEPTAGLDPKARIEMMQLFESIH----QSGQTVVLVTHLMD--DV-----ADYADYVYLL----EKGHIISCGTPSD-V  231 (288)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHHH----HCCCEEEEECCCHH--HH-----HHHCCEEEEE----ECCEEEEECCHHH-H
T ss_conf             958855589999999999999999----53999999860899--99-----9979999999----8999999878899-8


Q ss_pred             CCCCCEEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             6898468646898438999343898899999999984088753
Q gi|254780606|r  614 LGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEY  656 (744)
Q Consensus       614 ~g~gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~  656 (744)
                      +.+-+.|           +.+++.-..+-++...++..|...+
T Consensus       232 f~~~~~l-----------~~~~l~~P~~~~l~~~L~~~g~~~~  263 (288)
T PRK13643        232 FQEVDFL-----------KAHELGVPKATHFADQLQKTGAVTF  263 (288)
T ss_pred             HCCHHHH-----------HHCCCCCCHHHHHHHHHHHCCCCCC
T ss_conf             6699999-----------9769999849999999997699886


No 187
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=95.33  E-value=0.18  Score=29.05  Aligned_cols=41  Identities=15%  Similarity=0.294  Sum_probs=27.1

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             2112011484699707875344799999999998568011079
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      |-+++.+.--+-|.|-.|||||++++. |++++ +...-++.|
T Consensus        24 vs~~v~~Gei~~liGpnGaGKSTL~~~-i~Gl~-~p~~G~I~~   64 (255)
T PRK11300         24 VNLEVREQEVVSLIGPNGAGKTTVFNC-LTGFY-KPTGGTILL   64 (255)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC-CCCCEEEEE
T ss_conf             088989997999998999649999999-96798-898608999


No 188
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=95.33  E-value=0.011  Score=37.28  Aligned_cols=20  Identities=45%  Similarity=0.687  Sum_probs=18.4

Q ss_pred             CEEEEECCCCCHHHHHHHHH
Q ss_conf             46997078753447999999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMI  433 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i  433 (744)
                      |+.|+|.+|||||.|||++-
T Consensus         3 ~iaVtGesGaGKSSfINAlR   22 (197)
T cd04104           3 NIAVTGESGAGKSSFINALR   22 (197)
T ss_pred             EEEEECCCCCCHHHHHHHHH
T ss_conf             79995589986899999986


No 189
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.31  E-value=0.068  Score=31.99  Aligned_cols=40  Identities=20%  Similarity=0.446  Sum_probs=27.0

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             11201148469970787534479999999999856801107999
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      -+++.+.-.+.|.|.+|||||++++. |++++   .|+.=++.+
T Consensus        22 sl~i~~Ge~i~ivG~sGsGKSTLl~l-l~gl~---~p~~G~I~i   61 (171)
T cd03228          22 SLTIKPGEKVAIVGPSGSGKSTLLKL-LLRLY---DPTSGEILI   61 (171)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEE
T ss_conf             89985998999999999839999999-97677---589748999


No 190
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional
Probab=95.30  E-value=0.013  Score=36.86  Aligned_cols=153  Identities=22%  Similarity=0.338  Sum_probs=70.1

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC---E--------EC-CCCCCCCEEEEEEE
Q ss_conf             211201148469970787534479999999999856801107999723421---0--------00-12577520000444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML---E--------LS-VYDGIPHLLTPVVT  472 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~---~--------~~-~~~~~ph~~~~v~~  472 (744)
                      +-+++.+.-.+.|.|..|||||+++| +|.+| ++-.-.++.+--.|.+..   +        +. .|+. +|++. -.|
T Consensus        27 vsl~i~~Ge~v~i~G~nGsGKSTll~-~l~gl-~~p~~G~v~~~G~~~~~~~~~~~~~~rr~~ig~v~Q~-~~l~~-~~t  102 (648)
T PRK10535         27 ISLTIYAGEMVAIVGASGSGKSTLMN-ILGCL-DKPTSGTYRVAGQDVATLDADALAQLRREHFGFIFQR-YHLLS-HLT  102 (648)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHH-HHHCC-CCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEECCC-CCCCC-CCC
T ss_conf             69999899899999999962999999-99569-9999669999999988599899999865868998679-74379-995


Q ss_pred             CHHHHHHHHHH---HHHHHHHH-HHHHHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH
Q ss_conf             41787689999---99866769-999998077867999---------998864202677666543233867999844568
Q gi|254780606|r  473 NPKKAVMALKW---AVREMEER-YRKMSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA  539 (744)
Q Consensus       473 ~~~~~~~~l~~---~~~em~~r-~~~~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a  539 (744)
                      -.+.....+.+   -..++.+| .+++...|..+..+.         .+|+.-.+.         +-.-|. +++.||=.
T Consensus       103 v~env~~~~~~~g~~~~~~~~~~~~~l~~~gl~~~~~~~p~~LSgGq~QRvaiAra---------l~~~p~-vlllDEPT  172 (648)
T PRK10535        103 AAQNVEVPAVYAGLERKQRLERAQELLQRLGLEDRVEYQPSQLSGGQQQRVSIARA---------LMNGGQ-VILADEPT  172 (648)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHH---------HHHCCC-EEEECCCC
T ss_conf             99999989987799989999999999997799667557823389999999999999---------972898-99956885


Q ss_pred             -HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             -767531035899999999964201358999851654
Q gi|254780606|r  540 -DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       540 -~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                       .|-....+++-+.|.+|.    .-|.-+|+.|-.+.
T Consensus       173 ~~LD~~~~~~v~~ll~~l~----~~G~tii~vtHd~~  205 (648)
T PRK10535        173 GALDSHSGEEVMAILHQLR----DRGHTVIIVTHDPQ  205 (648)
T ss_pred             CCCCHHHHHHHHHHHHHHH----HCCCEEEEECCCHH
T ss_conf             5579999999999999999----77999999764869


No 191
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=95.30  E-value=0.13  Score=30.02  Aligned_cols=156  Identities=17%  Similarity=0.295  Sum_probs=71.2

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC-----EE-CCCCCCCCEEE--
Q ss_conf             887321120----1148469970787534479999999999856801107999723421-----00-01257752000--
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML-----EL-SVYDGIPHLLT--  468 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~-----~~-~~~~~~ph~~~--  468 (744)
                      .|++++-|+    .+.--+.|.|-.|+|||++|+ +|.+|+   .|+.=++. +|-+.+     +. ..|++ +.++.  
T Consensus        12 g~~~~L~dvsl~i~~Ge~~~lvGpnGaGKSTLl~-~i~Gl~---~p~~G~I~-~~G~~i~~~~~~~g~vfQ~-~~l~p~~   85 (255)
T PRK11248         12 GGKPALEDINLTLESGELLVVLGPSGCGKTTLLN-LIAGFV---PPQHGSIT-LDGKPVEGPGAERGVVFQN-EGLLPWR   85 (255)
T ss_pred             CCEEEEECEEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCCEEE-ECCCCCCCCCHHCEEEECC-CCCCCCC
T ss_conf             9998881317798699899999999846999999-997599---88997185-7996478862110699455-7547568


Q ss_pred             EEEECHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH
Q ss_conf             044441787689999998667699-9999807786799---------999886420267766654323386799984456
Q gi|254780606|r  469 PVVTNPKKAVMALKWAVREMEERY-RKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEM  538 (744)
Q Consensus       469 ~v~~~~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~  538 (744)
                      .|..+..........-..+++.+. +++...|..+...         -.+|+.-.+.-         -.-|.| ++.||=
T Consensus        86 tv~env~~~l~~~g~~~~~~~~~~~~~L~~vgL~~~~~~~p~~LSGGqkQRVaiArAL---------~~~P~i-LllDEP  155 (255)
T PRK11248         86 NVQDNVAFGLQLAGVEKMQRLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARAL---------AANPQL-LLLDEP  155 (255)
T ss_pred             CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHH---------HCCCCE-EEEECC
T ss_conf             7999999899874898789999999999976990244189334999999999999999---------729999-998088


Q ss_pred             -HHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             -8767531035899999999964201358999851654
Q gi|254780606|r  539 -ADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       539 -a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                       +-|-.....++...   |.++-+..|+-+|+.|..-+
T Consensus       156 t~~LD~~~r~~l~~l---l~~l~~~~g~Til~vTHdl~  190 (255)
T PRK11248        156 FGALDAFTREQMQEL---LLKLWQETGKQVLLITHDIE  190 (255)
T ss_pred             CCCCCHHHHHHHHHH---HHHHHHHCCCEEEEECCCHH
T ss_conf             777998999999999---99999961999999886899


No 192
>PRK06904 replicative DNA helicase; Validated
Probab=95.29  E-value=0.19  Score=28.99  Aligned_cols=148  Identities=16%  Similarity=0.194  Sum_probs=71.3

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC-------CCCCCCC--EEEE-EEECHHHHH
Q ss_conf             01148469970787534479999999999856801107999723421000-------1257752--0000-444417876
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS-------VYDGIPH--LLTP-VVTNPKKAV  478 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~-------~~~~~ph--~~~~-v~~~~~~~~  478 (744)
                      |.+.--++|||.+|+|||.|..+|....+.++.   ...+++-.-|..-.       ...+++.  +... ..++. + .
T Consensus       218 l~~g~LiViAaRPsmGKTa~alnia~n~A~~~~---~~V~~fSLEM~~~~l~~R~ls~~s~v~~~~i~~g~~l~~~-e-~  292 (472)
T PRK06904        218 LQPSDLIIVAARPSMGKTTFAMNLCENAAMASE---KPVLVFSLEMPAEQIMMRMLASLSRVDQTKIRTGQNLDQQ-D-W  292 (472)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCC---CCEEEECCCCCHHHHHHHHHHHHCCCCHHHHHCCCCCHHH-H-H
T ss_conf             875757999737987568999999999999559---9579977879999999999998649998886468856099-9-9


Q ss_pred             HHHHHHHHHHHHHHHHH-HHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC----H--HHHH
Q ss_conf             89999998667699999-980778679999988642026776665432338679998445687675310----3--5899
Q gi|254780606|r  479 MALKWAVREMEERYRKM-SHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG----K--EIEG  551 (744)
Q Consensus       479 ~~l~~~~~em~~r~~~~-~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~----~--~~e~  551 (744)
                      ..+..+..++.....++ .....-++.....+.+......     ..   +  =+||||=+. ||...+    .  ++..
T Consensus       293 ~~~~~~~~~l~~~~~l~idd~~~~t~~~i~~~~r~~~~~~-----~~---l--~~vvIDYLq-L~~~~~~~~~r~~ei~~  361 (472)
T PRK06904        293 AKISSTVGMFKQKPNLYIDDSSGLTPTELRSRARRVYREN-----GG---L--SLIMVDYLQ-LMRAPGFEDNRTLEIAE  361 (472)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHC-----CC---C--CEEEEEHHH-HCCCCCCCCCHHHHHHH
T ss_conf             9999999998468981684699999999999999999873-----89---9--789963886-60488877778899999


Q ss_pred             HHHHHHHHHHCCEEEEEEEEC
Q ss_conf             999999964201358999851
Q gi|254780606|r  552 AIQRLAQMARAAGIHLIMATQ  572 (744)
Q Consensus       552 ~~~~la~~~ra~GihlilatQ  572 (744)
                      .-..|-++|+.++|.+|+..|
T Consensus       362 isr~LK~lAkel~ipvi~LsQ  382 (472)
T PRK06904        362 ISRSLKALAKELKVPVVALSQ  382 (472)
T ss_pred             HHHHHHHHHHHHCCCEEEECC
T ss_conf             999999999997998899732


No 193
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.
Probab=95.28  E-value=0.24  Score=28.19  Aligned_cols=53  Identities=9%  Similarity=0.141  Sum_probs=41.8

Q ss_pred             CHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC
Q ss_conf             20114846997078753447999999999985680110799972342100012
Q gi|254780606|r  408 DLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY  460 (744)
Q Consensus       408 dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~  460 (744)
                      -+.|.=-.+|.|-.|.|||++|..|+.++...++-..+-+.+|+-++-|...|
T Consensus        12 pigkGQR~gI~g~~gvGKT~Ll~~i~~~~~~~~~~~~~v~~lIGER~rEv~e~   64 (249)
T cd01128          12 PIGKGQRGLIVAPPKAGKTTLLQSIANAITKNHPEVYLIVLLIDERPEEVTDM   64 (249)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEEEEECCHHHHHHH
T ss_conf             61678677887899988999999999999985898499999971657999999


No 194
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=95.28  E-value=0.18  Score=29.02  Aligned_cols=33  Identities=30%  Similarity=0.394  Sum_probs=23.4

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             3211201148469970787534479999999999
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      -|-+++.+.--+-|.|..|||||+++++| ++|+
T Consensus       342 ~vsf~i~~GE~l~lvG~sGsGKSTl~r~l-~gl~  374 (623)
T PRK10261        342 KVSFDLWPGETLSLVGESGSGKSTTGRAL-LRLV  374 (623)
T ss_pred             CCCCCCCCCCEEEEECCCCCCHHHHHHHH-HCCC
T ss_conf             34003589958999767876689999998-5664


No 195
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=95.27  E-value=0.052  Score=32.78  Aligned_cols=54  Identities=26%  Similarity=0.339  Sum_probs=32.5

Q ss_pred             CCEEECC----HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE
Q ss_conf             8732112----0114846997078753447999999999985680110799972342100
Q gi|254780606|r  402 GESVIAD----LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL  457 (744)
Q Consensus       402 g~~~~~d----l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~  457 (744)
                      ++++.-|    +.+.-.+-|-|.||||||++++. |+.+ |....-++.+--+|-+....
T Consensus       353 ~~~vL~~is~~I~~Ge~vaIVG~SGsGKSTL~~L-L~rl-y~p~~G~I~idG~di~~i~~  410 (593)
T PRK10790        353 DNLVLKNINLSVPSRNFVALVGHTGSGKSTLASL-LMGY-YPLTEGEIRLDGRPLSSLSH  410 (593)
T ss_pred             CCHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHH-HHHH-CCCCCCCCCCCCEECCCCCH
T ss_conf             9801426010448997899879998868999999-9985-56789941659932442468


No 196
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.23  E-value=0.25  Score=28.08  Aligned_cols=160  Identities=17%  Similarity=0.259  Sum_probs=79.3

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC------------CEECCCCCCCCEEEEEEE
Q ss_conf             21120114846997078753447999999999985680110799972342------------100012577520000444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM------------LELSVYDGIPHLLTPVVT  472 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~------------~~~~~~~~~ph~~~~v~~  472 (744)
                      +-+++.+.--+-|-|-+|||||++|+. |.+|   ..|+.=++++-+ |.            .-|-.|.-.||+     |
T Consensus        21 is~~v~~Ge~~~iiGpSGsGKSTll~~-i~Gl---~~p~~G~I~~~g-~~i~~~~~~~r~ig~vfQ~~~Lfp~l-----t   90 (239)
T cd03296          21 VSLDIPSGELVALLGPSGSGKTTLLRL-IAGL---ERPDSGTILFGG-EDATDVPVQERNVGFVFQHYALFRHM-----T   90 (239)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHH-HHCC---CCCCCEEEEECC-EECCCCCHHHCCEEEECCCCCCCCCC-----C
T ss_conf             386988998999999999779999999-9769---999863999999-99999996567767981782106799-----6


Q ss_pred             CHHHHHHHHHH-------HHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEH
Q ss_conf             41787689999-------99866769-99999807786799---------999886420267766654323386799984
Q gi|254780606|r  473 NPKKAVMALKW-------AVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIV  535 (744)
Q Consensus       473 ~~~~~~~~l~~-------~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvvi  535 (744)
                      -.+..+..|+.       -..|+.+| .+++...+..++..         -.+|++-.+.-         ..-|. |++.
T Consensus        91 V~eNi~~~l~~~~~~~~~~~~e~~~rv~~~l~~v~l~~~~~~~p~eLSGGq~QRVaiARAl---------~~~P~-vlll  160 (239)
T cd03296          91 VFDNVAFGLRVKPRSERPPEAEIRAKVHELLKLVQLDWLADRYPAQLSGGQRQRVALARAL---------AVEPK-VLLL  160 (239)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHH---------HCCCC-EEEE
T ss_conf             9999987997335456998999999999998654997677489666999898999999987---------64999-8997


Q ss_pred             HH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             45-687675310358999999999642013589998516544441467885056305720
Q gi|254780606|r  536 DE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       536 DE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
                      || ++.|--   ...+..+..|..+-+..||-.|+.|..+. +++      .+.-||++-
T Consensus       161 DEP~s~LD~---~~~~~i~~~l~~l~~e~~~T~i~vTHd~~-~a~------~laDri~vm  210 (239)
T cd03296         161 DEPFGALDA---KVRKELRRWLRRLHDELHVTTVFVTHDQE-EAL------EVADRVVVM  210 (239)
T ss_pred             CCCCCCCCH---HHHHHHHHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEEE
T ss_conf             388664699---99999999999999985998999988999-999------969999999


No 197
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=95.23  E-value=0.046  Score=33.16  Aligned_cols=138  Identities=20%  Similarity=0.244  Sum_probs=62.7

Q ss_pred             CCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHH
Q ss_conf             87321120----11484699707875344799999999998568011079997234210001257752000044441787
Q gi|254780606|r  402 GESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKA  477 (744)
Q Consensus       402 g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~  477 (744)
                      .++++-|+    .+.-.+-|.|.+|||||++++. |++++ ...--++.+--.|.+......+..  + +.-+--|..-.
T Consensus        14 ~~~vL~~i~l~i~~G~~vaIvG~sGsGKSTLl~l-l~gl~-~p~~G~i~i~g~~~~~~~~~~~~~--~-i~~v~Q~~~lf   88 (173)
T cd03246          14 EPPVLRNVSFSIEPGESLAIIGPSGSGKSTLARL-ILGLL-RPTSGRVRLDGADISQWDPNELGD--H-VGYLPQDDELF   88 (173)
T ss_pred             CCCCEECEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC-CCCCCEEEECCEECCCCCHHHHHC--C-EEEEECCCEEC
T ss_conf             9864547699985999999999999809999999-96666-679998999999933289989842--0-89990888367


Q ss_pred             HHHHH-H-HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             68999-9-998667699999980778679999988642026776665432338679998445687675310358999999
Q gi|254780606|r  478 VMALK-W-AVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQR  555 (744)
Q Consensus       478 ~~~l~-~-~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~  555 (744)
                      ...++ + +..-...|.. +++                 .-.         .-|. +++.||----+.   .+.+..+.+
T Consensus        89 ~~ti~eNiLSGGQkQRva-lAR-----------------al~---------~~p~-ililDEpts~LD---~~~e~~i~~  137 (173)
T cd03246          89 SGSIAENILSGGQRQRLG-LAR-----------------ALY---------GNPR-ILVLDEPNSHLD---VEGERALNQ  137 (173)
T ss_pred             CCCHHHHCCCHHHHHHHH-HHH-----------------HHH---------CCCC-EEEEECCCCCCC---HHHHHHHHH
T ss_conf             775899767699999999-999-----------------982---------7999-999968766899---899999999


Q ss_pred             HHHHHHCCEEEEEEEECCCC
Q ss_conf             99964201358999851654
Q gi|254780606|r  556 LAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       556 la~~~ra~GihlilatQrp~  575 (744)
                      +-..-+..|.-+|+.|.|++
T Consensus       138 ~l~~l~~~~~Tvi~vtH~~~  157 (173)
T cd03246         138 AIAALKAAGATRIVIAHRPE  157 (173)
T ss_pred             HHHHHHHCCCEEEEECCCHH
T ss_conf             99978648989999847999


No 198
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=95.21  E-value=0.13  Score=30.15  Aligned_cols=145  Identities=17%  Similarity=0.269  Sum_probs=83.5

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC---E-ECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHH
Q ss_conf             9970787534479999999999856801107999723421---0-00125775200004444178768999999866769
Q gi|254780606|r  416 LVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML---E-LSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEER  491 (744)
Q Consensus       416 lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~---~-~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r  491 (744)
                      ...|-||.|||+.|-=|-....+++....|-||=+|-=+.   | |..|..|-.+-..++.++++...+|.    ++.. 
T Consensus       180 alVGPTGVGKTTTiAKLAAr~~l~~g~~kVaLIT~DTYRIgAvEQLktYa~IlgvPv~vv~~~~eL~~aL~----~l~~-  254 (404)
T PRK06995        180 ALVGPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRIGGHEQLRIYGKILGVPVHAVKDAADLRLALA----ELRN-  254 (404)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHH----HHCC-
T ss_conf             98668887637589999999999838983799976875478999999999875955999599999999999----7089-


Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEE
Q ss_conf             99999807786799999886420267766654323386799984456876753103589999999996420135899985
Q gi|254780606|r  492 YRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMAT  571 (744)
Q Consensus       492 ~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlilat  571 (744)
                                                            +=+|.||=-. + ..........+..|...+...-+||+|..
T Consensus       255 --------------------------------------~dlILIDTaG-r-s~rD~~~~e~l~~l~~~~~~~~~~LVLsa  294 (404)
T PRK06995        255 --------------------------------------KHIVLIDTVG-M-SQRDRMVSEQIAMLHGAGAPVQRLLLLNA  294 (404)
T ss_pred             --------------------------------------CCEEEEECCC-C-CCCCHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             --------------------------------------9999980999-8-97688899999999735788528999779


Q ss_pred             CCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCC
Q ss_conf             16544441467885056305720368111003267
Q gi|254780606|r  572 QRPSVDVITGTIKANFPIRISFQVTSKIDSRTILG  606 (744)
Q Consensus       572 Qrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~  606 (744)
                      -.=.. .+...++.=-...+.--+-++.|--.-+|
T Consensus       295 t~~~~-dl~~i~~~f~~~~~~~~I~TKLDEt~~~G  328 (404)
T PRK06995        295 TSHGD-TLNEVVQAYRGPGLAGCILTKLDEAASLG  328 (404)
T ss_pred             CCCHH-HHHHHHHHHCCCCCCEEEEECCCCCCCHH
T ss_conf             89999-99999998446999839983040679723


No 199
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=95.20  E-value=0.034  Score=34.07  Aligned_cols=56  Identities=34%  Similarity=0.554  Sum_probs=33.0

Q ss_pred             EEECCCCCEEECCHHHCCC--EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE-EECCCCC
Q ss_conf             4205788732112011484--6997078753447999999999985680110799-9723421
Q gi|254780606|r  396 LGKTISGESVIADLANMPH--ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI-MVDPKML  455 (744)
Q Consensus       396 ~g~~~~g~~~~~dl~~~PH--~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~-liD~k~~  455 (744)
                      ||....-.-.+..+.+.||  +||+|.||||||..|.+++..+   +.++ .+++ +=||=..
T Consensus        62 LG~~~~~~~~l~~~~~~~~GlilitGptGSGKtTtl~a~l~~~---~~~~-~~i~tiEdPvE~  120 (264)
T cd01129          62 LGLKPENLEIFRKLLEKPHGIILVTGPTGSGKTTTLYSALSEL---NTPE-KNIITVEDPVEY  120 (264)
T ss_pred             HCCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCC-CEEEEEECCCCC
T ss_conf             5799999999999970899889997899997799999999864---3688-508998676314


No 200
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=95.19  E-value=0.24  Score=28.18  Aligned_cols=183  Identities=18%  Similarity=0.209  Sum_probs=80.8

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCC--HHHEEEEEECCC---CCEEC---------CCCCCCCEEEEE
Q ss_conf             2112011484699707875344799999999998568--011079997234---21000---------125775200004
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLR--PDECRMIMVDPK---MLELS---------VYDGIPHLLTPV  470 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~--p~~~~~~liD~k---~~~~~---------~~~~~ph~~~~v  470 (744)
                      |-+++.+.=-+-|.|..|||||+++++| ++|+....  -.++.|.-.|.-   .-++.         .|++--.-+.+.
T Consensus        35 Vsf~i~~GEilgivGeSGsGKSTl~~~i-~gll~~~~~~sG~I~~~G~~i~~~~~~~~~~~r~~~I~~vfQdp~~sLnP~  113 (330)
T PRK09473         35 LNFSLRAGETLGIVGESGSGKSQTAFAL-MGLLAANGRIGGSATFNGREILNLPEKELNKLRAEQISMIFQDPMTSLNPY  113 (330)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHHH-HCCCCCCCCEEEEEEECCEECCCCCHHHHHHHHCCCEEEEEECCCHHCCCC
T ss_conf             4768889989999868987799999999-768888883358999999986658999999863066799960750113841


Q ss_pred             EECHHHHHHHHHHH----H-HHHHHHHHHHHHCCCCCHHH------------HHHHHHHHHCCCCCCCCCCCCCCCEEEE
Q ss_conf             44417876899999----9-86676999999807786799------------9998864202677666543233867999
Q gi|254780606|r  471 VTNPKKAVMALKWA----V-REMEERYRKMSHLSVRNIKS------------YNERISTMYGEKPQGCGDDMRPMPYIVI  533 (744)
Q Consensus       471 ~~~~~~~~~~l~~~----~-~em~~r~~~~~~~~~~~i~~------------~n~~~~~~~~~~~~~~~~~~~~~p~ivv  533 (744)
                      .+=.+.....+...    . +..++..+++...+..+...            -.+|+...+.         +---|. ++
T Consensus       114 ~~i~~~l~e~l~~~~~~~~~~~~~~~~~lL~~v~l~~~~~~l~~yP~eLSGGq~QRV~IArA---------L~~~P~-lL  183 (330)
T PRK09473        114 MRVGEQLMEVLMLHKGMSKAEAFEESVRMLDAVKMPEARKRMKMYPHEFSGGMRQRVMIAMA---------LLCRPK-LL  183 (330)
T ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCC-EE
T ss_conf             04566555789885389989999999988887607217888734815339889999999999---------970999-99


Q ss_pred             EHHHHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEE----ECCCHHHCCHHCCCC
Q ss_conf             8445687-67531035899999999964201358999851654444146788505630572----036811100326763
Q gi|254780606|r  534 IVDEMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISF----QVTSKIDSRTILGEH  608 (744)
Q Consensus       534 viDE~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~----~v~~~~dsr~il~~~  608 (744)
                      |.||=.- |-.....++-+   -|..+-+..|+-+|+-|-..+  +    + ..+--||+.    ++-...+...|+..+
T Consensus       184 I~DEPTsaLDv~~q~~Il~---ll~~l~~e~g~til~ITHDl~--~----v-~~~~DrI~VMy~G~iVE~G~~~~i~~~P  253 (330)
T PRK09473        184 IADEPTTALDVTVQAQIMT---LLNELKREFNTAIIMITHDLG--V----V-AGICDKVLVMYAGRTMEYGNARDVFYQP  253 (330)
T ss_pred             EECCCCCCCCHHHHHHHHH---HHHHHHHHCCCCEEEECCCHH--H----H-HHHCCEEEEEECCEEEEECCHHHHHHCC
T ss_conf             9738755479999999999---999999974994799828899--9----9-9869989999898899978899997379


No 201
>KOG0735 consensus
Probab=95.19  E-value=0.0088  Score=38.07  Aligned_cols=55  Identities=20%  Similarity=0.245  Sum_probs=43.0

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCE
Q ss_conf             0114846997078753447999999999985680110799972342100012577520
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHL  466 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~  466 (744)
                      .-..+|+|+.|.-|+|||+++++++--   ...+...++.++|++.....-++.+-|+
T Consensus       428 v~~~~~Ill~G~~GsGKT~L~kal~~~---~~k~~~~hv~~v~Cs~l~~~~~e~iQk~  482 (952)
T KOG0735         428 VFRHGNILLNGPKGSGKTNLVKALFDY---YSKDLIAHVEIVSCSTLDGSSLEKIQKF  482 (952)
T ss_pred             CCCCCCEEEECCCCCCHHHHHHHHHHH---HCCCCCEEEEEEECHHCCCHHHHHHHHH
T ss_conf             334661898679987776999999987---5156506999975221042048999999


No 202
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=95.16  E-value=0.22  Score=28.45  Aligned_cols=41  Identities=27%  Similarity=0.378  Sum_probs=28.5

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             211201148469970787534479999999999856801107999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      +-+++.+.-.+-|.|..|||||+++++| ++|   ..|+.=++.+
T Consensus        24 isl~i~~Gei~~iiG~sGsGKSTLl~~i-~gl---~~p~~G~I~~   64 (257)
T PRK10619         24 VSLQANAGDVISIIGSSGSGKSTFLRCI-NFL---EKPSEGSIVV   64 (257)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHHH-HCC---CCCCCCEEEE
T ss_conf             0668879979999989998199999999-659---9999818999


No 203
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=95.14  E-value=0.11  Score=30.42  Aligned_cols=45  Identities=22%  Similarity=0.418  Sum_probs=29.0

Q ss_pred             CCCEEECC----HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             88732112----01148469970787534479999999999856801107999
Q gi|254780606|r  401 SGESVIAD----LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       401 ~g~~~~~d----l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      .+..++-|    +.+.--+-+.|..|||||++++. |++++   .|+.=++.+
T Consensus        11 g~~~~L~~vs~~v~~Gei~~liG~nGaGKSTLl~~-i~Gl~---~p~~G~I~~   59 (222)
T cd03224          11 GKSQILFGVSLTVPEGEIVALLGRNGAGKTTLLKT-IMGLL---PPRSGSIRF   59 (222)
T ss_pred             CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEEE
T ss_conf             99999814089988998999999999859999999-97798---899609999


No 204
>PRK09751 putative ATP-dependent helicase Lhr; Provisional
Probab=95.14  E-value=0.15  Score=29.71  Aligned_cols=50  Identities=10%  Similarity=0.164  Sum_probs=45.1

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCH
Q ss_conf             76603899999999749862322000001007899999999998797570
Q gi|254780606|r  680 ERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSE  729 (744)
Q Consensus       680 ~~~~~~~~~~~~~~~~~~~s~s~~qr~~~~g~~ra~~~~~~~e~~g~~~~  729 (744)
                      ..|+|-+-..++...++-.++.-+..+|.+|-..+...++.|+.+|.|-.
T Consensus       972 ~~d~l~~lv~r~art~GPft~~~~a~~~gl~~~~~~~aL~~L~~~G~v~~ 1021 (1490)
T PRK09751        972 VSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1021 (1490)
T ss_pred             CCHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEC
T ss_conf             51589999999987169866999998868988999999999996697752


No 205
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=95.13  E-value=0.051  Score=32.82  Aligned_cols=68  Identities=24%  Similarity=0.393  Sum_probs=47.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC---C-EECCCCCCCCEEEEEEECHHHHHHHHH
Q ss_conf             6997078753447999999999985680110799972342---1-000125775200004444178768999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM---L-ELSVYDGIPHLLTPVVTNPKKAVMALK  482 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~---~-~~~~~~~~ph~~~~v~~~~~~~~~~l~  482 (744)
                      +.+.|-||.|||+.|-=|-..+.+++....|-|+=+|-=+   + -|..|..+-.+-..++.++.+...+|.
T Consensus       197 i~lvGPTGVGKTTTiAKLAa~~~l~~~~~~V~lIT~DtyRigA~eQLk~ya~il~vp~~vv~~~~~l~~~l~  268 (282)
T TIGR03499       197 IALVGPTGVGKTTTLAKLAARFVLEHGKKKVALITTDTYRIGAVEQLKTYAKILGVPVKVARDPKELAKALE  268 (282)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCEEEEECCHHHHHHHHH
T ss_conf             999778887578899999999999738996799980777678999999999995974899399999999998


No 206
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]
Probab=95.13  E-value=0.047  Score=33.07  Aligned_cols=19  Identities=16%  Similarity=0.424  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHCCEEEEEE
Q ss_conf             9999999964201358999
Q gi|254780606|r  551 GAIQRLAQMARAAGIHLIM  569 (744)
Q Consensus       551 ~~~~~la~~~ra~Gihlil  569 (744)
                      +.|..|.++||---|-+++
T Consensus      4511 dsi~kllrra~e~kvmivf 4529 (4600)
T COG5271        4511 DSIRKLLRRAQEEKVMIVF 4529 (4600)
T ss_pred             HHHHHHHHHHHHCCEEEEE
T ss_conf             8999999986546459999


No 207
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=95.13  E-value=0.074  Score=31.73  Aligned_cols=32  Identities=31%  Similarity=0.413  Sum_probs=23.9

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             211201148469970787534479999999999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      +-+++.+.-.+.|.|.+|||||++++. |++++
T Consensus        27 isl~i~~Ge~v~ivG~sGsGKSTLl~l-l~g~~   58 (207)
T cd03369          27 VSFKVKAGEKIGIVGRTGAGKSTLILA-LFRFL   58 (207)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHH-HHHHC
T ss_conf             588986999999999999879999999-99872


No 208
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=95.12  E-value=0.038  Score=33.69  Aligned_cols=153  Identities=17%  Similarity=0.265  Sum_probs=73.3

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC------------EECCCCCCCCEEEEE
Q ss_conf             73211201148469970787534479999999999856801107999723421------------000125775200004
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML------------ELSVYDGIPHLLTPV  470 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~------------~~~~~~~~ph~~~~v  470 (744)
                      +-+-+++.+.--+.+-|-.|+|||++|+. |.+|.   .|+.=.+ ++|-+.+            -|-.|.-.||+-  |
T Consensus        20 ~~vsl~i~~Ge~~~llGpsG~GKSTllr~-i~Gl~---~p~~G~I-~i~g~~v~~~~~~~r~ig~vfQ~~~L~p~lt--V   92 (369)
T PRK11000         20 KDINLDIHEGEFVVFVGPSGCGKSTLLRM-IAGLE---DITSGDL-FIGEKRMNDVPPAERGVGMVFQSYALYPHLS--V   92 (369)
T ss_pred             CCCEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEE-EECCEECCCCCHHHCCEEEEECCCCCCCCCC--H
T ss_conf             64388987998999999997369999999-97799---9995499-9999999879977878699940785478989--9


Q ss_pred             EECHHHHHHHHHHHHHHHHHHHHHH-HHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HH
Q ss_conf             4441787689999998667699999-9807786799---------99988642026776665432338679998445-68
Q gi|254780606|r  471 VTNPKKAVMALKWAVREMEERYRKM-SHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MA  539 (744)
Q Consensus       471 ~~~~~~~~~~l~~~~~em~~r~~~~-~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a  539 (744)
                      ..+..........-..++.+|...+ ...+..++.+         -.+|++-.+.-         -.-|.| ++.|| ++
T Consensus        93 ~eNi~~~l~~~~~~~~e~~~rv~~~l~~~~l~~~~~r~p~~LSGGq~QRvaiARAL---------~~~P~i-lllDEP~s  162 (369)
T PRK11000         93 AENMSFGLKLAGAKKEEINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTL---------VAEPSV-FLLDEPLS  162 (369)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCHHHHHCCHHHCCHHHHHHHHHHHHH---------HCCCCE-EEECCCCC
T ss_conf             99997788763898899999999999863745355588746694277999999886---------259985-88436667


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             767531035899999999964201358999851654
Q gi|254780606|r  540 DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       540 ~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .|-.....+   ....|.++-+..|+-.|+.|-...
T Consensus       163 ~LD~~~r~~---~~~~l~~l~~~~g~T~i~vTHD~~  195 (369)
T PRK11000        163 NLDAALRVQ---MRIEISRLHKRLGRTMIYVTHDQV  195 (369)
T ss_pred             CCCHHHEEH---HHHHHHHHHHHHCCEEEEEECCHH
T ss_conf             888666524---789999999986985999908999


No 209
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.09  E-value=0.22  Score=28.53  Aligned_cols=207  Identities=16%  Similarity=0.170  Sum_probs=97.9

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC-------CCEE--------CCCCCCC-CEEEEE
Q ss_conf             12011484699707875344799999999998568011079997234-------2100--------0125775-200004
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK-------MLEL--------SVYDGIP-HLLTPV  470 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k-------~~~~--------~~~~~~p-h~~~~v  470 (744)
                      +++.+.=-+.|-|.+|||||++++. |.+|+   .|+.=++++-|..       ..++        ..|+.-. +++...
T Consensus        32 l~i~~Ge~~aIiG~nGsGKSTL~~~-l~Gll---~p~~G~v~~~~~~i~~~~~~~~~~~~~r~~vG~vfQ~P~~qlf~~t  107 (289)
T PRK13645         32 LTFKKNKVTCVIGTTGSGKSTMIQL-TNGLI---ISETGQTIVGDYAIPANLKKIKEVKRLRKEIGLVFQFPEYQLFQET  107 (289)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEECCEECCCCCCCHHHHHHHHCCEEEEEECCCCCCCHHH
T ss_conf             8988998999999999579999999-96598---8999859999998347653155789976367999667764626637


Q ss_pred             E-ECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHHHH------------HHHHHHHCCCCCCCCCCCCCCCEEEEEHH
Q ss_conf             4-44178768999999866769-9999980778679999------------98864202677666543233867999844
Q gi|254780606|r  471 V-TNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKSYN------------ERISTMYGEKPQGCGDDMRPMPYIVIIVD  536 (744)
Q Consensus       471 ~-~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~~n------------~~~~~~~~~~~~~~~~~~~~~p~ivvviD  536 (744)
                      + .|.......+..-..|+.+| .+.+...+..  ..|-            +|++-...         +.--|.| ++.|
T Consensus       108 V~~~iafg~~n~g~~~~e~~~rv~~~l~~v~L~--~~~~~~~p~~LSGGqkqRVaiA~a---------La~~P~i-LilD  175 (289)
T PRK13645        108 IEKDIAFGPVNLGENKQEAYKKVPELLKLVQLP--EDYVKRSPFELSGGQKRRVALAGI---------IAMDGNT-LVLD  175 (289)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCC--HHHHCCCCCCCCHHHHHHHHHHHH---------HHCCCCE-EEEE
T ss_conf             999998679876999999999999999876998--667418901099999999999999---------9639999-9995


Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCC
Q ss_conf             56876753103589999999996420135899985165444414678850563057203681110032676316885689
Q gi|254780606|r  537 EMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGR  616 (744)
Q Consensus       537 E~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~  616 (744)
                      |=..-+.  ....+..+.-|-++.+..|+-+|+.|...+  .+     +++--||..-    .+-++|.+ +-.+.++.+
T Consensus       176 EPTagLD--p~~~~~i~~ll~~L~~~~g~Tvi~vtHdm~--~v-----~~~aDrviVm----~~G~iv~~-G~p~evf~~  241 (289)
T PRK13645        176 EPTGGLD--PKGEEDFINLFERLNKEYKKRIIMVTHNMD--QV-----LRIADEVIVM----HEGKVISI-GSPFEIFSN  241 (289)
T ss_pred             CCCCCCC--HHHHHHHHHHHHHHHHHCCCEEEEECCCHH--HH-----HHHCCEEEEE----ECCEEEEE-CCHHHHHCC
T ss_conf             8876489--899999999999999956999999915999--99-----9979999999----89989998-788998679


Q ss_pred             CCEEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCCC
Q ss_conf             84686468984389993438988999999999840887
Q gi|254780606|r  617 GDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCP  654 (744)
Q Consensus       617 gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~  654 (744)
                      -|+|-..+           +.-..+.++...++..|-.
T Consensus       242 ~~~l~~~~-----------l~~P~~~~l~~~L~~~g~~  268 (289)
T PRK13645        242 QELLTKIE-----------IDPPKLYQLMYKLKNKGID  268 (289)
T ss_pred             HHHHHHCC-----------CCCCHHHHHHHHHHHCCCC
T ss_conf             99999779-----------9998599999999976998


No 210
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=95.08  E-value=0.068  Score=31.98  Aligned_cols=68  Identities=25%  Similarity=0.394  Sum_probs=49.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC---CE-ECCCCCCCCEEEEEEECHHHHHHHHH
Q ss_conf             6997078753447999999999985680110799972342---10-00125775200004444178768999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM---LE-LSVYDGIPHLLTPVVTNPKKAVMALK  482 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~---~~-~~~~~~~ph~~~~v~~~~~~~~~~l~  482 (744)
                      +.+.|-||+|||+.|-=|-....+++....|-||=+|.=+   +| |..|..+-.+=..++.++.+...+|.
T Consensus       213 valVGPTGVGKTTTiAKLAA~~~l~~~~~kV~lIT~DtyRigA~eQLk~Ya~ilgvp~~v~~~~~~l~~al~  284 (412)
T PRK05703        213 VALVGPTGVGKTTTLAKLAARYALEEGKDKVALITLDTYRIGAVEQLKTYAKIMGIPVKVAYDPKELAKALE  284 (412)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHH
T ss_conf             999888887567699999999999729981799983767777999999999971973798479999999998


No 211
>PRK06526 transposase; Provisional
Probab=95.08  E-value=0.28  Score=27.79  Aligned_cols=27  Identities=15%  Similarity=0.219  Sum_probs=21.3

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             484699707875344799999999998
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLY  438 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~  438 (744)
                      .=++++.|.||.|||-+-.++-...+.
T Consensus        98 ~~Nvil~G~~GtGKThLA~Alg~~A~~  124 (254)
T PRK06526         98 KENVVFLGPPGTGKTHLAIGLGIRACQ  124 (254)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             887899899998689999999999998


No 212
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.06  E-value=0.17  Score=29.17  Aligned_cols=45  Identities=24%  Similarity=0.356  Sum_probs=30.2

Q ss_pred             EEEEEEECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             689842057887321120----1148469970787534479999999999
Q gi|254780606|r  392 LALCLGKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      |....|+.-...+++-|+    .+.-.+.+-|..|||||++|+.| ++++
T Consensus         9 ls~~y~~~~~~~~vL~~is~~i~~Gei~~llG~nGsGKSTLl~~l-~G~~   57 (202)
T cd03233           9 ISFTTGKGRSKIPILKDFSGVVKPGEMVLVLGRPGSGCSTLLKAL-ANRT   57 (202)
T ss_pred             EEEEECCCCCEEEEEECEEEEECCCEEEEEECCCCCCHHHHHHHH-HCCC
T ss_conf             699978998268999770889809849999989999889999998-3787


No 213
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.05  E-value=0.036  Score=33.91  Aligned_cols=207  Identities=18%  Similarity=0.311  Sum_probs=96.0

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC-------------CCCCCCC-EEEE-
Q ss_conf             211201148469970787534479999999999856801107999723421000-------------1257752-0000-
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS-------------VYDGIPH-LLTP-  469 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~-------------~~~~~ph-~~~~-  469 (744)
                      +-+++.+.=.+.|-|.+|||||++++. |.+|+   .|+.=++ ++|-+.+++.             .|+..-+ ++.. 
T Consensus        25 isl~I~~Ge~~aiiG~NGaGKSTLl~~-i~Gll---~p~~G~I-~~~G~~i~~~~~~~~~~r~~ig~vfQ~p~~~l~~~t   99 (285)
T PRK13636         25 ININIKKGEVTAILGGNGAGKSTLFQN-LNGIL---KPSSGRI-LFDGKPIDYSRKGLMKLRESVGMVFQDPDNQLFSAS   99 (285)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEE-EECCEECCCCHHHHHHHHHHEEEEEECCCCCCCCCC
T ss_conf             378987998999999999809999999-96598---8886089-999999874434499998740699707642447574


Q ss_pred             EEECHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH
Q ss_conf             444417876899999986676999-999807786799---------9998864202677666543233867999844568
Q gi|254780606|r  470 VVTNPKKAVMALKWAVREMEERYR-KMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA  539 (744)
Q Consensus       470 v~~~~~~~~~~l~~~~~em~~r~~-~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a  539 (744)
                      |..+.......+..-..|+.+|.. .+...|..++..         -.+|+.-...         +..-|. +++.||=.
T Consensus       100 V~e~v~~g~~~~g~~~~e~~~rv~~~L~~~gl~~~~~~~~~~LSGGqkqRvaIA~a---------La~~P~-iLlLDEPT  169 (285)
T PRK13636        100 VYQDVSFGAVNLKLPEDEVRKRVDNALKRTGIEHLKDKPTHCLSFGQKKRVAIAGV---------LVMEPK-VLVLDEPT  169 (285)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHH---------HHCCCC-EEEEECCC
T ss_conf             99999999998599999999999999987598866528800199999999999999---------974998-99997875


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCE
Q ss_conf             76753103589999999996420135899985165444414678850563057203681110032676316885689846
Q gi|254780606|r  540 DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDM  619 (744)
Q Consensus       540 ~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~  619 (744)
                      .-+.  .......+..|.++.+..|+-+|+.|...+  .+     +.+--||.+=-    +.++|.+.. .+.++.+-|+
T Consensus       170 agLD--p~~~~~i~~ll~~l~~e~g~TiilvtHd~~--~v-----~~~aDrvivl~----~G~iv~~G~-p~evf~~~~~  235 (285)
T PRK13636        170 AGLD--PMGVSEIMKLLVEMQKELGLTIIIATHDID--IV-----PLYCDNVFVMK----EGRVILQGN-PKEVFAEKEM  235 (285)
T ss_pred             CCCC--HHHHHHHHHHHHHHHHHCCCEEEEECCCHH--HH-----HHHCCEEEEEE----CCEEEEECC-HHHHHCCHHH
T ss_conf             5599--999999999999999844989999948899--99-----99699999998----998999869-9999669999


Q ss_pred             EEECCCCCEEEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             86468984389993438988999999999840
Q gi|254780606|r  620 LYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQ  651 (744)
Q Consensus       620 l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~  651 (744)
                      |...+=           .-..+-+++..++..
T Consensus       236 l~~~~l-----------~~P~~~~l~~~L~~~  256 (285)
T PRK13636        236 LRKVNL-----------RLPRIGHLMEILKEK  256 (285)
T ss_pred             HHHCCC-----------CCCCHHHHHHHHHHH
T ss_conf             997799-----------999699999999883


No 214
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=95.05  E-value=0.11  Score=30.62  Aligned_cols=139  Identities=22%  Similarity=0.294  Sum_probs=67.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE-----EECCC-C-----------CEECCCCCCCCEEEEEEECHHHH
Q ss_conf             6997078753447999999999985680110799-----97234-2-----------10001257752000044441787
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI-----MVDPK-M-----------LELSVYDGIPHLLTPVVTNPKKA  477 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~-----liD~k-~-----------~~~~~~~~~ph~~~~v~~~~~~~  477 (744)
                      .-+.|-.|||||.||| ||.+|+   .||+=++.     |+|-. +           .-|-.++-+||+-  |-.|....
T Consensus        27 TAlFG~SGsGKTslin-~IaGL~---rPdeG~I~lngr~L~Ds~k~i~lp~~~RriGYVFQDARLFpH~t--VrgNL~YG  100 (352)
T COG4148          27 TALFGPSGSGKTSLIN-MIAGLT---RPDEGRIELNGRVLVDAEKGIFLPPEKRRIGYVFQDARLFPHYT--VRGNLRYG  100 (352)
T ss_pred             EEEECCCCCCHHHHHH-HHHCCC---CCCCCEEEECCEEEECCCCCCCCCHHHHEEEEEEECCCCCCCEE--EECCHHHH
T ss_conf             9996478887161898-974347---76661899898886515667446754611356740020166517--73220010


Q ss_pred             HHHHHHHHHHHHHHHH------HHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHH
Q ss_conf             6899999986676999------9998077867999998864202677666543233867999844568767531035899
Q gi|254780606|r  478 VMALKWAVREMEERYR------KMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEG  551 (744)
Q Consensus       478 ~~~l~~~~~em~~r~~------~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~  551 (744)
                      ...-  ...++++--.      ++.++-.+--.+-.+|++..+.         +---|.|+..-.-||-|-+.-+.|+--
T Consensus       101 ~~~~--~~~~fd~iv~lLGI~hLL~R~P~~LSGGEkQRVAIGRA---------LLt~P~LLLmDEPLaSLD~~RK~Eilp  169 (352)
T COG4148         101 MWKS--MRAQFDQLVALLGIEHLLDRYPGTLSGGEKQRVAIGRA---------LLTAPELLLMDEPLASLDLPRKREILP  169 (352)
T ss_pred             CCCC--CHHHHHHHHHHHCCHHHHHCCCCCCCCCHHHHHHHHHH---------HHCCCCEEEECCCHHHCCCCHHHHHHH
T ss_conf             1435--36779999998484867850877567615567778888---------754977343068403236510467789


Q ss_pred             HHHHHHHHHHCCEEEEEEEECC
Q ss_conf             9999999642013589998516
Q gi|254780606|r  552 AIQRLAQMARAAGIHLIMATQR  573 (744)
Q Consensus       552 ~~~~la~~~ra~GihlilatQr  573 (744)
                      ++.||.+.   .-|-++.-|-.
T Consensus       170 ylERL~~e---~~IPIlYVSHS  188 (352)
T COG4148         170 YLERLRDE---INIPILYVSHS  188 (352)
T ss_pred             HHHHHHHH---CCCCEEEEECC
T ss_conf             99998762---18878999368


No 215
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=95.04  E-value=0.24  Score=28.27  Aligned_cols=155  Identities=19%  Similarity=0.296  Sum_probs=81.0

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHH--
Q ss_conf             732112011484699707875344799999999998568011079997234210001257752000044441787689--
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMA--  480 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~--  480 (744)
                      ++|-+-|.+.--+-|.|.-|||||.+.+ ||.+++   .|.. -=++++-.-..|..|.....+.--+.-|+..+..-  
T Consensus        30 ~~vSFtL~~~QTlaiIG~NGSGKSTLak-MlaGmi---~PTs-G~il~n~~~L~~~Dy~~R~k~IRMiFQDpnts~NPRl  104 (267)
T COG4167          30 KPVSFTLREGQTLAIIGENGSGKSTLAK-MLAGMI---EPTS-GEILINDHPLHFGDYSFRSKRIRMIFQDPNTSLNPRL  104 (267)
T ss_pred             CCEEEEECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCC-CEEEECCCCCCCCCHHHHHHHEEEEECCCCCCCCCHH
T ss_conf             4157896079679998269974758999-983555---8988-5487888413123467664444345418865568022


Q ss_pred             -----HH---HHHH------HHHHHHHHHHHCCCC-CHHHHH---------HHHHHHHCCCCCCCCCCCCCCCEEEEEHH
Q ss_conf             -----99---9998------667699999980778-679999---------98864202677666543233867999844
Q gi|254780606|r  481 -----LK---WAVR------EMEERYRKMSHLSVR-NIKSYN---------ERISTMYGEKPQGCGDDMRPMPYIVIIVD  536 (744)
Q Consensus       481 -----l~---~~~~------em~~r~~~~~~~~~~-~i~~~n---------~~~~~~~~~~~~~~~~~~~~~p~ivvviD  536 (744)
                           |+   .++.      .|++-|..+...|.- +-..|+         +|++-.+.-         ---|.|+|+-|
T Consensus       105 ~iGqiLd~PL~l~T~~~~~~R~~~i~~TL~~VGL~Pdhan~~~~~la~~QKQRVaLARAL---------IL~P~iIIaDe  175 (267)
T COG4167         105 RIGQILDFPLRLNTDLEPEQRRKQIFETLRMVGLLPDHANYYPHMLAPGQKQRVALARAL---------ILRPKIIIADE  175 (267)
T ss_pred             HHHHHHCCHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCHHHHHHHHHHHH---------HCCCCEEEEHH
T ss_conf             144563453340356883888999999999865576302345554061157789999987---------55973797354


Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCC
Q ss_conf             56876753103589999999996420135899985165
Q gi|254780606|r  537 EMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       537 E~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp  574 (744)
                      -++.|-|.....+-.++..|-   -..||-.|.-+|.-
T Consensus       176 Al~~LD~smrsQl~NL~LeLQ---ek~GiSyiYV~Qhl  210 (267)
T COG4167         176 ALASLDMSMRSQLINLMLELQ---EKQGISYIYVTQHI  210 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH---HHHCCEEEEEECHH
T ss_conf             340000899999999999999---97295399981202


No 216
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=95.04  E-value=0.031  Score=34.35  Aligned_cols=154  Identities=19%  Similarity=0.342  Sum_probs=77.2

Q ss_pred             CCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--C------C---CCEECCCCCCCCE
Q ss_conf             87321120----114846997078753447999999999985680110799972--3------4---2100012577520
Q gi|254780606|r  402 GESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--P------K---MLELSVYDGIPHL  466 (744)
Q Consensus       402 g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~------k---~~~~~~~~~~ph~  466 (744)
                      +..++-|+    .+.--+-+-|-.|||||++|+ ||.++-   .|+.=++.+-+  -      |   +.-|-.|.-.||+
T Consensus        17 ~~~al~~isl~i~~Gef~tlLGPSGcGKTTlLR-~IAGfe---~p~~G~I~l~g~~i~~lpp~kR~ig~VFQ~YALFPHm   92 (352)
T COG3842          17 DFTAVDDISLDIKKGEFVTLLGPSGCGKTTLLR-MIAGFE---QPSSGEILLDGEDITDVPPEKRPIGMVFQSYALFPHM   92 (352)
T ss_pred             CEEEEECCEEEECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCCCEEEECCEECCCCCHHHCCCCEEECCCCCCCCC
T ss_conf             726773214454488689998998888899999-996777---8888659999999888994226523260676668888


Q ss_pred             EEEEEECHHHHHHHHHH--HHHHHHHHHHHH-HH-----CCCCCHH----HHHHHHHHHHCCCCCCCCCCCCCCCEEEEE
Q ss_conf             00044441787689999--998667699999-98-----0778679----999988642026776665432338679998
Q gi|254780606|r  467 LTPVVTNPKKAVMALKW--AVREMEERYRKM-SH-----LSVRNIK----SYNERISTMYGEKPQGCGDDMRPMPYIVII  534 (744)
Q Consensus       467 ~~~v~~~~~~~~~~l~~--~~~em~~r~~~~-~~-----~~~~~i~----~~n~~~~~~~~~~~~~~~~~~~~~p~ivvv  534 (744)
                      -  |..|...... +++  ...|..+|...+ +.     +.-|...    +=++|++-.+.         +..-|.+ +.
T Consensus        93 t--V~~NVafGLk-~~~~~~~~ei~~rV~e~L~lV~L~~~~~R~p~qLSGGQqQRVALARA---------L~~~P~v-LL  159 (352)
T COG3842          93 T--VEENVAFGLK-VRKKLKKAEIKARVEEALELVGLEGFADRKPHQLSGGQQQRVALARA---------LVPEPKV-LL  159 (352)
T ss_pred             C--HHHHHHHHHH-HCCCCCHHHHHHHHHHHHHHCCCHHHHHHCHHHHCHHHHHHHHHHHH---------HHCCCCH-HH
T ss_conf             5--8997553331-05778778999999999987485444442766648278999999997---------4218354-43


Q ss_pred             HHH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             445-68767531035899999999964201358999851654
Q gi|254780606|r  535 VDE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       535 iDE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .|| |..|-.   +--+.+-..|-++-+.+||-.|+-|.-..
T Consensus       160 LDEPlSaLD~---kLR~~mr~Elk~lq~~~giT~i~VTHDqe  198 (352)
T COG3842         160 LDEPLSALDA---KLREQMRKELKELQRELGITFVYVTHDQE  198 (352)
T ss_pred             HCCCCCCHHH---HHHHHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             4274002318---99999999999999855972999978989


No 217
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=95.02  E-value=0.15  Score=29.63  Aligned_cols=153  Identities=16%  Similarity=0.316  Sum_probs=75.9

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC------------------CEECCCCCCC
Q ss_conf             7321120114846997078753447999999999985680110799972342------------------1000125775
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM------------------LELSVYDGIP  464 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~------------------~~~~~~~~~p  464 (744)
                      +-|-+++.+.--+-|-|-+|||||++|+. |..|+   .|+.=++++ |-+.                  .-|-.|.-.|
T Consensus        45 ~dVsl~I~~GEi~~ivG~SGsGKSTLlr~-i~gL~---~Pt~G~I~i-~G~di~~~~~~~l~~~rrr~igmVFQ~~aL~P  119 (400)
T PRK10070         45 KDASLAIEEGEIFVIMGLSGSGKSTMVRL-LNRLI---EPTRGQVLI-DGVDIAKISDAELREVRRKKIAMVFQSFALMP  119 (400)
T ss_pred             ECCEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEE-CCEECCCCCHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             74076887999999999998469999999-97599---989818999-99999989978987651465599957974143


Q ss_pred             CEEEEEEECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHH-H--------HHHHHHHHCCCCCCCCCCCCCCCEEEEE
Q ss_conf             200004444178768999999866769-99999807786799-9--------9988642026776665432338679998
Q gi|254780606|r  465 HLLTPVVTNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKS-Y--------NERISTMYGEKPQGCGDDMRPMPYIVII  534 (744)
Q Consensus       465 h~~~~v~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~-~--------n~~~~~~~~~~~~~~~~~~~~~p~ivvv  534 (744)
                      |+-  |..+.........|-..|..+| .+++...|..+... |        .+|+.-.+.         +..-|.|+ +
T Consensus       120 ~~T--V~eNi~~~l~~~~~~~~e~~~ra~e~L~~VgL~~~~~~yP~eLSGGqqQRVaiARA---------La~~P~iL-L  187 (400)
T PRK10070        120 HMT--VLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARA---------LAINPDIL-L  187 (400)
T ss_pred             CCC--HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHH---------HHCCCCEE-E
T ss_conf             888--88878789998499989999999999997499024218934489999999999999---------86299999-9


Q ss_pred             HHH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             445-68767531035899999999964201358999851654
Q gi|254780606|r  535 VDE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       535 iDE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .|| |+.|-.....++.+   .|..+-+..|.-.|+-|.-.+
T Consensus       188 ~DEP~SALDp~~r~~i~~---~l~~L~~~~~~TiifVTHDl~  226 (400)
T PRK10070        188 MDEAFSALDPLIRTEMQD---ELVKLQAKHQRTIVFISHDLD  226 (400)
T ss_pred             EECCCCCCCHHHHHHHHH---HHHHHHHHHCCEEEEECCCHH
T ss_conf             708765459899999999---999999985999999899999


No 218
>PRK13542 consensus
Probab=95.01  E-value=0.29  Score=27.65  Aligned_cols=49  Identities=29%  Similarity=0.460  Sum_probs=31.8

Q ss_pred             EEECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             42057887321120----114846997078753447999999999985680110799
Q gi|254780606|r  396 LGKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       396 ~g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      |.+...|++++-++    .+.=.+.|.|-.|+|||++|+. |++++   .|+.=++.
T Consensus        24 ls~~~g~~~il~~isl~i~~Gei~~liGpNGaGKTTLlk~-l~Gll---~p~~G~I~   76 (224)
T PRK13542         24 LGFSRGGRAVFRGIDISLAPGDLLQVMGPNGSGKTSLLRV-LSGLM---PPAEGDLY   76 (224)
T ss_pred             EEEEECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEE
T ss_conf             6999999998846167875997999999999999999999-95797---88852899


No 219
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=95.01  E-value=0.11  Score=30.49  Aligned_cols=39  Identities=23%  Similarity=0.277  Sum_probs=27.9

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             14846997078753447999999999985680110799972
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
                      +.--.||+|.+|+|||+|-..++...+.+  -+.+-++..+
T Consensus        31 ~g~~~li~G~~G~GKt~~~~~f~~~~~~~--g~~~~~~~~e   69 (241)
T PRK06067         31 FGSLILIEGENDTGKSVLSQQFVWGALNQ--GKRGLAITTE   69 (241)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHC--CCEEEEEEEC
T ss_conf             99089998079988799999999999867--9829999942


No 220
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.00  E-value=0.047  Score=33.09  Aligned_cols=146  Identities=19%  Similarity=0.273  Sum_probs=69.9

Q ss_pred             CHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECCCC---------CEECCCCCCCCEEEEEEECHHH
Q ss_conf             201148469970787534479999999999856801107999--72342---------1000125775200004444178
Q gi|254780606|r  408 DLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDPKM---------LELSVYDGIPHLLTPVVTNPKK  476 (744)
Q Consensus       408 dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~k~---------~~~~~~~~~ph~~~~v~~~~~~  476 (744)
                      ++.+.-.+-|-|..|||||++|| +|.+|+   .|+.=++++  .|...         .-|-.+.-+||+-  |..+   
T Consensus        20 ~i~~Ge~~~ilGpSGsGKSTLl~-li~Gl~---~p~sG~I~i~G~di~~~~~~~r~ig~vfQ~~~L~p~lt--V~eN---   90 (211)
T cd03298          20 TFAQGEITAIVGPSGSGKSTLLN-LIAGFE---TPQSGRVLINGVDVTAAPPADRPVSMLFQENNLFAHLT--VEQN---   90 (211)
T ss_pred             EECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCC--HHHH---
T ss_conf             98899899999999955999999-997699---98852999999999999988986799953886689994--9999---


Q ss_pred             HHHHHH---HHHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHHH
Q ss_conf             768999---999866769-99999807786799---------99988642026776665432338679998445-68767
Q gi|254780606|r  477 AVMALK---WAVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADLM  542 (744)
Q Consensus       477 ~~~~l~---~~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l~  542 (744)
                      ..-.+.   ....+..+| .+++...|..+...         -.+|++-.+.-.         .-|. +++.|| ++-|-
T Consensus        91 i~~~l~~~~~~~~~~~~~v~~~l~~~gl~~~~~~~p~~LSGGqkQRvaiARAL~---------~~P~-ilLlDEPts~LD  160 (211)
T cd03298          91 VGLGLSPGLKLTAEDRQAIEVALARVGLAGLEKRLPGELSGGERQRVALARVLV---------RDKP-VLLLDEPFAALD  160 (211)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHH---------CCCC-EEEECCCCCCCC
T ss_conf             875886468882999999999998769987872894558989999999999986---------5999-999718876559


Q ss_pred             HHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             531035899999999964201358999851654
Q gi|254780606|r  543 MVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       543 ~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .....   ..+.-|..+-+..|+-+|+.|-.+.
T Consensus       161 ~~~~~---~l~~~l~~l~~~~~~Tvi~vTHd~~  190 (211)
T cd03298         161 PALRA---EMLDLVLDLHAETKMTVLMVTHQPE  190 (211)
T ss_pred             HHHHH---HHHHHHHHHHHHHCCEEEEECCCHH
T ss_conf             89999---9999999999974998999988999


No 221
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=94.99  E-value=0.084  Score=31.36  Aligned_cols=41  Identities=24%  Similarity=0.419  Sum_probs=30.0

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             211201148469970787534479999999999856801107999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      +-+++.+.-.+-|.|..|||||++++ +|.+|+   .|+.=++++
T Consensus        28 vs~~i~~GE~v~iiG~sGsGKSTLl~-~i~Gl~---~p~~G~I~~   68 (233)
T PRK11629         28 VSFSIGEGEMMAIVGSSGSGKSTLLH-LLGGLD---TPTSGDVIF   68 (233)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCCEEEEE
T ss_conf             28998899899999999940999999-996699---998639999


No 222
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.99  E-value=0.13  Score=30.04  Aligned_cols=189  Identities=16%  Similarity=0.208  Sum_probs=82.5

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC-CCCCCCEEEEEEECHH---------
Q ss_conf             112011484699707875344799999999998568011079997234210001-2577520000444417---------
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV-YDGIPHLLTPVVTNPK---------  475 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~-~~~~ph~~~~v~~~~~---------  475 (744)
                      -+++.+.=.+.|.|.+|||||++++. |.+|+ .-+-..+.+--+|.....-.. ...+-..++-|.-+++         
T Consensus        27 sl~I~~Ge~~aiiG~nGsGKSTLl~~-l~GLl-~p~~G~I~~~g~~i~~~~~~~~~~~~r~~ig~VfQ~P~~ql~~~tV~  104 (286)
T PRK13646         27 NTEFEQGKYYAIVGQTGSGKSTLIQN-INALL-KPTTGTVTVDDITITHKTKDKYIRPVRKRIGMVFQFPESQLFEDTVE  104 (286)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC-CCCCCEEEECCEECCCCCHHHHHHHHHHCEEEEEECCHHHHHHHHHH
T ss_conf             77986998999999999819999999-97078-88887599998987555746789998740899998840222077899


Q ss_pred             -HHHHHHH---HHHHHHHHH-HHHHHHCCCC-CHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH
Q ss_conf             -8768999---999866769-9999980778-6799---------99988642026776665432338679998445687
Q gi|254780606|r  476 -KAVMALK---WAVREMEER-YRKMSHLSVR-NIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD  540 (744)
Q Consensus       476 -~~~~~l~---~~~~em~~r-~~~~~~~~~~-~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~  540 (744)
                       ..+..++   +-..|+.+| ...+...|.. ++..         -.+|++-...         +.--|- +++.||=..
T Consensus       105 ~~i~fg~~~~g~~~~e~~~r~~~~l~~~gl~~~~~~~~p~~LSGGqkqRVaiA~a---------La~~P~-iLilDEPTa  174 (286)
T PRK13646        105 REMIFGPKNFKMNLDEAKNYAHRLLMDLGFSRDVMSQSPFQMSGGQMRKIAIVSI---------LAMNPD-IIVVDEPTA  174 (286)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHHHHHHHHHH---------HHCCCC-EEEEECCCC
T ss_conf             9998679777999999999999999984994757756943299999999999999---------851989-999838744


Q ss_pred             -HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCE
Q ss_conf             -6753103589999999996420135899985165444414678850563057203681110032676316885689846
Q gi|254780606|r  541 -LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDM  619 (744)
Q Consensus       541 -l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~  619 (744)
                       |-.....++..   -|-++-+..|+-+|+.|...+  .+     +.+--||.+-    .+.+ |+-++..+.++..-+.
T Consensus       175 gLDp~~~~~i~~---ll~~l~~~~g~TiI~iTHdm~--~v-----~~~adrv~vm----~~G~-Iv~~G~p~evf~~~~~  239 (286)
T PRK13646        175 GLDPQSKRQVMR---LLKSLQTDENKAIILISHDMN--EV-----ARYADEVIVM----KEGS-IVSQTSPKELFKDKKK  239 (286)
T ss_pred             CCCHHHHHHHHH---HHHHHHHHCCCEEEEECCCHH--HH-----HHHCCEEEEE----ECCE-EEEECCHHHHHCCHHH
T ss_conf             389899999999---999999953989999913899--99-----9969999999----8989-9997789999779657


Q ss_pred             EE
Q ss_conf             86
Q gi|254780606|r  620 LY  621 (744)
Q Consensus       620 l~  621 (744)
                      |.
T Consensus       240 l~  241 (286)
T PRK13646        240 LA  241 (286)
T ss_pred             HH
T ss_conf             98


No 223
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.
Probab=94.98  E-value=0.023  Score=35.16  Aligned_cols=163  Identities=15%  Similarity=0.218  Sum_probs=83.7

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE------CCC---------------CCEECCCC
Q ss_conf             732112011484699707875344799999999998568011079997------234---------------21000125
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV------DPK---------------MLELSVYD  461 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li------D~k---------------~~~~~~~~  461 (744)
                      +-+-+++.+.--+-|-|-+|||||++|+.| .+|.   .|+.=++++-      |..               +.-|-.|.
T Consensus        41 ~dvsl~I~~GEi~~lvGpSGsGKSTLLr~i-~GL~---~pt~G~I~i~~~~~~~d~~~~~~~~lr~~R~~~IgmVFQ~~a  116 (382)
T TIGR03415        41 ANASLDIEEGEICVLMGLSGSGKSSLLRAV-NGLN---PVSRGSVLVKDGDGSIDVANCDAATLRRLRTHRVSMVFQKFA  116 (382)
T ss_pred             ECCEEEECCCCEEEEECCCCCHHHHHHHHH-HCCC---CCCCEEEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEECCCC
T ss_conf             651748879989999999973499999999-7599---988529999268642245659989987630576699963786


Q ss_pred             CCCCEEEEEEECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHHHHH------------HHHHHHCCCCCCCCCCCCCC
Q ss_conf             775200004444178768999999866769-99999807786799999------------88642026776665432338
Q gi|254780606|r  462 GIPHLLTPVVTNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKSYNE------------RISTMYGEKPQGCGDDMRPM  528 (744)
Q Consensus       462 ~~ph~~~~v~~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~~n~------------~~~~~~~~~~~~~~~~~~~~  528 (744)
                      -+||+-  |..+.........|-..|..+| .+++...|.   .+|-.            |+.-.+.         +..-
T Consensus       117 L~P~~T--V~eNia~~L~~~g~~~~e~~~rv~e~L~~VgL---~~~~~~yP~eLSGGqqQRVaIARA---------La~~  182 (382)
T TIGR03415       117 LMPWLT--VEENVAFGLEMQGMPEAERRKRVDEQLELVGL---AQWADKKPGELSGGMQQRVGLARA---------FAMD  182 (382)
T ss_pred             CCCCCC--HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCC---HHHHHCCHHHCCHHHHHHHHHHHH---------HHCC
T ss_conf             465681--99999899988699999999999999873598---465547955579889999999999---------8638


Q ss_pred             CEEEEEHHH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE
Q ss_conf             679998445-687675310358999999999642013589998516544441467885056305720
Q gi|254780606|r  529 PYIVIIVDE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ  594 (744)
Q Consensus       529 p~ivvviDE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~  594 (744)
                      |-|+ +.|| |+.|--....++   ...|-++-+..|+-.|+-|-..+ ..+      .+.-||+.-
T Consensus       183 P~iL-LmDEPfsaLD~~~r~~l---~~~l~~L~~~~~~TiifVTHD~~-EA~------~laDRIaVM  238 (382)
T TIGR03415       183 ADIL-LMDEPFSALDPLIRTQL---QDELLELQAKLNKTIIFVSHDLD-EAL------KIGNRIAIM  238 (382)
T ss_pred             CCEE-EEECCCCCCCHHHHHHH---HHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEEE
T ss_conf             9989-97088765599999999---99999999986998999879999-999------868989999


No 224
>TIGR00618 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. SbcC may have nuclease activity that is functionally related to one of the nuclease activities of the RecBCD enzyme (IPR004586 from INTERPRO).; GO: 0004527 exonuclease activity, 0006259 DNA metabolic process.
Probab=94.97  E-value=0.028  Score=34.60  Aligned_cols=42  Identities=21%  Similarity=0.413  Sum_probs=29.8

Q ss_pred             ECCCCCEEECCHHH-----CCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             05788732112011-----48469970787534479999999999856
Q gi|254780606|r  398 KTISGESVIADLAN-----MPHILVAGTTGSGKSVAINTMIMSLLYRL  440 (744)
Q Consensus       398 ~~~~g~~~~~dl~~-----~PH~lvaG~TgsGKS~~l~~~i~sl~~~~  440 (744)
                      ....-.+-+.|.+.     .+-.+|.|.||+|||.+|.+|-..| |..
T Consensus        11 ~~~y~~~~~~dfT~~~fasl~~f~i~G~tGAGKtsLldAI~yAL-YGk   57 (1063)
T TIGR00618        11 FTSYKGESVIDFTALGFASLKLFVICGKTGAGKTSLLDAITYAL-YGK   57 (1063)
T ss_pred             CCCCCCCCEEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH-CCC
T ss_conf             35345761010278872125736777889983545999999987-288


No 225
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.95  E-value=0.026  Score=34.80  Aligned_cols=217  Identities=14%  Similarity=0.191  Sum_probs=96.2

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC--------CCCCCC-CEEEEEEECHHH
Q ss_conf             11201148469970787534479999999999856801107999723421000--------125775-200004444178
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS--------VYDGIP-HLLTPVVTNPKK  476 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~--------~~~~~p-h~~~~v~~~~~~  476 (744)
                      -+++.+.-.+-+-|..|||||++++. |++|+ +-+.-++.+.-.|.+.....        .|++.- +++...+.  +.
T Consensus        24 s~~i~~Ge~~aliG~NGaGKSTLl~~-i~Gll-~p~~G~I~i~G~~i~~~~~~~~r~~ig~vfQ~p~~~l~~~tv~--~~   99 (277)
T PRK13652         24 NFIAGRKQRIAVIGPNGAGKSTLFKH-FNGIL-KPTSGSVLIRGEPITKENIREVRKFVGLVFQNPDDQIFSPTVE--QD   99 (277)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC-CCCCEEEEECCEECCCCCHHHHHHCCEEEEECCCHHHCCCHHH--HH
T ss_conf             87998998999999999479999999-96699-9984699999999998999999713289987762221325599--99


Q ss_pred             HHHHHHH---HHHHHHHH-HHHHHHCCCCCHHHHHHHHHHHHCCCCCCC---CCCCCCCCEEEEEHHHHHHHHHHCCHHH
Q ss_conf             7689999---99866769-999998077867999998864202677666---5432338679998445687675310358
Q gi|254780606|r  477 AVMALKW---AVREMEER-YRKMSHLSVRNIKSYNERISTMYGEKPQGC---GDDMRPMPYIVIIVDEMADLMMVAGKEI  549 (744)
Q Consensus       477 ~~~~l~~---~~~em~~r-~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~---~~~~~~~p~ivvviDE~a~l~~~~~~~~  549 (744)
                      ....+..   -..++..| .+.+...|.   ..|..+....-+...+..   ..-+-.-|. +++.||=..-+  .....
T Consensus       100 i~~~~~~~g~~~~~~~~~v~~~l~~~gL---~~~~~~~~~~LSGGqkqRvaiA~aL~~~P~-lLlLDEPtagL--Dp~~~  173 (277)
T PRK13652        100 IAFGPINLGLDEETVAHRVDEALHMLGL---EELRDRVPHHLSGGEKKRVAIAGILAMEPQ-VLVLDEPTAGL--DPQGV  173 (277)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCC---HHHHHCCHHHCCHHHHHHHHHHHHHHHCCC-EEEECCCCCCC--CHHHH
T ss_conf             9988988698999999999999986799---788718954489999999999999982999-99983974548--99999


Q ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEEECCCCCEE
Q ss_conf             99999999964201358999851654444146788505630572036811100326763168856898468646898438
Q gi|254780606|r  550 EGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQ  629 (744)
Q Consensus       550 e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~~~~~~~~~  629 (744)
                      ...+.-|-++.+..|+-+|+.|.+-+  .+     ..+-.||.+=    .+-++|.+..- +.++.+=|.|...+     
T Consensus       174 ~~i~~~l~~l~~~~g~Tii~vtHdl~--~v-----~~~aDri~vl----~~G~ii~~Gtp-~ev~~~p~~l~~~~-----  236 (277)
T PRK13652        174 KELFDFLNALPETYGMTVIFSTHQVE--LV-----AEMADYIYVM----EKGEIVGYGTV-QEIFLQPDLLARAR-----  236 (277)
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCHH--HH-----HHHCCEEEEE----ECCEEEEECCH-HHHHHCHHHHHHCC-----
T ss_conf             99999999999850989999914899--99-----9979999999----89999998789-99974989999779-----


Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             99934389889999999998408875
Q gi|254780606|r  630 RVHGPLVSDIEIEKVVQHLKKQGCPE  655 (744)
Q Consensus       630 r~~~~~~~~~~~~~~~~~~~~~~~~~  655 (744)
                            +....+-++...++++|-+-
T Consensus       237 ------l~~p~~~~l~~~L~~~g~~i  256 (277)
T PRK13652        237 ------LDLPSLPKLIQSLRAQGIAI  256 (277)
T ss_pred             ------CCCCHHHHHHHHHHHCCCCC
T ss_conf             ------99983999999999759999


No 226
>pfam00270 DEAD DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.
Probab=94.95  E-value=0.077  Score=31.61  Aligned_cols=43  Identities=21%  Similarity=0.310  Sum_probs=23.9

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             1484699707875344799999999998568011079997234
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      +.=.++|.+.||||||..---.+...+..+.....-++++.-|
T Consensus        13 ~g~~~iv~~pTGsGKT~~~~~~~l~~~~~~~~~~~~v~l~Pt~   55 (167)
T pfam00270        13 EGKDVLVQAPTGSGKTLAFLLPALQALLKNPDGPQALVLAPTR   55 (167)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCHH
T ss_conf             6997899889997589999999999987477898799990608


No 227
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.94  E-value=0.086  Score=31.28  Aligned_cols=123  Identities=22%  Similarity=0.314  Sum_probs=60.5

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--CCCCEECCCCCCCCEEEEEEECHHHHHHH
Q ss_conf             7321120114846997078753447999999999985680110799972--34210001257752000044441787689
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--PKMLELSVYDGIPHLLTPVVTNPKKAVMA  480 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~k~~~~~~~~~~ph~~~~v~~~~~~~~~~  480 (744)
                      +.+-+++.+.-.+.|.|..|+|||++++. |++++   .|+.=++.+-+  .+......+..  + +. .+.        
T Consensus        16 ~~i~~~i~~Ge~~~i~G~nGaGKSTLl~~-l~gl~---~~~~G~i~~~g~~~~~~~~~~~~~--~-i~-~v~--------   79 (157)
T cd00267          16 DNVSLTLKAGEIVALVGPNGSGKSTLLRA-IAGLL---KPTSGEILIDGKDIAKLPLEELRR--R-IG-YVP--------   79 (157)
T ss_pred             EEEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEEECCEECCCCCHHHHHH--C-CC-CCC--------
T ss_conf             21178987997999987889998999999-95884---799628999999999799999994--0-60-876--------


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH-HHHHCCHHHHHHHHHHHHH
Q ss_conf             999998667699999980778679999988642026776665432338679998445687-6753103589999999996
Q gi|254780606|r  481 LKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD-LMMVAGKEIEGAIQRLAQM  559 (744)
Q Consensus       481 l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~-l~~~~~~~~e~~~~~la~~  559 (744)
                        -+..-|.+|..+-...           .                .-|. +++.||-.. |-.....++...|.++.+.
T Consensus        80 --QLSgGqkqrv~iA~al-----------~----------------~~p~-ililDEPtsgLD~~~~~~l~~~i~~l~~~  129 (157)
T cd00267          80 --QLSGGQRQRVALARAL-----------L----------------LNPD-LLLLDEPTSGLDPASRERLLELLRELAEE  129 (157)
T ss_pred             --CCCHHHHHHHHHHHHH-----------H----------------CCCC-EEEEECCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             --6886999999999999-----------7----------------0999-99996987668999999999999999968


Q ss_pred             HHCCEEEEEEEECCCC
Q ss_conf             4201358999851654
Q gi|254780606|r  560 ARAAGIHLIMATQRPS  575 (744)
Q Consensus       560 ~ra~GihlilatQrp~  575 (744)
                          |.-+|+.|..++
T Consensus       130 ----g~tii~vtH~~~  141 (157)
T cd00267         130 ----GRTVIIVTHDPE  141 (157)
T ss_pred             ----CCEEEEEECCHH
T ss_conf             ----999999908999


No 228
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.93  E-value=0.033  Score=34.17  Aligned_cols=204  Identities=18%  Similarity=0.206  Sum_probs=99.2

Q ss_pred             CHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHH--EEEEEECCC---CCEEC--------CCCCCC--CEEEEEEE
Q ss_conf             2011484699707875344799999999998568011--079997234---21000--------125775--20000444
Q gi|254780606|r  408 DLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDE--CRMIMVDPK---MLELS--------VYDGIP--HLLTPVVT  472 (744)
Q Consensus       408 dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~--~~~~liD~k---~~~~~--------~~~~~p--h~~~~v~~  472 (744)
                      .+.+.-.+.|-|.+|||||++++. |.+|+   .|+.  --.+.+|-+   ...+.        .|++ |  .++..  |
T Consensus        30 ~I~~Ge~vaiiG~nGsGKSTL~~~-l~Gll---~P~~~~~G~i~~~g~~i~~~~~~~lr~~vg~VfQ~-P~~q~~~~--t  102 (283)
T PRK13640         30 SIPRGSWTALIGHNGSGKSTISKL-INGLL---LPDDNPKSKITVDGITLTAKTVWDIREKVGIVFQN-PDNQFVGA--T  102 (283)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCCEEEEEECCEECCCCCHHHHHHCEEEEEEC-CCCCCCCC--C
T ss_conf             998999999999999879999999-96403---78888617999999999967988996261899868-87618878--2


Q ss_pred             CHHHHHHHHH---HHHHHHHHHHH-HHHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH
Q ss_conf             4178768999---99986676999-9998077867999---------998864202677666543233867999844568
Q gi|254780606|r  473 NPKKAVMALK---WAVREMEERYR-KMSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA  539 (744)
Q Consensus       473 ~~~~~~~~l~---~~~~em~~r~~-~~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a  539 (744)
                      =.+..+-.+.   .-..++.+|.+ .+...|..+..+-         .+|++-...         +.--|- +++.||=.
T Consensus       103 V~e~iafgl~n~~~~~~e~~~~v~~~l~~vgl~~~~~~~p~~LSGGqkQRvaiA~a---------La~~P~-iLllDEPT  172 (283)
T PRK13640        103 VGDDVAFGLENRGVPRPEMIKIVADVLSDVGMLDYIDSEPANLSGGQKQRVAIAGI---------LAVEPQ-IIILDEST  172 (283)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCC-EEEECCCC
T ss_conf             99999845753799999999999999987799777647922299999999999999---------971999-99976874


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCE
Q ss_conf             76753103589999999996420135899985165444414678850563057203681110032676316885689846
Q gi|254780606|r  540 DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDM  619 (744)
Q Consensus       540 ~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~  619 (744)
                      .-+.  ....+..+.-|-++.+..|+-+|+.|.+.+  .    +.  +--||.+=-    +-|+|.+. -.+.++.+-|+
T Consensus       173 s~LD--~~~~~~i~~~l~~l~~e~g~TvI~itHd~~--~----a~--~aDrv~vm~----~G~iv~~G-~p~evf~~~~~  237 (283)
T PRK13640        173 SMLD--PAGKEQILKLIRKLMKDNNLTIISITHDID--E----AA--GADQVLVLD----DGKLLAQG-SPVEIFPKVEL  237 (283)
T ss_pred             CCCC--HHHHHHHHHHHHHHHHCCCCEEEEEEECHH--H----HH--HCCEEEEEE----CCEEEEEC-CHHHHHCCHHH
T ss_conf             5489--899999999999999706989999978878--9----97--099899999----99999977-78998579999


Q ss_pred             EEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCCC
Q ss_conf             86468984389993438988999999999840887
Q gi|254780606|r  620 LYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCP  654 (744)
Q Consensus       620 l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~  654 (744)
                      |-.           +.+....+-++...++.+|-.
T Consensus       238 l~~-----------~~l~~P~~~~l~~~L~~~g~~  261 (283)
T PRK13640        238 LKR-----------IGLDIPFVYKLKLKLKEKGIS  261 (283)
T ss_pred             HHH-----------CCCCCCHHHHHHHHHHHCCCC
T ss_conf             997-----------799999699999999974999


No 229
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; InterPro: IPR012701    Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three-component ABC transporter, where IPR005769 from INTERPRO is the permease, IPR005770 from INTERPRO is the phosphonates binding protein, and IPR012693 from INTERPRO is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lyase complex. This protein (PhnL) and the adjacent-encoded PhnK (IPR012700 from INTERPRO) resemble transporter ATP-binding proteins but are suggested, based on mutagenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se ..
Probab=94.92  E-value=0.017  Score=36.17  Aligned_cols=51  Identities=20%  Similarity=0.349  Sum_probs=31.7

Q ss_pred             CCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE
Q ss_conf             78368984205788732112011484699707875344799999999998568011079997
Q gi|254780606|r  389 KANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV  450 (744)
Q Consensus       389 ~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li  450 (744)
                      ...||++-+       |-+.+...=-+.+.|.+|||||++|++|-    -+|.||-=++..=
T Consensus        18 G~~LpVl~~-------v~l~V~aGEcv~L~G~SGaGKSTlLk~lY----aNYlp~~G~i~~~   68 (224)
T TIGR02324        18 GVRLPVLKN-------VSLTVNAGECVALSGPSGAGKSTLLKSLY----ANYLPDSGRILVR   68 (224)
T ss_pred             CEEEEECCC-------CEEEEECCCEEEEECCCCCCHHHHHHHHH----HCCCCCCCEEEEE
T ss_conf             865000067-------43787367358853688876789999766----3047468677776


No 230
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=94.91  E-value=0.023  Score=35.22  Aligned_cols=30  Identities=23%  Similarity=0.317  Sum_probs=22.8

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             1201148469970787534479999999999
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      +.+.+.=.+-|.|.+|||||++++. |++|+
T Consensus        35 ~~i~~Ge~vaIvG~sGsGKSTL~~l-l~gl~   64 (226)
T cd03248          35 FTLHPGEVTALVGPSGSGKSTVVAL-LENFY   64 (226)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHH-HHCCC
T ss_conf             9982999999999999849999999-96454


No 231
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR); InterPro: IPR005291   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    These proteins are integral membrane proteins and they are involved in the transport of chloride ions. Many of these proteins are the cystis fibrosis transmembrane conductor regulators (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se.; GO: 0005254 chloride channel activity, 0006811 ion transport, 0016020 membrane.
Probab=94.89  E-value=0.018  Score=35.89  Aligned_cols=190  Identities=23%  Similarity=0.368  Sum_probs=106.7

Q ss_pred             EEEEECCCCCEEECCHH----HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCC----CCCC
Q ss_conf             98420578873211201----148469970787534479999999999856801107999723421000125----7752
Q gi|254780606|r  394 LCLGKTISGESVIADLA----NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYD----GIPH  465 (744)
Q Consensus       394 ~~~g~~~~g~~~~~dl~----~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~----~~ph  465 (744)
                      +-.-.+.+|+.|.-||+    -.=.+=+-|.||||||++|-+++.   +.++-.++.+--|-..-+.|-.++    -+|+
T Consensus      1264 LT~KYT~~G~avL~dlSFsv~~GQ~VGlLGRTGsGKSTLLSAlLR---L~~T~GEI~IDGvSW~SvtLQ~WRKAFGViPQ 1340 (1534)
T TIGR01271      1264 LTAKYTEAGRAVLQDLSFSVEAGQRVGLLGRTGSGKSTLLSALLR---LLSTEGEIQIDGVSWNSVTLQKWRKAFGVIPQ 1340 (1534)
T ss_pred             CEEEECCCCHHHHHHCCEEECCCCEEEEEECCCCCHHHHHHHHHH---HCCCCCCEEECCEEECCCCHHHHHHHCCCCCC
T ss_conf             402321020555641341443883577530268767899999999---60779816762335052122003444131563


Q ss_pred             EEEEEEEC--HHHHHHHHHHHHHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHH
Q ss_conf             00004444--178768999999866769999998077867-999998864202677666543233867999844568767
Q gi|254780606|r  466 LLTPVVTN--PKKAVMALKWAVREMEERYRKMSHLSVRNI-KSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLM  542 (744)
Q Consensus       466 ~~~~v~~~--~~~~~~~l~~~~~em~~r~~~~~~~~~~~i-~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~  542 (744)
                      =+ .|.+-  .+...=--+|--+|+   -+.-.+.|.|.+ +.|-.                  +|-  ++.+|=.--|.
T Consensus      1341 Kv-Fi~sGTFR~NLDPy~~~SD~E~---WkVaeEVGLkSvIEQFPd------------------KLd--F~L~DGGyvLS 1396 (1534)
T TIGR01271      1341 KV-FIFSGTFRKNLDPYEQWSDEEI---WKVAEEVGLKSVIEQFPD------------------KLD--FVLVDGGYVLS 1396 (1534)
T ss_pred             EE-EEECCCCCCCCCHHHHCCHHHH---HHHHHHCCCEEEEECCCC------------------CCC--EEEECCCEEEE
T ss_conf             47-8831551136881342260356---666543154311000888------------------412--48862867831


Q ss_pred             HHCCHHHHHHHHH-HHHHHHCCEEEEEEEECCCCCC-------CCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHC
Q ss_conf             5310358999999-9996420135899985165444-------4146788505630572036811100326763168856
Q gi|254780606|r  543 MVAGKEIEGAIQR-LAQMARAAGIHLIMATQRPSVD-------VITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLL  614 (744)
Q Consensus       543 ~~~~~~~e~~~~~-la~~~ra~GihlilatQrp~~~-------vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~  614 (744)
                      ..+ |... .++| |-.|||      ||----|++-       ||...+|..|           .|-.+||-|.--|.||
T Consensus      1397 ~GH-KQLM-CLARSiLSKAk------ILLLDEPsA~LDPvT~Qi~RkTLK~~F-----------s~CTVILsEHRvEalL 1457 (1534)
T TIGR01271      1397 NGH-KQLM-CLARSILSKAK------ILLLDEPSAHLDPVTLQIIRKTLKQSF-----------SNCTVILSEHRVEALL 1457 (1534)
T ss_pred             CCH-HHHH-HHHHHHHHHHH------HHHCCCCCHHCCHHHHHHHHHHHHHHH-----------CCCEEEEECCCHHHHH
T ss_conf             641-6899-99988886533------222148710103168999999985322-----------1574875112222466


Q ss_pred             CCCCEEEECCCCCEEE
Q ss_conf             8984686468984389
Q gi|254780606|r  615 GRGDMLYMSGGGRIQR  630 (744)
Q Consensus       615 g~gd~l~~~~~~~~~r  630 (744)
                      ---.+|..-+. ...|
T Consensus      1458 ECQ~FL~IE~~-~~k~ 1472 (1534)
T TIGR01271      1458 ECQQFLVIEGS-SVKQ 1472 (1534)
T ss_pred             HHCCEEEEECC-CCHH
T ss_conf             40310144256-4303


No 232
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344   This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. C-terminal part of the protein matches a domain found in viral RNA helicase, superfamily 1, IPR000606 from INTERPRO. ; GO: 0008854 exodeoxyribonuclease V activity, 0009338 exodeoxyribonuclease V complex.
Probab=94.88  E-value=0.31  Score=27.43  Aligned_cols=126  Identities=21%  Similarity=0.338  Sum_probs=68.8

Q ss_pred             EEEEEECCCCCE------EECCH-HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCC
Q ss_conf             898420578873------21120-11484699707875344799999999998568011079997234210001257752
Q gi|254780606|r  393 ALCLGKTISGES------VIADL-ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPH  465 (744)
Q Consensus       393 ~~~~g~~~~g~~------~~~dl-~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph  465 (744)
                      -++...+.+|+-      +.+.+ .+.+=.||.|..|.|||..+.-||..|.-.. +.                 .+-|.
T Consensus       216 ~f~~~~~~~~~~~~D~Q~~a~~~aL~~~f~li~GGPGTGKTTTv~~LL~al~~~~-~~-----------------~G~~~  277 (753)
T TIGR01447       216 LFPLLNEQNGRKVTDWQKVAVALALKSNFSLITGGPGTGKTTTVARLLLALIKQS-PK-----------------QGKPR  277 (753)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHHHHHH-HH-----------------CCCCC
T ss_conf             8542104544311379999999986087689987988977899999999999989-86-----------------49974


Q ss_pred             EEEEEEECHHHHHHHHHHHHHHHHHHHHH---------HHHC--CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEE
Q ss_conf             00004444178768999999866769999---------9980--778679999988642026776665432338679998
Q gi|254780606|r  466 LLTPVVTNPKKAVMALKWAVREMEERYRK---------MSHL--SVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVII  534 (744)
Q Consensus       466 ~~~~v~~~~~~~~~~l~~~~~em~~r~~~---------~~~~--~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvv  534 (744)
                      +...++--..||+.-|......-..+...         +...  .+..|+.   ...........-..+.-.+||+=|+|
T Consensus       278 ~~I~l~APTGKAa~RL~esl~~~~~~L~~~~~aid~~~~~~~~~~~~TiHr---LLG~~~I~~~~fr~h~~N~L~~DVLv  354 (753)
T TIGR01447       278 LRIALAAPTGKAAARLAESLRKAVKKLAAENMAIDEDLIAALPSEATTIHR---LLGIKPIDTKRFRHHERNPLPLDVLV  354 (753)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCHHHHHHHH---HHCCCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             047886684479999999999886322342366587985487204568888---61661478767767777889855278


Q ss_pred             HHHHH
Q ss_conf             44568
Q gi|254780606|r  535 VDEMA  539 (744)
Q Consensus       535 iDE~a  539 (744)
                      |||-.
T Consensus       355 vDEaS  359 (753)
T TIGR01447       355 VDEAS  359 (753)
T ss_pred             ECCCH
T ss_conf             70600


No 233
>PRK13342 recombination factor protein RarA; Reviewed
Probab=94.88  E-value=0.31  Score=27.45  Aligned_cols=68  Identities=21%  Similarity=0.253  Sum_probs=35.3

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEE-CCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCC
Q ss_conf             799984456876753103589999999996420135899985-16544441467885056305720368111003267
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMAT-QRPSVDVITGTIKANFPIRISFQVTSKIDSRTILG  606 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlilat-Qrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~  606 (744)
                      ..|++|||..-|..    .-.+.+...--.|.   |-||.|| ..|+-.+... |..-+ ..+.|+--+..|=..||.
T Consensus        93 ~tilfiDEIHRfnK----~QQD~LLp~vE~g~---iiLIgATTENP~f~in~a-LlSRc-~vf~l~~L~~~di~~iL~  161 (417)
T PRK13342         93 RTILFIDEIHRFNK----AQQDALLPHVEDGT---ITLIGATTENPSFEVNPA-LLSRA-QVFELKPLSEEDLEQLLK  161 (417)
T ss_pred             CEEEEEECHHHCCH----HHHHHHHHHHHCCC---EEEEEECCCCCHHHCCHH-HHHHH-HHEECCCCCHHHHHHHHH
T ss_conf             65999978200588----99999987511265---699974157922534898-98565-700205899999999999


No 234
>COG3596 Predicted GTPase [General function prediction only]
Probab=94.88  E-value=0.018  Score=35.90  Aligned_cols=24  Identities=38%  Similarity=0.656  Sum_probs=19.7

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             469970787534479999999999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      .+|+.|+||+|||.++|++..+..
T Consensus        41 nvLi~G~TG~GKSSliNALF~~~~   64 (296)
T COG3596          41 NVLLMGATGAGKSSLINALFQGEV   64 (296)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCC
T ss_conf             589743777768899999970267


No 235
>PRK08233 hypothetical protein; Provisional
Probab=94.88  E-value=0.021  Score=35.42  Aligned_cols=22  Identities=27%  Similarity=0.492  Sum_probs=19.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHH
Q ss_conf             6997078753447999999999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +.|||.||||||.+.+.|+-.|
T Consensus         6 IgIaGgSgSGKTtla~~l~~~l   27 (182)
T PRK08233          6 ITIAAVSGGGKTTLTERLTHKL   27 (182)
T ss_pred             EEEECCCCCCHHHHHHHHHHHC
T ss_conf             9996888678999999999974


No 236
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=94.87  E-value=0.11  Score=30.56  Aligned_cols=57  Identities=19%  Similarity=0.304  Sum_probs=34.2

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC
Q ss_conf             887321120----11484699707875344799999999998568011079997234210001
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV  459 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~  459 (744)
                      ..+++.-|+    .+.=.+.|-|.||||||++++ +|+.+ |.....++.+--+|-+...+..
T Consensus       353 ~~~~vL~~isl~I~~G~~vaiVG~SGsGKSTL~~-LL~gl-y~p~~G~I~idg~di~~~~~~~  413 (581)
T PRK11176        353 KEVPALRNINFKIPAGKTVALVGRSGSGKSTIAN-LLTRF-YDIDEGEILLDGHDLRDYTLAS  413 (581)
T ss_pred             CCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHH-HHHHH-CCCCCCEEEECCEEHHHCCHHH
T ss_conf             9862010663357999443122899986789999-99853-6678874878988512147666


No 237
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=94.85  E-value=0.096  Score=30.96  Aligned_cols=62  Identities=15%  Similarity=0.210  Sum_probs=36.6

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE--EECCCCCEECC-------CCCCCCEEEE
Q ss_conf             321120114846997078753447999999999985680110799--97234210001-------2577520000
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI--MVDPKMLELSV-------YDGIPHLLTP  469 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~--liD~k~~~~~~-------~~~~ph~~~~  469 (744)
                      .+-+.+.+.-++-|.|.||||||++++-+ +.   -+.|++=++.  -+|.+...+..       -..-+|++..
T Consensus       359 ~isl~i~~Ge~vaiVG~SGsGKSTL~~LL-~r---~ydp~~G~I~idG~di~~~~~~~lr~~i~~V~Q~~~LF~~  429 (575)
T PRK11160        359 GLSLQIKAGEKVALLGRTGCGKSTLLQLL-TR---AWDPQQGEILLNGQPIASYSEAALRQAISVVSQRVHLFSG  429 (575)
T ss_pred             CEEEEECCCCEEEEECCCCCCHHHHHHHH-HC---CCCCCCCEEEECCEECCCCCHHHHHHHHCCCCCCCCCCCC
T ss_conf             71589769988999889997599999998-62---3678998899998975638889998761356777602588


No 238
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB; InterPro: IPR013363    Proteins in this entry are the DotB component of Dot/Icm secretion systems, as found in the obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the literature now seems to favor calling this the Dot/Icm system. This family is most closely related to the TraJ proteins of plasmid transfer (IPR013364 from INTERPRO), rather than to proteins of other type IV secretion systems..
Probab=94.82  E-value=0.027  Score=34.71  Aligned_cols=126  Identities=24%  Similarity=0.355  Sum_probs=66.6

Q ss_pred             CCCCEEEEEEEECCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEEECCCCCCCEEEHHHHHCCH
Q ss_conf             35513898676489258999754888639999859999998714776327751898345442688888707658751281
Q gi|254780606|r  304 FGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESR  383 (744)
Q Consensus       304 ~~~~~~~~~~~~gp~~~~~~~~~~~g~~~~~~~~~~~d~~~~~~~~~~~~~~~pg~~~~~~~~p~~~~~~v~~~~~~~~~  383 (744)
                      ||-++..-=..---.=|.||++|..++|..--.|          +.++   -+-|...|-|.+-          .+=. .
T Consensus        58 yGPn~ttq~~~G~didthye~rPnr~~r~ryr~n----------~t~C---~v~Gh~~iqit~r----------~iP~-~  113 (358)
T TIGR02524        58 YGPNATTQLLRGKDIDTHYEIRPNRNVRYRYRVN----------ATAC---LVEGHEAIQITLR----------AIPA-E  113 (358)
T ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCEEEEEEE----------CEEE---EEECCCCEEEEEE----------ECCC-C
T ss_conf             1875211232045222100004677750467870----------4044---5205550477876----------4279-8


Q ss_pred             HHCCCCCCEEEEEEECCCCCEEECCHH-HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCC
Q ss_conf             211467836898420578873211201-1484699707875344799999999998568011079997234210001257
Q gi|254780606|r  384 SFSHSKANLALCLGKTISGESVIADLA-NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDG  462 (744)
Q Consensus       384 ~~~~~~~~l~~~~g~~~~g~~~~~dl~-~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~  462 (744)
                      ...-++..||-.+         +.-++ ..-=+.|.|+||||||.+|-++|..|+-  .+|.-+-+|.--.-.|| .|+.
T Consensus       114 PP~ls~~~lP~~i---------~~aiaPqeG~v~~tGatGsGkstlla~iirel~e--~~ds~rk~ltye~Pie~-vyd~  181 (358)
T TIGR02524       114 PPKLSKLDLPDAI---------VEAIAPQEGVVYVTGATGSGKSTLLAAIIRELIE--ASDSNRKVLTYEAPIEY-VYDE  181 (358)
T ss_pred             CCCCCCCCCHHHH---------HHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHH--CCCCCCEEEEECCCHHH-HHHC
T ss_conf             8744311341799---------9851788866998626776368899999999860--67656414642263233-2211


Q ss_pred             CCC
Q ss_conf             752
Q gi|254780606|r  463 IPH  465 (744)
Q Consensus       463 ~ph  465 (744)
                      +--
T Consensus       182 ~~t  184 (358)
T TIGR02524       182 LET  184 (358)
T ss_pred             CCC
T ss_conf             010


No 239
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=94.81  E-value=0.047  Score=33.05  Aligned_cols=57  Identities=18%  Similarity=0.220  Sum_probs=32.0

Q ss_pred             ECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE
Q ss_conf             057887321120----11484699707875344799999999998568011079997234210
Q gi|254780606|r  398 KTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE  456 (744)
Q Consensus       398 ~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~  456 (744)
                      ..-++++++-|+    .+.-.+-|.|.+|||||++++. |+++ |...--.+.+--.|.....
T Consensus        10 Y~~~~~~~L~~is~~i~~G~~vaivG~sGsGKSTll~l-l~gl-~~p~~G~I~i~g~di~~~~   70 (237)
T cd03252          10 YKPDGPVILDNISLRIKPGEVVGIVGRSGSGKSTLTKL-IQRF-YVPENGRVLVDGHDLALAD   70 (237)
T ss_pred             ECCCCCCCEECCEEEECCCCEEEEECCCCCHHHHHHHH-HHCC-CCCCCCEEEECCEECCCCC
T ss_conf             79899572515089987999999999999859999999-9677-6579878999999955189


No 240
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.79  E-value=0.034  Score=34.03  Aligned_cols=207  Identities=19%  Similarity=0.268  Sum_probs=100.6

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC---CCEEC--------CCCCCCCEEEEEEECH
Q ss_conf             112011484699707875344799999999998568011079997234---21000--------1257752000044441
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK---MLELS--------VYDGIPHLLTPVVTNP  474 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k---~~~~~--------~~~~~ph~~~~v~~~~  474 (744)
                      -+++.+.-.+.|-|..|||||++++. |.+|+   .|+.=++ ++|-+   .....        .|++.-+.+. -.|-.
T Consensus        24 sl~i~~GE~vaivG~nGsGKSTL~~~-l~Gll---~p~~G~I-~i~G~~i~~~~~~~lr~~ig~VfQ~p~~~~~-~~tV~   97 (276)
T PRK13650         24 SFHVKQGEWLSIIGHNGSGKSTTVRL-IDGLL---EAESGSI-IIDGDLLTEENVWEIRHKIGMVFQNPDNQFV-GATVE   97 (276)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEE-EECCEECCCCCHHHHHHCEEEEEECCCHHCC-CCCHH
T ss_conf             87998998999999999879999999-97388---9886089-9999999867768876414699767201056-36399


Q ss_pred             HHHHHHHHH---HHHHHHHHHH-HHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHH
Q ss_conf             787689999---9986676999-999807786799---------999886420267766654323386799984456876
Q gi|254780606|r  475 KKAVMALKW---AVREMEERYR-KMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADL  541 (744)
Q Consensus       475 ~~~~~~l~~---~~~em~~r~~-~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l  541 (744)
                      +.....+..   -..++.+|.. .+...|..+...         -.+|++-.+.         +..-|. +++.||=---
T Consensus        98 e~i~fgl~~~g~~~~e~~~rv~~~l~~~gl~~~~~r~p~~LSGGQrQRvaIA~a---------La~~P~-lLilDEPTs~  167 (276)
T PRK13650         98 DDVAFGLENKGIPHEEMKERVNEALELVGMQDFKEREPARLSGGQKQRVAIAGA---------VAMRPK-IIILDEATSM  167 (276)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCC-EEEEECCCCC
T ss_conf             999879987799999999999999987799245538903389999999999999---------973999-9998388665


Q ss_pred             HHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEE
Q ss_conf             75310358999999999642013589998516544441467885056305720368111003267631688568984686
Q gi|254780606|r  542 MMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLY  621 (744)
Q Consensus       542 ~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~  621 (744)
                      +.  ..-....+..|.++.+..|+-+|+.|.+.+  .    + + +..||.+--    +-| |+..+-.+.++.+-|.|.
T Consensus       168 LD--~~~~~~i~~~l~~l~~~~g~Tvi~iTHdl~--~----v-~-~aDrvivm~----~G~-Iv~~Gtp~evf~~p~~l~  232 (276)
T PRK13650        168 LD--PEGRLELIKTIKNIRDDYQLTVISITHDLD--E----V-A-LSDRVLVMK----DGQ-VESTSTPRELFSRGDELL  232 (276)
T ss_pred             CC--HHHHHHHHHHHHHHHHHCCCEEEEEEECHH--H----H-H-CCCEEEEEE----CCE-EEEECCHHHHHCCHHHHH
T ss_conf             89--999999999999999842989999957789--9----9-6-099999998----999-999768999974989999


Q ss_pred             ECCCCCEEEEEECCCCHHHHHHHHHHHHHCCCC
Q ss_conf             468984389993438988999999999840887
Q gi|254780606|r  622 MSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCP  654 (744)
Q Consensus       622 ~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~  654 (744)
                      ..+=.           ...+-+++..++.+|..
T Consensus       233 ~~~l~-----------~P~~~~~~~~L~~~g~~  254 (276)
T PRK13650        233 QLGLD-----------IPFTTSLVQMLQEEGYD  254 (276)
T ss_pred             HCCCC-----------CCHHHHHHHHHHHCCCC
T ss_conf             77999-----------98699999999965999


No 241
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=94.74  E-value=0.3  Score=27.52  Aligned_cols=191  Identities=14%  Similarity=0.231  Sum_probs=109.9

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC----EECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             469970787534479999999999856801107999723421----0001257752000044441787689999998667
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML----ELSVYDGIPHLLTPVVTNPKKAVMALKWAVREME  489 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~----~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~  489 (744)
                      -+-.-|-||.|||+-|--|-.-..++|..+.|-||-.|--++    -|..|-.|-.+-..++.|..+...+|..    +.
T Consensus       350 v~AlvGpTGvGKTTT~aKlAa~~~~~~g~~~valit~DtyRiga~eQL~~y~~ilgvpv~~~~~~~~l~~~l~~----l~  425 (557)
T PRK12727        350 VIALVGPTGAGKTTTIAKLAQRFAAQHAPRDVALVTTDTQRVGGREQLHSYGRQLGIAVHEADSAESLLDLLER----LR  425 (557)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCEEEEECCHHHHHHHHHH----HC
T ss_conf             47874377767311799999999997399818999726640879999999999839757982899999999998----36


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             69999998077867999998864202677666543233867999844568767531035899999999964201358999
Q gi|254780606|r  490 ERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIM  569 (744)
Q Consensus       490 ~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlil  569 (744)
                      .                                       +-+|.||-..  |..........+..|. -++..-.||+|
T Consensus       426 ~---------------------------------------~~lvliDTaG--~~~rd~~~~~~~~~l~-~~~~~~~~Lvl  463 (557)
T PRK12727        426 D---------------------------------------YKLVLIDTAG--MGQRDRALAAQLNWLR-AARQVTSLLVL  463 (557)
T ss_pred             C---------------------------------------CCEEEEECCC--CCCCCHHHHHHHHHHH-CCCCCCEEEEE
T ss_conf             9---------------------------------------9989994999--8846999999999875-14776359999


Q ss_pred             EECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEEECCCCC-E---EEEEECCCCHHHHHHHH
Q ss_conf             8516544441467885056305720368111003267631688568984686468984-3---89993438988999999
Q gi|254780606|r  570 ATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGR-I---QRVHGPLVSDIEIEKVV  645 (744)
Q Consensus       570 atQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~~~~~~~-~---~r~~~~~~~~~~~~~~~  645 (744)
                      ..--=. +++...++.--...+.-.+-++.|--.-||.-=---+-.+=-..|+..|-+ |   .+..+.|+    |+|..
T Consensus       464 ~a~~~~-~~l~~~~~~~~~~~~~~~i~TKlDE~~~~G~~l~~~~~~~lp~~y~t~GQ~VPeDi~~a~~~~L----v~Ra~  538 (557)
T PRK12727        464 PANAHF-SDLDEVVRRFAHAKPQGVVLTKLDETGRFGSALSVVVDHQMPITWVTDGQRVPDDLHRANAASL----VLRLE  538 (557)
T ss_pred             ECCCCH-HHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHHHHCCCEEEECCCCCCCCCHHHCCHHHH----HHHHH
T ss_conf             688998-9999999985379987489961436787039999999968982897589828523643899999----99999


Q ss_pred             HHHHHCCCCC
Q ss_conf             9998408875
Q gi|254780606|r  646 QHLKKQGCPE  655 (744)
Q Consensus       646 ~~~~~~~~~~  655 (744)
                      +-|+.-.+|-
T Consensus       539 ~L~~~~~~~~  548 (557)
T PRK12727        539 DLRRAADKPC  548 (557)
T ss_pred             HHHHHCCCCC
T ss_conf             9764115899


No 242
>KOG0733 consensus
Probab=94.74  E-value=0.13  Score=30.01  Aligned_cols=13  Identities=46%  Similarity=0.779  Sum_probs=7.3

Q ss_pred             CEEEEEEEECCCC
Q ss_conf             1358999851654
Q gi|254780606|r  563 AGIHLIMATQRPS  575 (744)
Q Consensus       563 ~GihlilatQrp~  575 (744)
                      .|+++|-||.||+
T Consensus       646 ~gV~viaATNRPD  658 (802)
T KOG0733         646 RGVYVIAATNRPD  658 (802)
T ss_pred             CCEEEEEECCCCC
T ss_conf             4259995068976


No 243
>pfam04157 EAP30 EAP30/Vps36 family. This family includes EAP30 as well as the Vps36 protein. Vps36 is involved in Golgi to endosome trafficking. EAP30 is a subunit of the ELL complex. The ELL is an 80-kDa RNA polymerase II transcription factor. ELL interacts with three other proteins to form the complex known as ELL complex. The ELL complex is capable of increasing that catalytic rate of transcription elongation, but is unable to repress initiation of transcription by RNA polymerase II as is the case of ELL. EAP30 is thought to lead to the derepression of ELL's transcriptional inhibitory activity.
Probab=94.73  E-value=0.086  Score=31.29  Aligned_cols=91  Identities=26%  Similarity=0.283  Sum_probs=64.0

Q ss_pred             EEEEC-CCCHHHHHHHHHHHHHCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCC
Q ss_conf             99934-38988999999999840887531-11124555544445667777777660389999999974986232200000
Q gi|254780606|r  630 RVHGP-LVSDIEIEKVVQHLKKQGCPEYL-NTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRL  707 (744)
Q Consensus       630 r~~~~-~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~s~~qr~~  707 (744)
                      |..|. .||.+++.+.+..|+..|.+ |. ..+.     ++..- .-.....+.+..-...++++-..+.+|.+.|.++|
T Consensus       124 r~~g~~lvSp~Dl~~A~~~l~~Lg~~-~~l~~~~-----sg~~~-v~s~~~~e~~~~~~~il~~~~~~~~vt~~~l~~~l  196 (219)
T pfam04157       124 RARGTELVSPDDLLKACKKLEKLGLG-FKLVKVG-----SGVLV-VQSVPDSELSTDQTKILELAEELGGVTASELAEKL  196 (219)
T ss_pred             HHCCCCCCCHHHHHHHHHHHHHCCCC-EEEEEEC-----CCCEE-EEECCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             72388878999999999999975999-6999977-----97289-98568410468999999999727994899999997


Q ss_pred             CCCHHHHHHHHHHHHHCCCC
Q ss_conf             10078999999999987975
Q gi|254780606|r  708 QIGYNRAALLVERMEQEGLV  727 (744)
Q Consensus       708 ~~g~~ra~~~~~~~e~~g~~  727 (744)
                      .+-+.||-..++.||.+|++
T Consensus       197 ~ws~~~a~e~L~~~~~~G~l  216 (219)
T pfam04157       197 GWSIGRAKEVLEKAEKEGLL  216 (219)
T ss_pred             CCCHHHHHHHHHHHHHCCCE
T ss_conf             98899999999999974997


No 244
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]
Probab=94.71  E-value=0.024  Score=35.08  Aligned_cols=79  Identities=16%  Similarity=0.238  Sum_probs=63.4

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHC----CEE-------EEEEEECCCCCCCCHHHHHHCCCCEEEEECCCH
Q ss_conf             799984456876753103589999999996420----135-------899985165444414678850563057203681
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARA----AGI-------HLIMATQRPSVDVITGTIKANFPIRISFQVTSK  598 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra----~Gi-------hlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~  598 (744)
                      +=|+-|||+++|    .+.+.+.|-..+.+|+.    -||       +|+++|=.|..+-|..+|++-|...|--.-.+.
T Consensus       145 RGIlYvDEvnlL----~d~lvd~LLd~aaeG~n~vereGisi~hpa~fvligTmNPEeGeLrpqLlDRfg~~v~~~~~~~  220 (423)
T COG1239         145 RGILYVDEVNLL----DDHLVDALLDVAAEGVNDVEREGISIRHPARFLLIGTMNPEEGELRPQLLDRFGLEVDTHYPLD  220 (423)
T ss_pred             CCEEEEECCCCC----CHHHHHHHHHHHHHCCCEEEECCEEECCCCCEEEEEECCCCCCCCCHHHHHHHCCEEECCCCCC
T ss_conf             887987233435----1899999999997177403357503136761799964485446632466754111562347887


Q ss_pred             HHCCHHCCCCCHHH
Q ss_conf             11003267631688
Q gi|254780606|r  599 IDSRTILGEHGAEQ  612 (744)
Q Consensus       599 ~dsr~il~~~gae~  612 (744)
                      .+-|+.+-...++.
T Consensus       221 ~~~rv~Ii~r~~~f  234 (423)
T COG1239         221 LEERVEIIRRRLAF  234 (423)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             88889999998875


No 245
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=94.70  E-value=0.11  Score=30.63  Aligned_cols=187  Identities=17%  Similarity=0.295  Sum_probs=84.6

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECCC---------CCEECCCCCCCCEEEEEEEC
Q ss_conf             211201148469970787534479999999999856801107999--7234---------21000125775200004444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDPK---------MLELSVYDGIPHLLTPVVTN  473 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~k---------~~~~~~~~~~ph~~~~v~~~  473 (744)
                      +-+++.+.--+-+-|-.|||||++|+ +|.+|+   .|+.=++++  .|-.         +.-|-.|.-.||+-  |..+
T Consensus        38 vsl~I~~GE~~~llGpsGsGKSTllr-~i~Gl~---~p~~G~I~i~G~di~~~~~~~r~ig~vfQ~~~L~p~lt--V~eN  111 (377)
T PRK11607         38 VSLTIYKGEIFALLGASGCGKSTLLR-MLAGFE---QPSAGQIMLDGVDLSHVPPYQRPINMMFQSYALFPHMT--VEQN  111 (377)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCC--HHHH
T ss_conf             18799999899999999848999999-997699---99865999999998879866665046701265587757--5452


Q ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHCCCCCHHHHHH------------HHHHHHCCCCCCCCCCCCCCCEEEEEHHHH-H
Q ss_conf             17876899999986676999-999807786799999------------886420267766654323386799984456-8
Q gi|254780606|r  474 PKKAVMALKWAVREMEERYR-KMSHLSVRNIKSYNE------------RISTMYGEKPQGCGDDMRPMPYIVIIVDEM-A  539 (744)
Q Consensus       474 ~~~~~~~l~~~~~em~~r~~-~~~~~~~~~i~~~n~------------~~~~~~~~~~~~~~~~~~~~p~ivvviDE~-a  539 (744)
                      ........+.-..|+.+|.. ++...+   +.+|-.            |+.-.+.         +-.-|.+ ++.||= +
T Consensus       112 i~~~l~~~~~~~~e~~~rv~e~l~~v~---L~~~~~~~p~~LSGGqrQRVaiArA---------L~~~P~l-LllDEPts  178 (377)
T PRK11607        112 IAFGLKQDKLPKAEIASRVNEMLGLVH---MQEFAKRKPHQLSGGQRQRVALARS---------LAKRPKL-LLLDEPMG  178 (377)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHCCC---CHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCCE-EEECCCCC
T ss_conf             454786659998999999999985446---2766658965789868789999998---------7449978-99648754


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE----CCCHHHCCHHCCCCCH---HH
Q ss_conf             7675310358999999999642013589998516544441467885056305720----3681110032676316---88
Q gi|254780606|r  540 DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ----VTSKIDSRTILGEHGA---EQ  612 (744)
Q Consensus       540 ~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~----v~~~~dsr~il~~~ga---e~  612 (744)
                      .|-   .+--+.....|-++-+..|+-+|+.|-... +++      .+.-||+.-    +.....-+.|...+--   -.
T Consensus       179 ~LD---~~~r~~l~~~l~~l~~~~g~Tii~VTHD~~-eA~------~laDrI~Vm~~G~Ivq~GtP~Eiy~~P~~~fva~  248 (377)
T PRK11607        179 ALD---KKLRDRMQLEVVDILERVGVTCVMVTHDQE-EAM------TMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAE  248 (377)
T ss_pred             CCC---HHHHHHHHHHHHHHHHHHCCEEEEECCCHH-HHH------HHCCEEEEEECCEEEEEECHHHHHHCCCCHHHHH
T ss_conf             479---999999999999999973999999998999-999------8699999998999999968899986899858987


Q ss_pred             HCCCCCEE
Q ss_conf             56898468
Q gi|254780606|r  613 LLGRGDML  620 (744)
Q Consensus       613 l~g~gd~l  620 (744)
                      ++|.--+|
T Consensus       249 f~G~~N~l  256 (377)
T PRK11607        249 FIGSVNVF  256 (377)
T ss_pred             HCCCCCEE
T ss_conf             27935057


No 246
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=94.69  E-value=0.32  Score=27.41  Aligned_cols=147  Identities=15%  Similarity=0.213  Sum_probs=66.4

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC-CE----E-CCCCCCCCEEEEEEECHHHHHHH
Q ss_conf             120114846997078753447999999999985680110799972342-10----0-01257752000044441787689
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM-LE----L-SVYDGIPHLLTPVVTNPKKAVMA  480 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~-~~----~-~~~~~~ph~~~~v~~~~~~~~~~  480 (744)
                      +++.+.=.+.+.|..|||||++++. |++|+   .|+.=+++ ++-+. ..    . ..|++ ++++ +..+-.+.....
T Consensus        33 ~~I~~GEiv~LiG~nGaGKSTLlr~-i~Gl~---~p~~G~I~-~~~~~i~~~~~~i~~vfQ~-~~l~-~~~tV~eni~~g  105 (257)
T PRK11247         33 LHIPAGQFVAVVGRSGCGKSTLLRL-LAGLE---TPTAGDLL-AGTAPLAEAQEDTRLMFQD-ARLL-PWKKVIDNVGLG  105 (257)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEE-ECCEEHHHHHHCEEEEECC-CCCC-CCCCHHHHHHHH
T ss_conf             5887998999998998889999999-96589---88887089-8987554431100799325-6447-677899998632


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH-HHHHCCHHHH
Q ss_conf             9999986676999999807786799---------99988642026776665432338679998445687-6753103589
Q gi|254780606|r  481 LKWAVREMEERYRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD-LMMVAGKEIE  550 (744)
Q Consensus       481 l~~~~~em~~r~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~-l~~~~~~~~e  550 (744)
                      ++..  ..++-.+.+...|..+...         -.+|+.-.+.-         -.-|. +++.||=.. |-.   ...+
T Consensus       106 l~~~--~~~~~~e~l~~vgL~~~~~~~p~~LSGGqkQRvaiAraL---------~~~P~-lLlLDEPtsgLD~---~~~~  170 (257)
T PRK11247        106 LKGQ--WRDAALQALAAVGLADRANEWPAALSGGQKQRVALARAL---------IHRPR-LLLLDEPLGALDA---LTRI  170 (257)
T ss_pred             CCCC--HHHHHHHHHHHCCCCHHHHCCHHHCCHHHHHHHHHHHHH---------HCCCC-EEEEECCCCCCCH---HHHH
T ss_conf             1410--699999999985991355369444899999999999998---------45999-9998098765799---9999


Q ss_pred             HHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             9999999964201358999851654
Q gi|254780606|r  551 GAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       551 ~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ..+.-|.+..+..|+-+|+.|...+
T Consensus       171 ~i~~ll~~L~~e~g~TIi~vTHdl~  195 (257)
T PRK11247        171 EMQDLIESLWQQHGFTVLLVTHDVS  195 (257)
T ss_pred             HHHHHHHHHHHHHCCEEEEECCCHH
T ss_conf             9999999999960989999887999


No 247
>PRK05707 DNA polymerase III subunit delta'; Validated
Probab=94.65  E-value=0.36  Score=27.05  Aligned_cols=155  Identities=16%  Similarity=0.203  Sum_probs=79.0

Q ss_pred             HHHCCC-EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC--EECCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             011484-69970787534479999999999856801107999723421--000125775200004444178768999999
Q gi|254780606|r  409 LANMPH-ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML--ELSVYDGIPHLLTPVVTNPKKAVMALKWAV  485 (744)
Q Consensus       409 l~~~PH-~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~--~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~  485 (744)
                      -.+.|| .|+.|--|.||+.|-..+..+|+-.+ ++..     |+-+.  .-..+..--|--..++. +++.....    
T Consensus        18 ~~rl~HA~Lf~G~~G~GK~~lA~~~A~~LlC~~-~~~~-----~~Cg~C~sC~~~~~~~HPD~~~i~-pe~~~~~I----   86 (328)
T PRK05707         18 RGRHAHAYLLHGPAGIGKRALAERLAAFLLCEA-PQGG-----GACGSCKGCQLLAAGSHPDNFVLE-PEEADKPI----   86 (328)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCC-CCCC-----CCCCCCHHHHHHHCCCCCCEEEEE-CCCCCCCC----
T ss_conf             798220464479998679999999999984899-9998-----999888899998758999879984-26667769----


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEE
Q ss_conf             86676999999807786799999886420267766654323386799984456876753103589999999996420135
Q gi|254780606|r  486 REMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGI  565 (744)
Q Consensus       486 ~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gi  565 (744)
                                   ++..|.....++...   ...        =-|-|+|||+. |.|....   ..++-.+-- -=.-+.
T Consensus        87 -------------~IdqIR~l~~~~~~~---~~~--------g~~KV~iI~~A-e~m~~~A---aNALLKtLE-EPp~~t  137 (328)
T PRK05707         87 -------------KVDQVRELVSFVVQT---AQL--------GGRKVVLIEPA-EAMNRNA---ANALLKSLE-EPSGQT  137 (328)
T ss_pred             -------------CHHHHHHHHHHHHHC---CCC--------CCCEEEEEEHH-HHHCHHH---HHHHHHHHH-CCCCCE
T ss_conf             -------------799999999998317---667--------89579995028-7738999---999999850-789875


Q ss_pred             EEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCC
Q ss_conf             89998516544441467885056305720368111003267
Q gi|254780606|r  566 HLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILG  606 (744)
Q Consensus       566 hlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~  606 (744)
                      .+||.|..|+ .++++ |++=.- ++.|...+..+...-|-
T Consensus       138 ~fiL~t~~~~-~lLpT-I~SRCq-~~~~~~p~~e~~~~~L~  175 (328)
T PRK05707        138 VLLLISHQPS-RLLPT-IKSRCQ-QLACPLPSNEPSLQWLQ  175 (328)
T ss_pred             EEEEEECCHH-HCHHH-HHHCCE-EEECCCCCHHHHHHHHH
T ss_conf             9998609934-48258-874141-33489989999999999


No 248
>pfam00308 Bac_DnaA Bacterial dnaA protein.
Probab=94.63  E-value=0.36  Score=27.02  Aligned_cols=111  Identities=14%  Similarity=0.298  Sum_probs=59.2

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100012577520000444417876899999986676999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYR  493 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~  493 (744)
                      .+.|-|.+|+|||-+|+++...+... .++ .+++.++..                      ..   ....+....    
T Consensus        36 pl~i~G~~G~GKTHLLqA~~~~~~~~-~~~-~~v~yl~~~----------------------~~---~~~~~~~l~----   84 (219)
T pfam00308        36 PLFIYGGVGLGKTHLLHAIGNYALRN-FPN-LRVVYLTSE----------------------EF---LNDFVDALR----   84 (219)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHH-CCC-CEEEEEEHH----------------------HH---HHHHHHHHH----
T ss_conf             26998899998889999999999984-999-828884399----------------------99---998899998----


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECC
Q ss_conf             99980778679999988642026776665432338679998445687675310358999999999642013589998516
Q gi|254780606|r  494 KMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQR  573 (744)
Q Consensus       494 ~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQr  573 (744)
                            -..+..+..+...                 .=+++||.+..+.  .....+..+-.|--.-+..|-+||++..+
T Consensus        85 ------~~~~~~f~~~l~~-----------------~d~l~iDDi~~l~--~~~~~ee~lf~l~N~~~~~~~~lllts~~  139 (219)
T pfam00308        85 ------DNKIEAFKKSYRN-----------------VDLLLIDDIQFLA--GKEKTQEEFFHTFNALHENNKQIVLTSDR  139 (219)
T ss_pred             ------CCCHHHHHHHHHH-----------------CCHHHHCCHHHHC--CCHHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             ------1888899999763-----------------2336522367656--86478999999999999729869997799


Q ss_pred             CCCCCCHH
Q ss_conf             54444146
Q gi|254780606|r  574 PSVDVITG  581 (744)
Q Consensus       574 p~~~vi~~  581 (744)
                      +-.+ +..
T Consensus       140 ~p~~-l~~  146 (219)
T pfam00308       140 PPKE-LEG  146 (219)
T ss_pred             CCCC-CCC
T ss_conf             8100-245


No 249
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=94.61  E-value=0.046  Score=33.13  Aligned_cols=44  Identities=27%  Similarity=0.456  Sum_probs=31.5

Q ss_pred             CCCCCEEECCHHH---CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHH
Q ss_conf             5788732112011---48469970787534479999999999856801
Q gi|254780606|r  399 TISGESVIADLAN---MPHILVAGTTGSGKSVAINTMIMSLLYRLRPD  443 (744)
Q Consensus       399 ~~~g~~~~~dl~~---~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~  443 (744)
                      ...+.....|+.+   .+-.||.|.||||||.+|++|...| |-..|.
T Consensus        12 ~~y~g~~~IDF~~~~~~~lflI~G~nGsGKSTIlDAI~~aL-YGk~~r   58 (213)
T cd03279          12 GPFREEQVIDFTGLDNNGLFLICGPTGAGKSTILDAITYAL-YGKTPR   58 (213)
T ss_pred             CCCCCCEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHH-CCCCCC
T ss_conf             04589717848767878889998899997889999999998-388823


No 250
>COG1158 Rho Transcription termination factor [Transcription]
Probab=94.59  E-value=0.041  Score=33.50  Aligned_cols=156  Identities=22%  Similarity=0.300  Sum_probs=85.0

Q ss_pred             ECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEE----CHHHH
Q ss_conf             1120----114846997078753447999999999985680110799972342100012577520000444----41787
Q gi|254780606|r  406 IADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVT----NPKKA  477 (744)
Q Consensus       406 ~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~----~~~~~  477 (744)
                      +.||    .|.-..||..-..+||+++|+.|.-++...|+--.+=++|||-.--|-+..+..-.  +-|+.    .+-.-
T Consensus       163 viDL~~PIGkGQR~LIVAPPkaGKT~lLq~IA~aIt~N~Pe~~LiVLLIDERPEEVTdmqrsV~--geViaSTFDepp~~  240 (422)
T COG1158         163 VIDLISPIGKGQRGLIVAPPKAGKTTLLQNIANAITTNHPECELIVLLIDERPEEVTDMQRSVK--GEVVASTFDEPPSR  240 (422)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCEEEEEEEECCCCHHHHHHHHHHC--CEEEEECCCCCHHH
T ss_conf             7665265678846568669878733899999999863799649999993478067777887524--06986448886054


Q ss_pred             HHHHHHHHHHHH-HHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             689999998667-6999999807786799999886420267766654323386799984456876753103589999999
Q gi|254780606|r  478 VMALKWAVREME-ERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRL  556 (744)
Q Consensus       478 ~~~l~~~~~em~-~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~l  556 (744)
                      ..    -|.||- +|.+.+-+                                               .++++--++..|
T Consensus       241 Hv----qVAE~viEkAKRlVE-----------------------------------------------~~kDVVILLDSI  269 (422)
T COG1158         241 HV----QVAEMVIEKAKRLVE-----------------------------------------------HGKDVVILLDSI  269 (422)
T ss_pred             HH----HHHHHHHHHHHHHHH-----------------------------------------------CCCCEEEEEHHH
T ss_conf             68----999999999998887-----------------------------------------------178689996567


Q ss_pred             HHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEE-----EEECCCHHHCCHHCCCC----C-------HHHHCCCCCE
Q ss_conf             99642013589998516544441467885056305-----72036811100326763----1-------6885689846
Q gi|254780606|r  557 AQMARAAGIHLIMATQRPSVDVITGTIKANFPIRI-----SFQVTSKIDSRTILGEH----G-------AEQLLGRGDM  619 (744)
Q Consensus       557 a~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri-----~~~v~~~~dsr~il~~~----g-------ae~l~g~gd~  619 (744)
                      .++|||+-.     +.-||-.+++|.+-+|.=.|=     |-|--....|=|||...    |       -|-..|-|.|
T Consensus       270 TRLaRAYN~-----v~P~SGkvLsGGvD~nAL~~PKrFFGAARNIEeGGSLTIiATALVdTGSrMDeVIfEEFKGTGNm  343 (422)
T COG1158         270 TRLARAYNT-----VVPSSGKVLSGGVDANALHRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNM  343 (422)
T ss_pred             HHHHHHHCC-----CCCCCCCEECCCCCHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHCCCCCE
T ss_conf             789988536-----67997774048738566048355421220554586341111124414775112025342577750


No 251
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=94.59  E-value=0.03  Score=34.45  Aligned_cols=47  Identities=23%  Similarity=0.475  Sum_probs=31.0

Q ss_pred             CCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             87321120----11484699707875344799999999998568011079997234
Q gi|254780606|r  402 GESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       402 g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      |+||.-|+    .+.=.+-|.|.||||||++++.| +++   +.|+.=++ .+|-+
T Consensus        49 ~~pVLk~Isf~I~~Ge~vaIVG~sGSGKSTLl~lL-~gl---~~p~~G~I-~~~g~   99 (282)
T cd03291          49 GAPVLKNINLKIEKGEMLAITGSTGSGKTSLLMLI-LGE---LEPSEGKI-KHSGR   99 (282)
T ss_pred             CCCEEECEEEEECCCCEEEEECCCCCHHHHHHHHH-HCC---CCCCCCEE-EECCE
T ss_conf             89614164899849999999999998199999999-578---72786589-99999


No 252
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.57  E-value=0.066  Score=32.06  Aligned_cols=187  Identities=16%  Similarity=0.174  Sum_probs=81.6

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECH---------
Q ss_conf             32112011484699707875344799999999998568011079997234210001257752000044441---------
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNP---------  474 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~---------  474 (744)
                      -+-+++.+.--+.|-|..|||||++++. |++| +...--++.+--.|-+...+..+.   +.++-|.-++         
T Consensus        27 ~is~~i~~Ge~vaiiG~sGsGKSTLl~l-l~Gl-~~p~~G~I~~~g~~i~~~~~~~~~---~~ig~vfQ~p~~~~~~~tv  101 (269)
T PRK13648         27 DVSFNIPKGQWTSIVGHNGSGKSTIAKL-MIGI-EKVKSGEIFYNNQAITDDNFEKLR---KDIGIVFQNPDNQFVGSIV  101 (269)
T ss_pred             EEEEEECCCCEEEEECCCCCCHHHHHHH-HHCC-CCCCCEEEEECCEECCCCCHHHHH---HHCEEEEECHHHHCCCCHH
T ss_conf             4589985998999999999979999999-9649-799850999999999988989997---5026998871320472179


Q ss_pred             -HHHHHHHH---HHHHHHHHHHHH-HHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH
Q ss_conf             -78768999---999866769999-99807786799---------99988642026776665432338679998445687
Q gi|254780606|r  475 -KKAVMALK---WAVREMEERYRK-MSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD  540 (744)
Q Consensus       475 -~~~~~~l~---~~~~em~~r~~~-~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~  540 (744)
                       +.....+.   +-..++++|... +...+..+..+         -.+|++-.+.         +-.-|- +++.||=--
T Consensus       102 ~~~i~~gl~~~~~~~~e~~~~v~~~L~~~~l~~~~~~~p~~LSGGqkQRvaiAra---------L~~~P~-iLilDEPTs  171 (269)
T PRK13648        102 KYDVAFGLENHAVPYDEMHRRVSEALKQVDMLERADYEPNALSGGQKQRVAIASV---------LALNPS-VIILDEATS  171 (269)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHH---------HHHCCC-EEEECCCCC
T ss_conf             9999733644699999999999999987699134418964389999999999999---------975989-999818755


Q ss_pred             -HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCE
Q ss_conf             -6753103589999999996420135899985165444414678850563057203681110032676316885689846
Q gi|254780606|r  541 -LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDM  619 (744)
Q Consensus       541 -l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~  619 (744)
                       |-....+++...   |-++.+..|+-+|+.|.+.+.      ++ + --||.+==    +.+++.+ +-.+.++.+-+.
T Consensus       172 ~LD~~~~~~i~~l---l~~L~~~~~~TvI~itHdl~~------a~-~-aDrvivl~----~G~Iv~~-Gtp~Evf~~~~~  235 (269)
T PRK13648        172 MLDPDARQNLLDL---VRKVKSEHNITIISITHDLSE------AM-E-ADHVIVMN----KGTVYKE-GTATEIFDHAEE  235 (269)
T ss_pred             CCCHHHHHHHHHH---HHHHHHCCCCEEEEEEECHHH------HH-H-CCEEEEEE----CCEEEEE-CCHHHHHCCHHH
T ss_conf             4899999999999---999997379899999767899------97-1-99899998----9999997-589998779889


Q ss_pred             EE
Q ss_conf             86
Q gi|254780606|r  620 LY  621 (744)
Q Consensus       620 l~  621 (744)
                      |.
T Consensus       236 l~  237 (269)
T PRK13648        236 LT  237 (269)
T ss_pred             HH
T ss_conf             99


No 253
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.56  E-value=0.077  Score=31.62  Aligned_cols=139  Identities=24%  Similarity=0.318  Sum_probs=65.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-----CCC------------CCEECCCCCCCCEEEEEEECHHHH
Q ss_conf             699707875344799999999998568011079997-----234------------210001257752000044441787
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-----DPK------------MLELSVYDGIPHLLTPVVTNPKKA  477 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-----D~k------------~~~~~~~~~~ph~~~~v~~~~~~~  477 (744)
                      +-|.|.+|||||++|+. |.+|.   .|+.=++++-     |.+            +.-|-.|.-+||+-  |..|... 
T Consensus        26 ~~iiGpSGsGKSTll~~-i~GL~---~p~sG~I~~~G~~~~~~~~~~~~~~~~r~ig~VfQ~~~Lfp~lt--V~eNi~~-   98 (214)
T cd03297          26 TGIFGASGAGKSTLLRC-IAGLE---KPDGGTIVLNGTVLFDSRKKINLPPQQRKIGLVFQQYALFPHLN--VRENLAF-   98 (214)
T ss_pred             EEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCCCCCCCCCCCCEEEEECCCCCCCCCC--HHHHHHH-
T ss_conf             99999997359999999-98499---99964999999997665412467713487589767876578891--9999988-


Q ss_pred             HHHHHHH-HHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHHHHHC
Q ss_conf             6899999-9866769-99999807786799---------99988642026776665432338679998445-68767531
Q gi|254780606|r  478 VMALKWA-VREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADLMMVA  545 (744)
Q Consensus       478 ~~~l~~~-~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l~~~~  545 (744)
                        .|+.. ..+.+.| .+++...+..++.+         -.+|++-.+.-         -.-|.+ ++.|| |+.|--..
T Consensus        99 --~l~~~~~~~~~~~v~e~l~~~gl~~~~~~~P~~LSGGq~QRVaiARAL---------~~~P~l-lLlDEP~saLD~~~  166 (214)
T cd03297          99 --GLKRKRNREDRISVDELLDLLGLDHLLNRYPAQLSGGEKQRVALARAL---------AAQPEL-LLLDEPFSALDRAL  166 (214)
T ss_pred             --HHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHH---------HCCCCE-EEEECCCCCCCHHH
T ss_conf             --876798689999999999877997786089777992999999999998---------719999-99808876669999


Q ss_pred             CHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             035899999999964201358999851654
Q gi|254780606|r  546 GKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       546 ~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ..   ..+..|-+.-+..|+-+|+.|-.+.
T Consensus       167 ~~---~i~~~l~~l~~~~~~t~i~VTHd~~  193 (214)
T cd03297         167 RL---QLLPELKQIKKNLNIPVIFVTHDLS  193 (214)
T ss_pred             HH---HHHHHHHHHHHHHCCEEEEECCCHH
T ss_conf             99---9999999999985998999989999


No 254
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=94.56  E-value=0.17  Score=29.23  Aligned_cols=49  Identities=24%  Similarity=0.396  Sum_probs=30.2

Q ss_pred             ECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE
Q ss_conf             057887321120----11484699707875344799999999998568011079997
Q gi|254780606|r  398 KTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV  450 (744)
Q Consensus       398 ~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li  450 (744)
                      +...++.++-|+    .+.-=+.+-|.-|+|||++|+. |++++   .|+.=.+.+-
T Consensus        10 ~~~g~~~il~~vsf~i~~Gei~~l~G~NGaGKTTLlk~-i~Gl~---~p~~G~I~~~   62 (206)
T PRK13539         10 CVRGGRVVFSGLSFTLAAGEALVLTGPNGSGKTTLLRL-LAGLL---PPAAGTIKLD   62 (206)
T ss_pred             EEECCEEEECCCEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEEEC
T ss_conf             99999999815078986994999989999989999999-95887---8885189999


No 255
>PRK05580 primosome assembly protein PriA; Validated
Probab=94.54  E-value=0.11  Score=30.56  Aligned_cols=20  Identities=20%  Similarity=0.579  Sum_probs=10.6

Q ss_pred             HHCCEEEEEEEECCCCCCCC
Q ss_conf             42013589998516544441
Q gi|254780606|r  560 ARAAGIHLIMATQRPSVDVI  579 (744)
Q Consensus       560 ~ra~GihlilatQrp~~~vi  579 (744)
                      |+-.|+.|||++-.||....
T Consensus       314 a~~~~~~liLgSaTPSlEs~  333 (699)
T PRK05580        314 AKQEGCPVVLGSATPSLESL  333 (699)
T ss_pred             HHHHCCCEEECCCCCCHHHH
T ss_conf             99849988961689999999


No 256
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=94.50  E-value=0.27  Score=27.88  Aligned_cols=32  Identities=13%  Similarity=0.379  Sum_probs=24.2

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCH
Q ss_conf             14846997078753447999999999985680
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRP  442 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p  442 (744)
                      |.=-+||.|-.|+|||.+|+.+..+-.....|
T Consensus        14 k~~KililG~~~sGKTsil~~l~~~~~~~~~p   45 (174)
T cd04153          14 KEYKVIIVGLDNAGKTTILYQFLLGEVVHTSP   45 (174)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHCCCCCCCCC
T ss_conf             77999999899998899999997399277167


No 257
>PRK08058 DNA polymerase III subunit delta'; Validated
Probab=94.45  E-value=0.29  Score=27.62  Aligned_cols=152  Identities=14%  Similarity=0.167  Sum_probs=70.1

Q ss_pred             HHCCCE-EEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE--CCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             114846-997078753447999999999985680110799972342100--01257752000044441787689999998
Q gi|254780606|r  410 ANMPHI-LVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL--SVYDGIPHLLTPVVTNPKKAVMALKWAVR  486 (744)
Q Consensus       410 ~~~PH~-lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~--~~~~~~ph~~~~v~~~~~~~~~~l~~~~~  486 (744)
                      .+.||. |..|--|+||+.+-+.+...|+-.+ ++..     ++-+.--  ..+...-|--.-.+ .++...  +  -+.
T Consensus        25 ~rl~HA~Lf~Gp~G~GK~~~A~~~A~~LlC~~-~~~~-----~~Cg~C~~C~~~~~~~HPD~~~i-~p~~~~--i--~id   93 (329)
T PRK08058         25 NRLAHAYLFEGAKGTGKKATALWLAKSLFCLE-RNGV-----EPCGTCTNCKRIESGNHPDVHLV-APDGQS--I--KKD   93 (329)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCC-CCCC-----CCCCCCHHHHHHHCCCCCCEEEE-CCCCCC--C--CHH
T ss_conf             99661565578999889999999999973999-9999-----98878889999876999976774-566140--7--799


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEE
Q ss_conf             66769999998077867999998864202677666543233867999844568767531035899999999964201358
Q gi|254780606|r  487 EMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIH  566 (744)
Q Consensus       487 em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gih  566 (744)
                      .+.   .+.            +++..   ....        =.|-|+|||+.-.|...+    ..++-.+-- -=..+..
T Consensus        94 qiR---~L~------------~~~~~---~p~~--------g~~KV~II~~Ae~m~~~A----aNALLKtLE-EPp~~t~  142 (329)
T PRK08058         94 QIR---YLK------------EEFSK---SGVE--------SNKKVYIIEHADKMTASA----ANSLLKFLE-EPSGDTT  142 (329)
T ss_pred             HHH---HHH------------HHHCC---CCCC--------CCCEEEEEECHHHHCHHH----HHHHHHHHH-CCCCCCE
T ss_conf             999---999------------99643---8757--------886799973477629999----999999864-6897867


Q ss_pred             EEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCC
Q ss_conf             9998516544441467885056305720368111003267
Q gi|254780606|r  567 LIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILG  606 (744)
Q Consensus       567 lilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~  606 (744)
                      .||+|..++ .++++ |++=. -+|-|+.-+..+-...|-
T Consensus       143 fIL~t~~~~-~lLpT-I~SRC-q~i~f~~~~~~~i~~~L~  179 (329)
T PRK08058        143 AILLTENKH-QILPT-ILSRC-QVVEFRPLPPESLIQRLQ  179 (329)
T ss_pred             EEEEECCHH-HHHHH-HHHCC-EEEECCCCCHHHHHHHHH
T ss_conf             998729966-64368-86314-256588999999999999


No 258
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.44  E-value=0.04  Score=33.56  Aligned_cols=186  Identities=18%  Similarity=0.245  Sum_probs=82.6

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC-------CEE--------CCCCCCCCEEEEE
Q ss_conf             1120114846997078753447999999999985680110799972342-------100--------0125775200004
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM-------LEL--------SVYDGIPHLLTPV  470 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~-------~~~--------~~~~~~ph~~~~v  470 (744)
                      -+++.+.=-+.|.|.+|||||++++. |.+|+   .|+.=++.+ +-+.       ..+        ..|++--+.+..-
T Consensus        14 sl~i~~Ge~vaiiG~sGsGKSTLl~~-l~GLl---~P~~G~i~~-~g~~i~~~~~~~~~~~lr~~vG~VfQ~P~~ql~~~   88 (276)
T PRK13634         14 NVSIPSGSYVAIIGHTGSGKSTLLQH-LNGLL---KPTKGTVTI-GERVITAGKKNKKLKPLRKKVGIVFQFPEHQLFEE   88 (276)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEE-CCEECCCCCCHHHHHHHHHCEEEEEECCCHHCCHH
T ss_conf             77998998999999999699999999-97499---988749999-99988688866668998732689998762001551


Q ss_pred             EECHHHHHHHHHH---HHHHHHHHH-HHHHHCCCC-CHHH-H--------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHH
Q ss_conf             4441787689999---998667699-999980778-6799-9--------998864202677666543233867999844
Q gi|254780606|r  471 VTNPKKAVMALKW---AVREMEERY-RKMSHLSVR-NIKS-Y--------NERISTMYGEKPQGCGDDMRPMPYIVIIVD  536 (744)
Q Consensus       471 ~~~~~~~~~~l~~---~~~em~~r~-~~~~~~~~~-~i~~-~--------n~~~~~~~~~~~~~~~~~~~~~p~ivvviD  536 (744)
                       |-.+..+..+..   -..++++|. +++...|.. ++.. |        .+|++-...         +.--|. +++.|
T Consensus        89 -tV~e~iafg~~~~g~~~~e~~~rv~~~L~~vgL~~~~~~r~p~~LSGGqkQRVaIA~a---------La~~P~-iLllD  157 (276)
T PRK13634         89 -TVEKDICFGPMNFGVSEEEAKQKAKEMIELVGLPEELLARSPFELSGGQMRRVAIAGV---------LAMEPE-VLVLD  157 (276)
T ss_pred             -HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCC-EEEEC
T ss_conf             -5999999999986999999999999999976998778618900189999999999999---------972999-89976


Q ss_pred             HHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCC
Q ss_conf             5687-675310358999999999642013589998516544441467885056305720368111003267631688568
Q gi|254780606|r  537 EMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLG  615 (744)
Q Consensus       537 E~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g  615 (744)
                      |=.. |-.....++   +.-|.++.+..|+-+|+.|...+  .+     +.+.-||.+-    .+-++|.+.. .+.++.
T Consensus       158 EPTs~LD~~~~~~i---~~ll~~L~~e~g~Tii~vTHdl~--~~-----~~~aDrvivm----~~G~Iv~~G~-p~evf~  222 (276)
T PRK13634        158 EPTAGLDPKGRKEI---MEMFYKLHKEKGLTTVLVTHSME--DA-----ARYADQIVVM----HKGTVFLQGT-PREIFS  222 (276)
T ss_pred             CCCCCCCHHHHHHH---HHHHHHHHHHCCCEEEEECCCHH--HH-----HHHCCEEEEE----ECCEEEEECC-HHHHHC
T ss_conf             98542799999999---99999999961999999867999--99-----9979999999----8999999878-999972


Q ss_pred             CCCEEEE
Q ss_conf             9846864
Q gi|254780606|r  616 RGDMLYM  622 (744)
Q Consensus       616 ~gd~l~~  622 (744)
                      +-+.|..
T Consensus       223 ~p~~l~~  229 (276)
T PRK13634        223 HPDELEA  229 (276)
T ss_pred             CHHHHHH
T ss_conf             9999997


No 259
>pfam07088 GvpD GvpD gas vesicle protein. This family consists of several archaeal GvpD gas vesicle proteins. GvpD is thought to be involved in the regulation of gas vesicle formation.
Probab=94.44  E-value=0.068  Score=32.00  Aligned_cols=80  Identities=18%  Similarity=0.193  Sum_probs=43.1

Q ss_pred             EEEEHHHHHHHHH------HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHH
Q ss_conf             9998445687675------3103589999999996420135899985165444414678850563057203681110032
Q gi|254780606|r  531 IVIIVDEMADLMM------VAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTI  604 (744)
Q Consensus       531 ivvviDE~a~l~~------~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~i  604 (744)
                      ..|++|-+-.++.      ..+..++....+|...+|..|+|||+-.-.-...-+.-    -...=|.++|..-.+-|++
T Consensus       108 ~~Ia~DSW~~i~eyLa~r~d~pe~f~~~~n~lv~lar~~g~~Li~v~E~~~~~~LeY----ivDGVVtL~vk~d~~GR~~  183 (484)
T pfam07088       108 LTIAFDSWELIYEYLAERHDIPPDILTVTNQLVALARGSGARLVLVLETAQNSRLEY----IVDGVVTLNVKNDERGRTR  183 (484)
T ss_pred             CEEEEECHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHH----EEEEEEEEEEEECCCCCEE
T ss_conf             479983289999987776168466756665677766525945999982366775121----2303899988625678376


Q ss_pred             CCCCCHHHHCC
Q ss_conf             67631688568
Q gi|254780606|r  605 LGEHGAEQLLG  615 (744)
Q Consensus       605 l~~~gae~l~g  615 (744)
                       -.---|+|.|
T Consensus       184 -R~L~LeKLRG  193 (484)
T pfam07088       184 -RSLRLEKLRG  193 (484)
T ss_pred             -EEEEHHHHCC
T ss_conf             -7767234227


No 260
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=94.43  E-value=0.4  Score=26.70  Aligned_cols=183  Identities=17%  Similarity=0.229  Sum_probs=82.2

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHC---CHHHEEEEEECCCCC---EEC---------CCCCCCCEEEE
Q ss_conf             211201148469970787534479999999999856---801107999723421---000---------12577520000
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRL---RPDECRMIMVDPKML---ELS---------VYDGIPHLLTP  469 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~---~p~~~~~~liD~k~~---~~~---------~~~~~ph~~~~  469 (744)
                      |-+++.+.=-+-|.|.+|||||+++++|+ +|+-..   ....+.|--.|....   ++.         .|++--.-+.|
T Consensus        26 Vsf~i~~GEilgivGeSGsGKSTl~~~il-gll~~~~~~~~g~i~~~g~dl~~~~~~~~~~~~g~~i~~vfQdp~~sLnP  104 (327)
T PRK11022         26 ISYSVKQGEVVGIVGESGSGKSVSSLAIM-GLIDYPGRVMAEKLEFNGQDLQRISEKERRNLVGAEVAMIFQDPMTSLNP  104 (327)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHHHH-CCCCCCCCEEEEEEEECCEECCCCCHHHHHHHHCCCEEEEECCCHHHCCH
T ss_conf             18798899999999999878999999997-48898997654279999999774999999986377669996085132074


Q ss_pred             EEECHHHHHHHHHHH----HHHH-HHHHHHHHHCCCCCHHHH-H-----------HHHHHHHCCCCCCCCCCCCCCCEEE
Q ss_conf             444417876899999----9866-769999998077867999-9-----------9886420267766654323386799
Q gi|254780606|r  470 VVTNPKKAVMALKWA----VREM-EERYRKMSHLSVRNIKSY-N-----------ERISTMYGEKPQGCGDDMRPMPYIV  532 (744)
Q Consensus       470 v~~~~~~~~~~l~~~----~~em-~~r~~~~~~~~~~~i~~~-n-----------~~~~~~~~~~~~~~~~~~~~~p~iv  532 (744)
                      ..+--......++..    ..+. ++-.+++...|..+-..+ |           +|+.....         +---|. +
T Consensus       105 ~~tv~~~i~e~l~~~~~~~~~~~~~r~~elL~~vgl~~~~~~l~~yP~eLSGGq~QRV~IArA---------L~~~P~-l  174 (327)
T PRK11022        105 CYTVGFQIMEAIKVHQGGNKKTRRQRAIDLLNQVGIPDPASRLDVYPHQLSGGMSQRVMIAMA---------IACRPK-L  174 (327)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHCCHHHCCHHHHHHHHHHHH---------HHHCCC-E
T ss_conf             555557677788875278889999999999987158568889742855469999999999999---------970999-9


Q ss_pred             EEHHHHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEE----ECCCHHHCCHHCCC
Q ss_conf             98445687-67531035899999999964201358999851654444146788505630572----03681110032676
Q gi|254780606|r  533 IIVDEMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISF----QVTSKIDSRTILGE  607 (744)
Q Consensus       533 vviDE~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~----~v~~~~dsr~il~~  607 (744)
                      +|.||=.- |-.....++-+.   |..+-+..|+-+|+-|-...  ++     +.+--||+.    ++-.......|+..
T Consensus       175 LIaDEPTsaLD~~~q~~Il~l---l~~l~~~~g~til~ITHDl~--~v-----~~~aDri~VMy~G~iVE~G~~~~i~~~  244 (327)
T PRK11022        175 LIADEPTTALDVTIQAQIIEL---LLELQQKENMALVLITHDLA--LV-----AEAAHKIIVMYAGQVVETGDAHEIFRA  244 (327)
T ss_pred             EEECCCCCCCCHHHHHHHHHH---HHHHHHHHCCCEEEEECCHH--HH-----HHHCCEEEEEECCEEEEECCHHHHHHC
T ss_conf             998388765799999999999---99999971994899928899--99-----986998999989889997779999707


Q ss_pred             C
Q ss_conf             3
Q gi|254780606|r  608 H  608 (744)
Q Consensus       608 ~  608 (744)
                      +
T Consensus       245 P  245 (327)
T PRK11022        245 P  245 (327)
T ss_pred             C
T ss_conf             9


No 261
>cd01125 repA Hexameric Replicative Helicase RepA.  RepA is encoded by a plasmid, which is found in most Gram negative bacteria. RepA is a 5'-3' DNA helicase which can utilize ATP, GTP and CTP to a lesser extent.
Probab=94.36  E-value=0.41  Score=26.61  Aligned_cols=45  Identities=11%  Similarity=0.304  Sum_probs=32.2

Q ss_pred             EEEEHHHHHHHHH---HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             9998445687675---31035899999999964201358999851654
Q gi|254780606|r  531 IVIIVDEMADLMM---VAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       531 ivvviDE~a~l~~---~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      -+||||=|+.+..   ....++...+..+.++++.+|.++|+..---.
T Consensus       113 ~LVViDpL~~~~~~dENd~~~m~~~i~~l~~ia~~tg~aVl~vHHt~K  160 (239)
T cd01125         113 DLVVIDPLVSFHGVSENDNGAMDAVIKALRRIAAQTGAAILLVHHVRK  160 (239)
T ss_pred             CEEEECCCHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             899983817748999788999999999999999971999999706887


No 262
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.32  E-value=0.049  Score=32.93  Aligned_cols=205  Identities=16%  Similarity=0.289  Sum_probs=91.3

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC-------------CCCCCC-CEEEEE-E
Q ss_conf             1201148469970787534479999999999856801107999723421000-------------125775-200004-4
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS-------------VYDGIP-HLLTPV-V  471 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~-------------~~~~~p-h~~~~v-~  471 (744)
                      +++.+.=-+.|.|..|||||++++. |.+|+   .|..=++.+ |-+.+...             .|++.- .++... .
T Consensus        23 l~I~~Ge~vaiiG~nGsGKSTLl~~-l~Gll---~P~~G~I~v-~G~~i~~~~~~~~~~r~~vg~vfQ~p~~ql~~~tV~   97 (275)
T PRK13639         23 FKAEEGEMIAILGPNGAGKSTLFLH-FNGIL---KPSSGSVLI-KGEPIKYDKKSLLNVRKTVGIVFQNPDDQLFAPTVE   97 (275)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEE-CCEECCCCCHHHHHHHHHCEEEECCCHHHHCCCCHH
T ss_conf             8998998999999999649999999-97398---999639999-999998880659999874159933835765627199


Q ss_pred             ECHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH-
Q ss_conf             4417876899999986676999-9998077867999---------9988642026776665432338679998445687-
Q gi|254780606|r  472 TNPKKAVMALKWAVREMEERYR-KMSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD-  540 (744)
Q Consensus       472 ~~~~~~~~~l~~~~~em~~r~~-~~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~-  540 (744)
                      .+.......+.+-..++++|.. .+...|..++...         .+|++-...         +.--|- +++.||=.. 
T Consensus        98 e~i~fg~~~~g~~~~e~~~rv~~~l~~~gL~~~~~~~p~~LSGGqkqRVaiA~a---------La~~P~-iliLDEPTag  167 (275)
T PRK13639         98 EDVAFGPMNLGLSKEEVEKRVKDALKAVGMEGFERKPPHHLSGGQKKRVAIAGI---------LAMNPE-IMVLDEPTSG  167 (275)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCC-EEEECCCCCC
T ss_conf             999999998599999999999999987799456657944499999999999888---------736998-9997797554


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEE
Q ss_conf             67531035899999999964201358999851654444146788505630572036811100326763168856898468
Q gi|254780606|r  541 LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDML  620 (744)
Q Consensus       541 l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l  620 (744)
                      |-.....++...|.+|   .+ -|+-+|++|...+  .    + +.+-.||.+=-    +-++|.+..-. .++-+-|+|
T Consensus       168 LDp~~~~~i~~ll~~l---~~-~G~Tii~iTHdm~--~----~-~~~adrv~vl~----~G~iv~~G~p~-evf~~~~~l  231 (275)
T PRK13639        168 LDPMGASQIMKLLYDL---NK-EGITIIISTHDVD--L----V-PIYANKIYVLN----DGKIIKGGTPK-EIFSDSETI  231 (275)
T ss_pred             CCHHHHHHHHHHHHHH---HH-CCCEEEEECCCHH--H----H-HHHCCEEEEEE----CCEEEEECCHH-HHHCCHHHH
T ss_conf             8999999999999999---97-6999999938999--9----9-99699999998----99899987889-987499999


Q ss_pred             EECCCCCEEEEEECCCCHHHHHHHHHHHHHCCC
Q ss_conf             646898438999343898899999999984088
Q gi|254780606|r  621 YMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGC  653 (744)
Q Consensus       621 ~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~  653 (744)
                      ...+=           .-..+-++...+++.+.
T Consensus       232 ~~~~l-----------~~P~~~~l~~~L~~~~~  253 (275)
T PRK13639        232 RSANL-----------RLPRVAHLIELLNKEDN  253 (275)
T ss_pred             HHCCC-----------CCCHHHHHHHHHHHCCC
T ss_conf             97799-----------99909999999975369


No 263
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=94.30  E-value=0.27  Score=27.85  Aligned_cols=152  Identities=14%  Similarity=0.210  Sum_probs=70.7

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECCC---------CCEECCCCCCCCEEEEEEEC
Q ss_conf             211201148469970787534479999999999856801107999--7234---------21000125775200004444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDPK---------MLELSVYDGIPHLLTPVVTN  473 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~k---------~~~~~~~~~~ph~~~~v~~~  473 (744)
                      +-+++.+.--+-+-|-.|||||++|+. |.+|.   .|+.=++.+  .|..         +.-|-.|.-.||+-  |..+
T Consensus        21 vsl~i~~GE~~~llGpSGsGKSTLlr~-iaGL~---~p~sG~I~~~G~dv~~~~~~~r~Ig~vfQ~~~L~p~lt--V~eN   94 (352)
T PRK10851         21 ISLDIPSGQMVALLGPSGSGKTTLLRI-IAGLE---HQTSGHIRFHGTDVSRLHARDRKVGFVFQHYALFRHMT--VFDN   94 (352)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCCCCCCEEEEECCCHHCCCCC--HHHH
T ss_conf             376999998999999998469999999-97699---99956999999999989930084899940712145880--9999


Q ss_pred             HHHHHHHHH----HHHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH-
Q ss_conf             178768999----999866769-99999807786799---------999886420267766654323386799984456-
Q gi|254780606|r  474 PKKAVMALK----WAVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEM-  538 (744)
Q Consensus       474 ~~~~~~~l~----~~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~-  538 (744)
                      .......+.    .-..++++| .+++...+..++.+         -.+|++-.+.-         -.-|. |++.||= 
T Consensus        95 i~~gl~~~~~~~~~~~~~~~~rv~~~l~~vgL~~~~~r~p~~LSGGqrQRVaiARAL---------~~~P~-vLLLDEPt  164 (352)
T PRK10851         95 IAFGLTVLPRRERPNAAAIKAKVTQLLEMVQLAHLADRYPAQLSGGQKQRVALARAL---------AVEPQ-ILLLDEPF  164 (352)
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHH---------HCCCC-EEEEECCC
T ss_conf             987775422113768999999999999875994476099314999999999999998---------65999-99990887


Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             8767531035899999999964201358999851654
Q gi|254780606|r  539 ADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       539 a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      +.|-....   ...+..|.++-+..|+-.|+.|-..+
T Consensus       165 s~LD~~~r---~~i~~~l~~L~~e~g~T~i~VTHD~~  198 (352)
T PRK10851        165 GALDAQVR---KELRRWLRQLHEELKFTSVFVTHDQE  198 (352)
T ss_pred             CCCCHHHH---HHHHHHHHHHHHHHCCEEEEECCCHH
T ss_conf             66898999---99999999999973998999988999


No 264
>PRK08181 transposase; Validated
Probab=94.27  E-value=0.43  Score=26.48  Aligned_cols=44  Identities=14%  Similarity=0.308  Sum_probs=26.7

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHH-HHCCEEEEEEEECCCCCC
Q ss_conf             799984456876753103589999999996-420135899985165444
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQM-ARAAGIHLIMATQRPSVD  577 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~-~ra~GihlilatQrp~~~  577 (744)
                      +=++|||||.-+-+ ...+.+..+.-|... +|.   -+|+.||+|-.+
T Consensus       168 ~dLLIiDe~G~~~~-~~~~~~~lf~lI~~Rye~~---S~IITSn~~~~~  212 (269)
T PRK08181        168 FDLLILDDLAYVTK-DQAETSVLFELISARYERR---SILITANQPFGE  212 (269)
T ss_pred             CCEEEEHHCCCCCC-CHHHHHHHHHHHHHHHCCC---CEEEECCCCHHH
T ss_conf             46012201056679-9899999999999985788---889988999778


No 265
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=94.27  E-value=0.092  Score=31.09  Aligned_cols=36  Identities=22%  Similarity=0.420  Sum_probs=26.2

Q ss_pred             CCCEEECCHH----HCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             8873211201----148469970787534479999999999
Q gi|254780606|r  401 SGESVIADLA----NMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       401 ~g~~~~~dl~----~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      .|+++.-|+.    ..--+.|.|..|||||++|+.|. +++
T Consensus        20 ~~k~iL~~vs~~v~~Gei~~ilGpnGaGKSTLl~~l~-Gl~   59 (194)
T cd03213          20 SGKQLLKNVSGKAKPGELTAIMGPSGAGKSTLLNALA-GRR   59 (194)
T ss_pred             CCCEEEECCEEEEECCEEEEEECCCCCHHHHHHHHHH-CCC
T ss_conf             9998788838899088199999899951999999985-777


No 266
>PRK07399 DNA polymerase III subunit delta'; Validated
Probab=94.26  E-value=0.17  Score=29.21  Aligned_cols=183  Identities=19%  Similarity=0.280  Sum_probs=84.4

Q ss_pred             ECCCCCEEECCH-------HHCCC-EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCC--CEE
Q ss_conf             057887321120-------11484-69970787534479999999999856801107999723421000125775--200
Q gi|254780606|r  398 KTISGESVIADL-------ANMPH-ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIP--HLL  467 (744)
Q Consensus       398 ~~~~g~~~~~dl-------~~~PH-~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~p--h~~  467 (744)
                      .|+.|...+..+       .+.|| .|..|..|.||..+-..+...|+-.+.+....    ..|....    .-|  |.+
T Consensus         4 ~~iiGq~~~~~~L~~ai~~~rl~hAyLF~Gp~G~GK~~~A~~fa~~Ll~~~~~~~~~----~~ri~~~----nHPDl~~i   75 (314)
T PRK07399          4 ANLIGQPLAIELLTAAIEQNRIAPAYLFAGPEGVGRKLAALRFIEGLLSQGSPSKNI----RRRLEEG----NHPDLLWV   75 (314)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCH----HHHHHCC----CCCCEEEE
T ss_conf             312594999999999998599674487789998329999999999985789999766----5587518----99977886


Q ss_pred             EEEEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCH
Q ss_conf             00444417876899999986676999999807786799999886420267766654323386799984456876753103
Q gi|254780606|r  468 TPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGK  547 (744)
Q Consensus       468 ~~v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~  547 (744)
                      .|......+....-.+...-..++.  -...++..|...........          .. =.|-|+|||+.- .|...  
T Consensus        76 ~P~~~~~g~~~~~~~~~~~~~~~~~--~~~I~idqIR~l~~~l~~~p----------~~-~~~kVvII~~ae-~m~~~--  139 (314)
T PRK07399         76 EPTYQHQGKLITASEAEEAGLKRKS--PPQIRLEQIREIKRFLSRPP----------LE-APRKVVVIEDAE-TMNEA--  139 (314)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHCCC--CCCCCHHHHHHHHHHHCCCC----------CC-CCCEEEEECCHH-HCCHH--
T ss_conf             0562003454557789876530268--77787999999999973188----------56-884799988978-71999--


Q ss_pred             HHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCH
Q ss_conf             589999999996420135899985165444414678850563057203681110032676316
Q gi|254780606|r  548 EIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGA  610 (744)
Q Consensus       548 ~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~ga  610 (744)
                       ...++-.+--- =.-++ +||.|..|+ .++++ |++-. -+|-|+--+..+=..+|...|.
T Consensus       140 -AaNaLLKtLEE-P~~~~-fILit~~~~-~lLpT-I~SRC-Q~i~F~~l~~~~i~~~L~~~~~  196 (314)
T PRK07399        140 -AANALLKTLEE-PGNGT-LILIAPSPE-SLLPT-IVSRC-QIIPFYRLSDEQLEQVLKRLGD  196 (314)
T ss_pred             -HHHHHHHHHCC-CCCCE-EEEEECCHH-HCCHH-HHCCC-EEEECCCCCHHHHHHHHHHCCC
T ss_conf             -99999986147-87856-999979936-49146-64187-5633899899999999997166


No 267
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=94.25  E-value=0.43  Score=26.46  Aligned_cols=74  Identities=22%  Similarity=0.331  Sum_probs=50.0

Q ss_pred             EEEEHHHHHHHHHHCCH--------HHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHH--CCCCEEEEECCCHHH
Q ss_conf             99984456876753103--------58999999999642013589998516544441467885--056305720368111
Q gi|254780606|r  531 IVIIVDEMADLMMVAGK--------EIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKA--NFPIRISFQVTSKID  600 (744)
Q Consensus       531 ivvviDE~a~l~~~~~~--------~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~--n~~~ri~~~v~~~~d  600 (744)
                      -||+|||+-.++...+.        -+-..+..+-..-+.-++++|.||.||+  .|..-+.-  -|.-+|-|-..+...
T Consensus       337 ~iifiDEiDs~~~~r~~~~~~~~~rv~~~ll~~~d~~e~~~~v~vi~aTN~p~--~ld~a~lR~gRfd~~i~v~~pd~~~  414 (494)
T COG0464         337 SIIFIDEIDSLASGRGPSEDGSGRRVVGQLLTELDGIEKAEGVLVIAATNRPD--DLDPALLRPGRFDRLIYVPLPDLEE  414 (494)
T ss_pred             CEEEHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCC--CCCHHHHCCCCCEEEEEECCCCHHH
T ss_conf             88974886667412899876379999999999974754437648996479833--2687562436630378717989899


Q ss_pred             CCHHCC
Q ss_conf             003267
Q gi|254780606|r  601 SRTILG  606 (744)
Q Consensus       601 sr~il~  606 (744)
                      ...|+.
T Consensus       415 r~~i~~  420 (494)
T COG0464         415 RLEIFK  420 (494)
T ss_pred             HHHHHH
T ss_conf             999999


No 268
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=94.25  E-value=0.058  Score=32.43  Aligned_cols=36  Identities=31%  Similarity=0.439  Sum_probs=22.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCC-HHHEEEEEEC
Q ss_conf             699707875344799999999998568-0110799972
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLR-PDECRMIMVD  451 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~-p~~~~~~liD  451 (744)
                      +-|||.+|||||++-+. |..++.+.. ...+.++-.|
T Consensus         2 IGIaG~sgSGKST~a~~-l~~~l~~~~~~~~v~ii~~D   38 (220)
T cd02025           2 IGIAGSVAVGKSTTARV-LQALLSRWPDHPNVELITTD   38 (220)
T ss_pred             EEEECCCCCCHHHHHHH-HHHHHHHCCCCCCEEEEECC
T ss_conf             89788998779999999-99986002699948999787


No 269
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.24  E-value=0.092  Score=31.07  Aligned_cols=43  Identities=21%  Similarity=0.441  Sum_probs=28.1

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             887321120----11484699707875344799999999998568011079
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      .+++++-|+    .+.=.+.|.|.+|||||++++.| ++|+   .|.+=++
T Consensus        12 ~~~~iL~~isl~i~~Ge~v~ivG~sGsGKSTLl~ll-~gl~---~p~~G~I   58 (236)
T cd03253          12 PGRPVLKDVSFTIPAGKKVAIVGPSGSGKSTILRLL-FRFY---DVSSGSI   58 (236)
T ss_pred             CCCCEEECEEEEECCCCEEEEECCCCCCHHHHHHHH-CCCC---CCCCCEE
T ss_conf             799633056899869999999999999899999997-4385---4887489


No 270
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.22  E-value=0.051  Score=32.85  Aligned_cols=208  Identities=20%  Similarity=0.249  Sum_probs=93.5

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--CCCC----EEC--------CCCCCC-CEEEE
Q ss_conf             21120114846997078753447999999999985680110799972--3421----000--------125775-20000
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--PKML----ELS--------VYDGIP-HLLTP  469 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~k~~----~~~--------~~~~~p-h~~~~  469 (744)
                      |-+++.+.=-+.|.|..|||||++++. |.+|+   .|+.=++.+-+  ....    .+.        .|++-. .++..
T Consensus        26 Vsl~i~~Ge~~aiiG~nGsGKSTLl~~-l~Gl~---~p~~G~i~~~g~~i~~~~~~~~~~~~~~~iG~vfQ~p~~ql~~~  101 (280)
T PRK13649         26 VNLDILDGSYTAFIGHTGSGKSTIMQL-LNGLH---VPTTGIVSVDDTDITSHSKNKEIKSIRKKVGLVFQFPESQLFEE  101 (280)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCCHHHHHHHHHHEEEEEECCCCCCCCC
T ss_conf             268987998999995999869999999-96699---98860899999998777820139999876469974652123603


Q ss_pred             EEECHHHHHHHHH---HHHHHHHHHH-HHHHHCCCC-CHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEH
Q ss_conf             4444178768999---9998667699-999980778-6799---------999886420267766654323386799984
Q gi|254780606|r  470 VVTNPKKAVMALK---WAVREMEERY-RKMSHLSVR-NIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIV  535 (744)
Q Consensus       470 v~~~~~~~~~~l~---~~~~em~~r~-~~~~~~~~~-~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvvi  535 (744)
                      .+  .++.+-.++   .-..++++|. +.+...|.. ++.+         =.+|+.-...         +.--|.| ++.
T Consensus       102 tV--~eev~fg~~~~g~~~~e~~~~v~~~l~~~gL~e~~~~r~p~~LSGGqkqRvaiA~a---------L~~~P~i-Lll  169 (280)
T PRK13649        102 TV--LKDVAFGPQNFGVSPEEAEALAREKLALVGISENLFEKNPFELSGGQMRRVAIAGI---------LAMEPKI-LVL  169 (280)
T ss_pred             HH--HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHHHHHHHHHH---------HHCCCCE-EEE
T ss_conf             09--99998689886999999999999999876997466542900099999999999999---------9749999-998


Q ss_pred             HHHH-HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHC
Q ss_conf             4568-767531035899999999964201358999851654444146788505630572036811100326763168856
Q gi|254780606|r  536 DEMA-DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLL  614 (744)
Q Consensus       536 DE~a-~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~  614 (744)
                      ||=. .|-....+++...|.+|    +..|+-+|+.|.+.+  .+     +++--||.+=-    +-++|.+..- +.++
T Consensus       170 DEPTsgLDp~~~~~i~~ll~~l----~~~G~Tii~vTHdl~--~v-----~~~aDrv~vl~----~G~iv~~G~p-~evf  233 (280)
T PRK13649        170 DEPTAGLDPKGRKELMTIFKKL----HQSGMTIVLVTHLMD--DV-----ANYADFVYVLE----KGKIVLSGKP-KDIF  233 (280)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHH----HHCCCEEEEECCCHH--HH-----HHHCCEEEEEE----CCEEEEECCH-HHHH
T ss_conf             4875548999999999999999----863999999875899--99-----99799999998----9999998789-9997


Q ss_pred             CCCCEEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             89846864689843899934389889999999998408875
Q gi|254780606|r  615 GRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPE  655 (744)
Q Consensus       615 g~gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~  655 (744)
                      .+=|+|           +...+.-..+-++...++..|.+.
T Consensus       234 ~~~~~l-----------~~~~l~~P~~~~~~~~L~~~g~~~  263 (280)
T PRK13649        234 QQVSFL-----------EKKQLGVPKITKFAQRLVDRGIPF  263 (280)
T ss_pred             CCHHHH-----------HHCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             598999-----------877999991999999999759999


No 271
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=94.18  E-value=0.43  Score=26.47  Aligned_cols=47  Identities=21%  Similarity=0.321  Sum_probs=30.2

Q ss_pred             ECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             057887321120----114846997078753447999999999985680110799
Q gi|254780606|r  398 KTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       398 ~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      +...|+.++-|+    .+.-.+-|.|..|||||++++. |++++   .|+.=+++
T Consensus        19 ~~y~~~~vL~~vsl~i~~Ge~~~liG~NGaGKSTLl~~-l~gl~---~p~~G~I~   69 (265)
T PRK10575         19 FRVPGRTLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKM-LGRHQ---PPSEGEIL   69 (265)
T ss_pred             EEECCEEEEECEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEE
T ss_conf             99899998815088987998999999999809999999-95688---99873899


No 272
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=94.17  E-value=0.13  Score=30.02  Aligned_cols=153  Identities=20%  Similarity=0.329  Sum_probs=67.4

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE--ECCCCCEEC--------CCCCCCC-EEEE-EEE
Q ss_conf             211201148469970787534479999999999856801107999--723421000--------1257752-0000-444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM--VDPKMLELS--------VYDGIPH-LLTP-VVT  472 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l--iD~k~~~~~--------~~~~~ph-~~~~-v~~  472 (744)
                      +-+.+.+.-.+-+.|..|+|||++|+.| ++|+   .|+.=++.+  .|.+.....        .+++.-+ ++.. |..
T Consensus        20 vsl~i~~Gei~~iiG~nGaGKSTLlk~i-~Gl~---~p~~G~I~~~g~~i~~~~~~~~~~~ig~v~Q~p~~~~~~~tv~e   95 (211)
T cd03225          20 ISLTIKKGEFVLIVGPNGSGKSTLLRLL-NGLL---GPTSGEVLVDGKDLTKLSLKELRRKVGLVFQNPDDQFFGPTVEE   95 (211)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHH-HCCC---CCCCCCEEECCEECCCCCHHHHHCCEEEEEECCHHHCCCCCHHH
T ss_conf             1788849979999889999899999999-6467---79888778999999979989984038999778325305586999


Q ss_pred             CHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHH-H
Q ss_conf             4178768999999866769-999998077867999---------9988642026776665432338679998445687-6
Q gi|254780606|r  473 NPKKAVMALKWAVREMEER-YRKMSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMAD-L  541 (744)
Q Consensus       473 ~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~-l  541 (744)
                      +.........+-..++.+| .+++...+..++...         .+|+.-.+.-         -.-|. +++.||=.- |
T Consensus        96 ~i~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGqkQrv~iAral---------~~~P~-ililDEPTsgL  165 (211)
T cd03225          96 EVAFGLENLGLPEEEIEERVEEALELVGLEGLRDRSPFTLSGGQKQRVAIAGVL---------AMDPD-ILLLDEPTAGL  165 (211)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHH---------HCCCC-EEEEECCCCCC
T ss_conf             999999986999999999999999986994666389545999899999999999---------75999-99997985558


Q ss_pred             HHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             7531035899999999964201358999851654
Q gi|254780606|r  542 MMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       542 ~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      -.....++...|.+|.+    -|+-+|+.|.+.+
T Consensus       166 D~~~~~~i~~~l~~l~~----~g~tii~itHdl~  195 (211)
T cd03225         166 DPAGRRELLELLKKLKA----EGKTIIIVTHDLD  195 (211)
T ss_pred             CHHHHHHHHHHHHHHHH----CCCEEEEEECCHH
T ss_conf             99999999999999997----8999999925999


No 273
>TIGR02868 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydC; InterPro: IPR014223   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents CydC, a member of a heterodimeric ATP-binding cassette-type transporter (ABC transporter). It is involved in the export of glutathione from the cytoplasm to the periplasm and is required for the assembly of both cytochrome c and cytochrome bd , , .; GO: 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane.
Probab=94.16  E-value=0.04  Score=33.58  Aligned_cols=64  Identities=30%  Similarity=0.398  Sum_probs=43.8

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--CC---CCEE----CCCCCCCCEEEEEE
Q ss_conf             321120114846997078753447999999999985680110799972--34---2100----01257752000044
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--PK---MLEL----SVYDGIPHLLTPVV  471 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~k---~~~~----~~~~~~ph~~~~v~  471 (744)
                      -|-.||...=|+.|-|.+|+|||++|++ |++++   .|.+=++.|=|  +.   ..|+    +++..-+|+|.--|
T Consensus       379 ~V~L~l~~G~r~Ai~G~SG~GKsTLL~~-L~G~l---~P~~G~vtl~G~~~~~~~~~evrr~v~~~aQ~aHlF~ttv  451 (566)
T TIGR02868       379 GVSLDLPPGERVAILGPSGSGKSTLLAT-LAGLL---DPLQGEVTLDGVPVSSLSEDEVRRRVSVFAQDAHLFDTTV  451 (566)
T ss_pred             CCCCCCCCCCCEEEECCCCCCHHHHHHH-HHHHC---CCCCCCEEECCCCHHHCCCCHHEHHEEECCCCCCCCCCCH
T ss_conf             7864113886089866887657899999-98402---8999917877732432573110000031278862110547


No 274
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=94.15  E-value=0.36  Score=27.03  Aligned_cols=27  Identities=26%  Similarity=0.535  Sum_probs=19.3

Q ss_pred             HCCC--EEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             1484--69970787534479999999999
Q gi|254780606|r  411 NMPH--ILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       411 ~~PH--~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      ..|-  +.|-|..|.|||.+|+++|-...
T Consensus        36 epPP~vVavvGPpgvGKtTLiksLvk~yt   64 (225)
T cd01882          36 EPPPLVVAVVGPPGVGKTTLIKSLVKNYT   64 (225)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             99996999989899778899999999985


No 275
>TIGR00174 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2.5.1.8 from EC also known as tRNA delta(2)-isopentenylpyrophosphate transferases or IPP transferases. These enzymes modify both cytoplasmic and mitochondrial tRNAs at A(37) to give isopentenyl A(37) .; GO: 0004811 tRNA isopentenyltransferase activity, 0005524 ATP binding, 0008033 tRNA processing.
Probab=94.10  E-value=0.14  Score=29.78  Aligned_cols=68  Identities=26%  Similarity=0.366  Sum_probs=39.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC----CCCCEE-------CCCCCCCCEEEEEEECHH--HHHHHH
Q ss_conf             6997078753447999999999985680110799972----342100-------012577520000444417--876899
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD----PKMLEL-------SVYDGIPHLLTPVVTNPK--KAVMAL  481 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD----~k~~~~-------~~~~~~ph~~~~v~~~~~--~~~~~l  481 (744)
                      +.|+|+|+||||.+    ...|..+   =.+.+|=+|    .|+.+-       .-..++||++.-++.-.+  .+...-
T Consensus         2 i~i~GpTAvGKs~L----~i~La~~---lnaEiI~~DS~qiYK~~dIgtaKp~~~e~~~ipH~l~Dildp~e~y~~~~F~   74 (307)
T TIGR00174         2 IVIMGPTAVGKSNL----AIQLAKK---LNAEIISVDSMQIYKGMDIGTAKPSLQERKGIPHHLIDILDPSESYSAADFQ   74 (307)
T ss_pred             EEEEECCCCCHHHH----HHHHHHH---CCEEEEECCCHHHHCCCCCCCCCCCHHHHCCCCCEEEECCCCCCCCCCHHHH
T ss_conf             67740885547789----9998876---8957874350232237875357889687534981585134712003708899


Q ss_pred             HHHHHHHH
Q ss_conf             99998667
Q gi|254780606|r  482 KWAVREME  489 (744)
Q Consensus       482 ~~~~~em~  489 (744)
                      ..+..+|.
T Consensus        75 ~~~~~~~~   82 (307)
T TIGR00174        75 TQALNAIA   82 (307)
T ss_pred             HHHHHHHH
T ss_conf             99999999


No 276
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=94.10  E-value=0.47  Score=26.25  Aligned_cols=36  Identities=19%  Similarity=0.394  Sum_probs=25.0

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             1148469970787534479999999999856801107999
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      .+.-=..+.|.-|||||++|+. |++++   .|+.=++.+
T Consensus        24 ~~G~i~~i~G~NGsGKSTLlk~-i~Gl~---~p~~G~I~~   59 (195)
T PRK13541         24 LPSAITYIKGANGCGKSSLLRM-IAGIM---QPSSGNIYY   59 (195)
T ss_pred             CCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEEE
T ss_conf             7997999999999819999999-96798---898408999


No 277
>KOG1384 consensus
Probab=94.09  E-value=0.47  Score=26.25  Aligned_cols=53  Identities=30%  Similarity=0.495  Sum_probs=31.5

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC----CCCCEE-------CCCCCCCCEEEEEEEC
Q ss_conf             46997078753447999999999985680110799972----342100-------0125775200004444
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD----PKMLEL-------SVYDGIPHLLTPVVTN  473 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD----~k~~~~-------~~~~~~ph~~~~v~~~  473 (744)
                      -+.|.|+||||||    -+.+-|+.+..-+   +|--|    .||.+.       ..-.+.||++..++..
T Consensus         9 VvvI~G~TGsGKS----rLaVdLA~rf~~E---IINsDkmQvYkGldivTnK~t~~e~~gVPHHLlg~l~~   72 (348)
T KOG1384           9 VVVIMGATGAGKS----RLAVDLATRFPGE---IINSDKMQVYKGLDIVTNKITLQERKGVPHHLLGHLHP   72 (348)
T ss_pred             EEEEECCCCCCHH----HHHHHHHHHCCCE---EECCCCEEEECCCCCCCCCCCHHHCCCCCHHHHCCCCH
T ss_conf             9999557777704----6678889757864---65156335632766201668755407987677076886


No 278
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR005751    The DNA helicase PcrA is found mainly in Gram-positive bacteria and belongs to a superfamily of helicases, together with Rep and UvrD helicases from Escherichia coli. The action of the 3'5' bacterial DNA helicase is based upon two separate but coupled activities, ssDNA translocation and duplex destabilisation, and is driven by energy derived from the continuous ATP-binding and hydrolysis events that take place in the active-site cleft. The resulting conformational changes that accompany these events underpin the coupling process and allow the helicase to translocate along the DNA, destabilising the duplex and separating the two strands in an active process .; GO: 0004003 ATP-dependent DNA helicase activity, 0006268 DNA unwinding during replication, 0005737 cytoplasm.
Probab=94.08  E-value=0.13  Score=30.05  Aligned_cols=31  Identities=32%  Similarity=0.512  Sum_probs=26.7

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             11484699707875344799999999998568
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLR  441 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~  441 (744)
                      ...|=|++||| |||||=.|-+=|..|+..+.
T Consensus        16 t~GPLLi~AGA-GSGKTRVLThRIA~L~~e~~   46 (811)
T TIGR01073        16 TEGPLLIMAGA-GSGKTRVLTHRIAHLLAEKN   46 (811)
T ss_pred             CCCCCEEEECC-CCCCCHHHHHHHHHHHHHCC
T ss_conf             37841010137-88731057899999997223


No 279
>PRK06893 DNA replication initiation factor; Validated
Probab=94.07  E-value=0.13  Score=29.96  Aligned_cols=30  Identities=23%  Similarity=0.325  Sum_probs=23.7

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             148469970787534479999999999856
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRL  440 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~  440 (744)
                      ..+++.|.|..|+|||-+|+++.-.....+
T Consensus        38 ~~~~l~i~G~~gsGKTHLLqa~~~~~~~~~   67 (229)
T PRK06893         38 KQPFFYIWGGKSSGKSHLLKAVSNHYLLNQ   67 (229)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             698799989999988999999999999718


No 280
>PRK11701 phnK phosphonates transport ATP-binding protein; Provisional
Probab=94.05  E-value=0.47  Score=26.19  Aligned_cols=43  Identities=28%  Similarity=0.382  Sum_probs=29.0

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             73211201148469970787534479999999999856801107999
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      +-|-+++.+.=-+-|.|..|||||++++. |++++   .|+.=++.+
T Consensus        23 ~~Vs~~v~~GEi~~iiG~nGaGKSTLl~~-i~G~~---~p~~G~I~~   65 (258)
T PRK11701         23 RDVSFDLYPGEVLGIVGESGSGKTTLLNA-LSARL---APDAGEVHY   65 (258)
T ss_pred             CCEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEEE
T ss_conf             12277887997999988899889999999-85678---888873997


No 281
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.02  E-value=0.19  Score=28.87  Aligned_cols=152  Identities=15%  Similarity=0.271  Sum_probs=68.1

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--CCC---CEE-------C-CCCCCCCEEE--EE
Q ss_conf             1120114846997078753447999999999985680110799972--342---100-------0-1257752000--04
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--PKM---LEL-------S-VYDGIPHLLT--PV  470 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~k~---~~~-------~-~~~~~ph~~~--~v  470 (744)
                      -+++.+.=-+-|.|..|||||++|+. |.+|+   .|+.=++++-+  ...   -++       + .|+ -++++.  .|
T Consensus        21 sl~i~~Ge~~~iiGpsGsGKSTLl~~-i~gl~---~p~~G~I~~~g~~i~~~~~~~l~~~R~~ig~vfQ-~~~l~~~ltV   95 (241)
T cd03256          21 SLSINPGEFVALIGPSGAGKSTLLRC-LNGLV---EPTSGSVLIDGTDINKLKGKALRQLRRQIGMIFQ-QFNLIERLSV   95 (241)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCHHHHHHHHCCCEEECC-CCCCCCCCCH
T ss_conf             88999998999999998339999999-97499---9985599999999898998999998649189807-9978998899


Q ss_pred             EECHHHHH----HHHHHH-----HHHHHHHHHHHHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEE
Q ss_conf             44417876----899999-----9866769999998077867999---------99886420267766654323386799
Q gi|254780606|r  471 VTNPKKAV----MALKWA-----VREMEERYRKMSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIV  532 (744)
Q Consensus       471 ~~~~~~~~----~~l~~~-----~~em~~r~~~~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~iv  532 (744)
                      ..+.....    ..++..     ..+.++-...+...|..+....         .+|+.-.+.         +-.-|.| 
T Consensus        96 ~enV~~g~~~~~~~~~~~~~~~~~~~~~~~~~~L~~vgl~~~~~~~~~~LSGGq~QRVaIARA---------L~~~P~i-  165 (241)
T cd03256          96 LENVLSGRLGRRSTWRSLFGLFPKEEKQRALAALERVGLLDKAYQRADQLSGGQQQRVAIARA---------LMQQPKL-  165 (241)
T ss_pred             HHHHHHHHHCCCHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHH---------HHCCCCE-
T ss_conf             999863654133055776179959999999999997699778767844148028999999999---------8559998-


Q ss_pred             EEHHHHH-HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             9844568-767531035899999999964201358999851654
Q gi|254780606|r  533 IIVDEMA-DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       533 vviDE~a-~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ++.||=. .|-.....++.+   -|..+.+..|+-+|+.|..++
T Consensus       166 ll~DEPts~LD~~~~~~i~~---ll~~l~~~~g~Tii~vtHdl~  206 (241)
T cd03256         166 ILADEPVASLDPASSRQVMD---LLKRINREEGITVIVSLHQVD  206 (241)
T ss_pred             EEECCCCCCCCHHHHHHHHH---HHHHHHHHCCCEEEEECCCHH
T ss_conf             99628766589999999999---999999851989999957989


No 282
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=94.00  E-value=0.24  Score=28.25  Aligned_cols=44  Identities=23%  Similarity=0.401  Sum_probs=30.7

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             2112011484699707875344799999999998568011079997234
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      +-+++.+.-.+-+.|..|||||++|+ +|++|+   .|+.=.+ .++-+
T Consensus        41 isf~i~~GeivgilG~NGaGKSTLl~-~i~Gl~---~p~~G~I-~i~G~   84 (224)
T cd03220          41 VSFEVPRGERIGLIGRNGAGKSTLLR-LLAGIY---PPDSGTV-TVRGR   84 (224)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCCEE-EECCE
T ss_conf             07898389899999799981999999-997587---7787769-99989


No 283
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]
Probab=93.97  E-value=0.49  Score=26.09  Aligned_cols=146  Identities=12%  Similarity=0.106  Sum_probs=73.2

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHH
Q ss_conf             14846997078753447999999999985680110799972342100012577520000444417876899999986676
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEE  490 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~  490 (744)
                      +.=-++|+|-.|.|||.++--+...|.  .--+-+.-.++.|+++-.-          ..-.+++.+..-|+.+..-|. 
T Consensus        88 ~g~~~~~~gdsg~GKttllL~l~Iala--aG~~lfG~~v~epGkvlyv----------slEl~re~~L~Rl~~v~a~mg-  154 (402)
T COG3598          88 KGYVSILYGDSGVGKTTLLLYLCIALA--AGKNLFGNKVKEPGKVLYV----------SLELYREDILERLEPVRARMG-  154 (402)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHH--HHHHHHCCCCCCCCEEEEE----------EECCCHHHHHHHHHHHHHHCC-
T ss_conf             170589844886237689999999998--6477745335588807999----------822686889999999998709-


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHCCCC-----CCCCCCCCCCCEEEEEHHHHHHHHHH---CCHHHHHHHHHHHHHHHC
Q ss_conf             9999998077867999998864202677-----66654323386799984456876753---103589999999996420
Q gi|254780606|r  491 RYRKMSHLSVRNIKSYNERISTMYGEKP-----QGCGDDMRPMPYIVIIVDEMADLMMV---AGKEIEGAIQRLAQMARA  562 (744)
Q Consensus       491 r~~~~~~~~~~~i~~~n~~~~~~~~~~~-----~~~~~~~~~~p~ivvviDE~a~l~~~---~~~~~e~~~~~la~~~ra  562 (744)
                          +.-..+||++..|...+......-     ..-...+...-+-+||||-+.++...   ....+...|...-+++|.
T Consensus       155 ----LsPadvrn~dltd~~Gaa~~~d~l~pkl~rRfek~~~Q~rp~~vViDp~v~f~~G~s~s~vqv~~fi~~~rkla~~  230 (402)
T COG3598         155 ----LSPADVRNMDLTDVSGAADESDVLSPKLYRRFEKILEQKRPDFVVIDPFVAFYEGKSISDVQVKEFIKKTRKLARN  230 (402)
T ss_pred             ----CCHHHHHHEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCHHHHCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             ----9857632200002456787200105899999999998747874997344542277411168999999999999986


Q ss_pred             CEEEEEEEECC
Q ss_conf             13589998516
Q gi|254780606|r  563 AGIHLIMATQR  573 (744)
Q Consensus       563 ~GihlilatQr  573 (744)
                      .++|+|++.-.
T Consensus       231 l~caIiy~hHt  241 (402)
T COG3598         231 LECAIIYIHHT  241 (402)
T ss_pred             CCCEEEEEECC
T ss_conf             27739999445


No 284
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.97  E-value=0.29  Score=27.63  Aligned_cols=152  Identities=18%  Similarity=0.243  Sum_probs=69.6

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE--CCCC--CEEC-CCCCCCCEEE--EEEECHHHHH
Q ss_conf             112011484699707875344799999999998568011079997--2342--1000-1257752000--0444417876
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV--DPKM--LELS-VYDGIPHLLT--PVVTNPKKAV  478 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li--D~k~--~~~~-~~~~~ph~~~--~v~~~~~~~~  478 (744)
                      -+++.+.--+-|.|..|||||++|+ +|.+|+   .|+.=++.+-  |.+.  -..+ .|++ +.++.  .|..+.....
T Consensus        24 sl~i~~Ge~~~iiGpsGsGKSTLl~-~i~Gl~---~p~~G~I~~~G~~i~~~~~~ig~vfQ~-~~L~p~~tv~eni~~~l   98 (220)
T cd03293          24 SLSVEEGEFVALVGPSGCGKSTLLR-IIAGLE---RPTSGEVLVDGEPVTGPGPDRGYVFQQ-DALLPWLTVLDNVALGL   98 (220)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCCEEEECCEECCCCCCCEEEEECC-CCCCCCCCHHHHHHHHH
T ss_conf             8898799899999999957999999-997599---988738999999678889887999248-85377887999998899


Q ss_pred             HHHHHHHHHHHHH-HHHHHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH-HHHHHCCH
Q ss_conf             8999999866769-99999807786799---------9998864202677666543233867999844568-76753103
Q gi|254780606|r  479 MALKWAVREMEER-YRKMSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA-DLMMVAGK  547 (744)
Q Consensus       479 ~~l~~~~~em~~r-~~~~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a-~l~~~~~~  547 (744)
                      ....+-..++.+| .+++...|..+...         -.+|++-.+.-         -.-|. +++.||=. .|-.....
T Consensus        99 ~~~~~~~~~~~~~v~~~l~~~gL~~~~~~~p~~LSGGqkQRvaiARaL---------~~~P~-llllDEPts~LD~~~~~  168 (220)
T cd03293          99 ELQGVPKAEARERAEELLELVGLSGFENAYPHQLSGGMRQRVALARAL---------AVDPD-VLLLDEPFSALDALTRE  168 (220)
T ss_pred             HHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHH---------HCCCC-EEEEECCCCCCCHHHHH
T ss_conf             865999899999999999987895476189312999999999999998---------66999-99980887656999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             5899999999964201358999851654
Q gi|254780606|r  548 EIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       548 ~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                         ..+..|...-+..|+-+|+.|...+
T Consensus       169 ---~i~~~l~~l~~~~g~tii~vTHdl~  193 (220)
T cd03293         169 ---QLQEELLDIWRETGKTVLLVTHDID  193 (220)
T ss_pred             ---HHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             ---9999999999851999999888899


No 285
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=93.97  E-value=0.23  Score=28.35  Aligned_cols=40  Identities=28%  Similarity=0.458  Sum_probs=27.5

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             11201148469970787534479999999999856801107999
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      -+++.+.--+-|.|..|||||++++. |.+|+   .|+.=++.+
T Consensus        25 sl~i~~Ge~~~iiG~sGsGKSTLl~~-i~Gl~---~p~~G~I~~   64 (228)
T cd03257          25 SFSIKKGETLGLVGESGSGKSTLARA-ILGLL---KPTSGSIIF   64 (228)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEEE
T ss_conf             78986998999999999869999999-97289---878866998


No 286
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.94  E-value=0.29  Score=27.69  Aligned_cols=39  Identities=26%  Similarity=0.405  Sum_probs=25.3

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             1120114846997078753447999999999985680110799
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      -+++.+.-=+-+.|.-|||||++++. |++++   .|+.=++.
T Consensus        20 sl~i~~Gei~gl~G~NGaGKSTLl~~-i~Gl~---~p~~G~i~   58 (173)
T cd03230          20 SLTVEKGEIYGLLGPNGAGKTTLIKI-ILGLL---KPDSGEIK   58 (173)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEE
T ss_conf             87887993999987899799999999-97685---77878899


No 287
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.94  E-value=0.26  Score=27.96  Aligned_cols=32  Identities=13%  Similarity=0.359  Sum_probs=22.7

Q ss_pred             CCEEECCH----HHCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             87321120----114846997078753447999999
Q gi|254780606|r  402 GESVIADL----ANMPHILVAGTTGSGKSVAINTMI  433 (744)
Q Consensus       402 g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i  433 (744)
                      .+.++-|+    .+.--+.|-|..|||||++|+.|.
T Consensus        19 ~~~vL~~is~~i~~Ge~~~llGpnGaGKSTLl~~l~   54 (192)
T cd03232          19 KRQLLNNISGYVKPGTLTALMGESGAGKTTLLDVLA   54 (192)
T ss_pred             CEEEEECCEEEEECCEEEEEECCCCCCHHHHHHHHH
T ss_conf             679998838899288399999999998899999983


No 288
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.93  E-value=0.087  Score=31.25  Aligned_cols=58  Identities=21%  Similarity=0.251  Sum_probs=33.0

Q ss_pred             EECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE
Q ss_conf             2057887321120----11484699707875344799999999998568011079997234210
Q gi|254780606|r  397 GKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE  456 (744)
Q Consensus       397 g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~  456 (744)
                      ...-..++++.|+    .+.-++.|.|.+|||||++++. |++++ ...--.+.+--+|-+...
T Consensus         9 ~Y~~~~~~vL~ninl~i~~Ge~i~IvG~sGsGKSTLl~l-l~gl~-~p~~G~I~i~g~~i~~~~   70 (234)
T cd03251           9 RYPGDGPPVLRDISLDIPAGETVALVGPSGSGKSTLVNL-IPRFY-DVDSGRILIDGHDVRDYT   70 (234)
T ss_pred             EECCCCCCCEECEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC-CCCCCEEEECCEECCCCC
T ss_conf             969899673536089987999999998999829999999-96676-678868999999966089


No 289
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=93.90  E-value=0.19  Score=28.92  Aligned_cols=190  Identities=16%  Similarity=0.227  Sum_probs=84.2

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC---CCEEC--------CCCCCCCEEE--EEE
Q ss_conf             2112011484699707875344799999999998568011079997234---21000--------1257752000--044
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK---MLELS--------VYDGIPHLLT--PVV  471 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k---~~~~~--------~~~~~ph~~~--~v~  471 (744)
                      +-+++.+.--+-|.|..|||||+++++| ..| .+-+..++.|--.|..   ..++.        .|++ .+++.  .|.
T Consensus        24 Vsl~I~~Gei~giIG~SGaGKSTLlr~i-~gL-~~ptsG~I~~~G~dl~~l~~~~l~~~Rr~Ig~ifQ~-~~l~~~~tV~  100 (343)
T PRK11153         24 VSLHVPAGQIYGVIGASGAGKSTLIRCV-NLL-ERPTSGSVIVDGQDLTTLSESELTKARRQIGMIFQH-FNLLSSRTVF  100 (343)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHHH-HCC-CCCCCEEEEECCEECCCCCHHHHHHHHCCEEEEECC-CCCCCCCCHH
T ss_conf             1889989989999999998699999999-659-999963999999999879988999986386999506-6337887289


Q ss_pred             ECHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCHHH-H--------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHH
Q ss_conf             44178768999999866769-99999807786799-9--------99886420267766654323386799984456876
Q gi|254780606|r  472 TNPKKAVMALKWAVREMEER-YRKMSHLSVRNIKS-Y--------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADL  541 (744)
Q Consensus       472 ~~~~~~~~~l~~~~~em~~r-~~~~~~~~~~~i~~-~--------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l  541 (744)
                      .+.........|-..++++| .+++...|..+... |        .+|+.-.+.         +..-|.| ++.||----
T Consensus       101 env~~~l~~~~~~k~~~~~rv~elL~~vgL~~~~~~~p~~LSGGqkQRV~IArA---------La~~P~i-Ll~DEPTsa  170 (343)
T PRK11153        101 GNVALPLELDNTPKDEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARA---------LASNPKV-LLCDEATSA  170 (343)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHCCCCCCCCHHHHHHHHHHHH---------HHCCCCE-EEEECCCCC
T ss_conf             999999997699999999999999987799447619751189999999999999---------8669999-999288765


Q ss_pred             HHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEE----CCCHHHCCHHCCCCCH---HHHC
Q ss_conf             75310358999999999642013589998516544441467885056305720----3681110032676316---8856
Q gi|254780606|r  542 MMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQ----VTSKIDSRTILGEHGA---EQLL  614 (744)
Q Consensus       542 ~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~----v~~~~dsr~il~~~ga---e~l~  614 (744)
                      +  ....-...+.-|..+-|-.|+-+|+-|...+  ++    + .+-.||+.-    +-....-..|+..+..   ..|+
T Consensus       171 L--Dp~t~~~Il~lL~~l~~e~g~TivlITHdm~--~v----~-~icdrVaVm~~G~IVE~G~~~evf~~P~~~~tk~li  241 (343)
T PRK11153        171 L--DPATTRSILELLKDINRRLGLTILLITHEMD--VV----K-RICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFI  241 (343)
T ss_pred             C--CHHHHHHHHHHHHHHHHHHCCEEEEECCCHH--HH----H-HHCCEEEEEECCEEEEECCHHHHHHCCCCHHHHHHC
T ss_conf             8--9999999999999999961989999888999--99----9-869999999898899986889997389997999970


Q ss_pred             CC
Q ss_conf             89
Q gi|254780606|r  615 GR  616 (744)
Q Consensus       615 g~  616 (744)
                      |.
T Consensus       242 ~~  243 (343)
T PRK11153        242 QS  243 (343)
T ss_pred             CC
T ss_conf             88


No 290
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=93.88  E-value=0.31  Score=27.48  Aligned_cols=158  Identities=15%  Similarity=0.182  Sum_probs=90.9

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46997078753447999999999985680110799972342100012577520000444417876899999986676999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYR  493 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~  493 (744)
                      -++|-|---.||||+|+++-+..++..+-   -++-++. +..+.+|+.   + ..-|.|.......|--....|.+-..
T Consensus       327 ~liITGPNtGGKTv~LKtvgL~~lMaq~G---l~vPa~e-~s~~~~f~~---i-~adIGD~QSie~~LSTFS~hm~~i~~  398 (780)
T PRK00409        327 VLVITGPNTGGKTVTLKTLGLAALMAKSG---LPIPAAE-PSEIPVFKE---V-FADIGDEQSIEQSLSTFSGHMTNIVR  398 (780)
T ss_pred             EEEEECCCCCCCEEHHHHHHHHHHHHHHC---CCCCCCC-CCCCCCCCE---E-EEEECCCHHHHHCHHHHHHHHHHHHH
T ss_conf             89996898888563799999999999829---9975168-980423463---8-99827712133265249999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECC
Q ss_conf             99980778679999988642026776665432338679998445687675310358999999999642013589998516
Q gi|254780606|r  494 KMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQR  573 (744)
Q Consensus       494 ~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQr  573 (744)
                      .+..++                             +.-+|.+||+.-  -+.+.|-..+-.-|...=+..|...|+.|-+
T Consensus       399 il~~a~-----------------------------~~sLVLlDElG~--GTDP~EGaALa~aile~l~~~~~~~i~TTH~  447 (780)
T PRK00409        399 ILEKAD-----------------------------ENSLVLFDELGA--GTDPDEGAALAISILDYLRKRGAKIIATTHY  447 (780)
T ss_pred             HHHHCC-----------------------------CCEEEEECCCCC--CCCHHHHHHHHHHHHHHHHHCCCEEEEECCH
T ss_conf             997389-----------------------------980881232358--9984565999999999999779979994776


Q ss_pred             CCCCCCHHHHHHCCCCEEEEECCCH-HHCCHHCCCCCH
Q ss_conf             5444414678850563057203681-110032676316
Q gi|254780606|r  574 PSVDVITGTIKANFPIRISFQVTSK-IDSRTILGEHGA  610 (744)
Q Consensus       574 p~~~vi~~~ik~n~~~ri~~~v~~~-~dsr~il~~~ga  610 (744)
                      ...+.+-..-..-..+-+-|-..+- =-.|.++|.+|.
T Consensus       448 ~~lK~~a~~~~~~~nas~~FD~~tl~PtYrl~~G~pG~  485 (780)
T PRK00409        448 KELKALKYNREGVENASVEFDEETLRPTYRLLIGIPGR  485 (780)
T ss_pred             HHHHHHHHCCCCCEEEEEEECCCCCCCCEEEECCCCCC
T ss_conf             99999972799818988887402378606870599976


No 291
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB; InterPro: IPR013374    This model describes a protein involved in type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly, and is closely related to GspE (IPR013369 from INTERPRO) of type II secretion systems (also referred to as the main terminal branch of the general secretion pathway). Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0009297 pilus biogenesis.
Probab=93.84  E-value=0.03  Score=34.46  Aligned_cols=99  Identities=32%  Similarity=0.476  Sum_probs=55.6

Q ss_pred             HHHHHHHHHHHCCCCCE-EE--EECCCCEEEEEC-------------CCCCCCEEEHHHHHCCHHHCCCCCCEEE-EEEE
Q ss_conf             85999999871477632-77--518983454426-------------8888870765875128121146783689-8420
Q gi|254780606|r  336 IGLADDIARSMSSLSAR-VA--VIPKRNAIGIEL-------------PNETRETVYLRQIIESRSFSHSKANLAL-CLGK  398 (744)
Q Consensus       336 ~~~~~d~~~~~~~~~~~-~~--~~pg~~~~~~~~-------------p~~~~~~v~~~~~~~~~~~~~~~~~l~~-~~g~  398 (744)
                      .+|+.-||--|++.|-- ||  .||-=+-|=+.+             |=.-=+.|-|| ||++.+     ++|-| .||.
T Consensus       237 ~~l~~ri~aRiKvMS~LDIaEkR~PQDGRiKl~~sk~k~iDFRVStLPTLfGEKvVLR-iLDsS~-----a~Ldi~~LGF  310 (577)
T TIGR02538       237 LKLANRIAARIKVMSRLDIAEKRIPQDGRIKLKLSKSKAIDFRVSTLPTLFGEKVVLR-ILDSSA-----AKLDIDKLGF  310 (577)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCEEEEEEECCCCCCCCCEEEEE-EECHHH-----CCCCCHHHCC
T ss_conf             8899999989999732671224568787367753784455125378742024446677-655221-----2267422068


Q ss_pred             CCCCCEEECCHHHCC--CEEEEECCCCCHHHHHHHHHHHHHHHCCHH
Q ss_conf             578873211201148--469970787534479999999999856801
Q gi|254780606|r  399 TISGESVIADLANMP--HILVAGTTGSGKSVAINTMIMSLLYRLRPD  443 (744)
Q Consensus       399 ~~~g~~~~~dl~~~P--H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~  443 (744)
                      .-+=+-.+.+=-+-|  -+||-|=|||||||-|.|-+-.   -|+++
T Consensus       311 eP~Qk~~fL~Ai~kPqGMvLVTGPTGSGKTVSLYTaLni---LN~~~  354 (577)
T TIGR02538       311 EPDQKALFLEAIHKPQGMVLVTGPTGSGKTVSLYTALNI---LNTEE  354 (577)
T ss_pred             CHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHCC---CCCCC
T ss_conf             888999999997079972886266598416878763112---57767


No 292
>PRK12608 transcription termination factor Rho; Provisional
Probab=93.79  E-value=0.53  Score=25.88  Aligned_cols=54  Identities=9%  Similarity=0.168  Sum_probs=41.9

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCC
Q ss_conf             011484699707875344799999999998568011079997234210001257
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDG  462 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~  462 (744)
                      +.|.=-.||..-.++|||++|+.|..++...|+--++-.+|||-.--|-+.+..
T Consensus       129 IGkGQRgLIVAPPkaGKT~LLq~IA~aI~~NhPev~livLLIDERPEEVTdm~r  182 (379)
T PRK12608        129 IGKGQRGLIVAPPRAGKTILLQQIAQAVAANHPDIHLMVLLIDERPEEVTDMKR  182 (379)
T ss_pred             CCCCCCCEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHH
T ss_conf             345740127458986578999999999985799848999981689358888886


No 293
>pfam08423 Rad51 Rad51. Rad51 is a DNA repair and recombination protein and is a homologue of the bacterial ATPase RecA protein.
Probab=93.78  E-value=0.53  Score=25.86  Aligned_cols=46  Identities=17%  Similarity=0.335  Sum_probs=29.8

Q ss_pred             CEEEEEHHHHHHHHHHCC----------HHHHHHHHHHHHHHHCCEEEEEEEECCC
Q ss_conf             679998445687675310----------3589999999996420135899985165
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAG----------KEIEGAIQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~----------~~~e~~~~~la~~~ra~GihlilatQrp  574 (744)
                      +.-+||||-++.+.....          ...-..+..|-.+|+..++-+|+..|==
T Consensus       138 ~v~LvVvDSiaalfR~e~~g~~~l~~R~~~L~~~l~~L~~lA~~~~~aVvvTNQV~  193 (261)
T pfam08423       138 RFALLIVDSATALYRTDFSGRGELAERQQHLAKFLRSLQRLADEFGVAVVITNQVV  193 (261)
T ss_pred             CCEEEEEECCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             83499983240023330036752899999999999999999998095899960479


No 294
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=93.75  E-value=0.54  Score=25.82  Aligned_cols=186  Identities=22%  Similarity=0.269  Sum_probs=91.8

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEE--EEEECCCC-CEEC--------------CCCCCCCEE
Q ss_conf             211201148469970787534479999999999856801107--99972342-1000--------------125775200
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECR--MIMVDPKM-LELS--------------VYDGIPHLL  467 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~--~~liD~k~-~~~~--------------~~~~~ph~~  467 (744)
                      |-+++.+.=-+-|.|.+|||||++.++++ .|+-. .+..+.  =+++|-+. ..++              +|++--.-+
T Consensus        24 vs~~i~~GE~lgiVGESGsGKS~~~~aim-~llp~-~~~~i~~G~i~f~g~~l~~l~~~~~~~iRG~~I~mIfQ~p~~sL  101 (316)
T COG0444          24 VSFELKKGEILGIVGESGSGKSVLAKAIM-GLLPK-PNARIVGGEILFDGKDLLSLSEKELRKIRGKEIAMIFQDPMTSL  101 (316)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHHH-HCCCC-CCCEEEEEEEEECCCCCCCCCHHHHHHHCCCEEEEEECCCHHHC
T ss_conf             05887589689998389788999999998-46688-89748611899889646669999998631756899974815644


Q ss_pred             EEEEECHHHHHHHHHHHH-----HH-HHHHHHHHHHCCCCCHHH-HHHHHHHHHCCCCCCCCCC--------CCCCCEEE
Q ss_conf             004444178768999999-----86-676999999807786799-9998864202677666543--------23386799
Q gi|254780606|r  468 TPVVTNPKKAVMALKWAV-----RE-MEERYRKMSHLSVRNIKS-YNERISTMYGEKPQGCGDD--------MRPMPYIV  532 (744)
Q Consensus       468 ~~v~~~~~~~~~~l~~~~-----~e-m~~r~~~~~~~~~~~i~~-~n~~~~~~~~~~~~~~~~~--------~~~~p~iv  532 (744)
                      .|+.+=-+.....++...     +| +++-.++|...|..+-+. +|.      +.+.-..|.-        +..-|.| 
T Consensus       102 nPv~~Ig~Qi~E~l~~h~~~~~~~ea~~~a~~~L~~Vgi~~~~~~~~~------YPhelSGGMrQRV~IAmal~~~P~L-  174 (316)
T COG0444         102 NPVMTIGDQIAEVLRLHGKGLSKKEAKERAIELLELVGIPDPERRLKS------YPHELSGGMRQRVMIAMALALNPKL-  174 (316)
T ss_pred             CCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHH------CCCCCCCCHHHHHHHHHHHHCCCCE-
T ss_conf             970349999999999851411368999999999997699987899861------9835587189999999998589988-


Q ss_pred             EEHHHHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEE----EECCCHHHCCHHCCC
Q ss_conf             98445687-6753103589999999996420135899985165444414678850563057----203681110032676
Q gi|254780606|r  533 IIVDEMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRIS----FQVTSKIDSRTILGE  607 (744)
Q Consensus       533 vviDE~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~----~~v~~~~dsr~il~~  607 (744)
                      +|-||=-. |-.+....+-+.|.+|   -+-.|.-|||-|-...  |     -+.+--||+    -++-.......|+..
T Consensus       175 lIADEPTTALDvtvQaqIl~ll~~l---~~e~~~siilITHDl~--v-----va~~aDrv~VMYaG~iVE~g~~~~i~~~  244 (316)
T COG0444         175 LIADEPTTALDVTVQAQILDLLKEL---QREKGTALILITHDLG--V-----VAEIADRVAVMYAGRIVEEGPVEEIFKN  244 (316)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHH---HHHCCCEEEEEECCHH--H-----HHHHCCEEEEEECCEEEEECCHHHHHCC
T ss_conf             9967986045199999999999999---9854978999948889--9-----9974566899877589986788887438


Q ss_pred             CC
Q ss_conf             31
Q gi|254780606|r  608 HG  609 (744)
Q Consensus       608 ~g  609 (744)
                      +-
T Consensus       245 P~  246 (316)
T COG0444         245 PK  246 (316)
T ss_pred             CC
T ss_conf             99


No 295
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=93.75  E-value=0.08  Score=31.48  Aligned_cols=40  Identities=25%  Similarity=0.486  Sum_probs=31.0

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             011484699707875344799999999998568011079997234
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      +.+.-+++|.|.|||||+.+||+++.-     =|.+.+++-|+=.
T Consensus       140 ie~~~siii~G~t~sGKTt~lnall~~-----Ip~~~rivtIEdt  179 (312)
T COG0630         140 IEARKSIIICGGTASGKTTLLNALLDF-----IPPEERIVTIEDT  179 (312)
T ss_pred             HHCCCCEEEECCCCCCHHHHHHHHHHH-----CCCCCCEEEECCC
T ss_conf             976994999888888649599999863-----7852218995255


No 296
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]
Probab=93.71  E-value=0.22  Score=28.49  Aligned_cols=65  Identities=17%  Similarity=0.265  Sum_probs=44.8

Q ss_pred             CCCEEEEEEECCCC--CEEECCHHHCC--CEEEEECCCCCHHHHHHHHHHHHHHHCC-HHHEEEEEECCC
Q ss_conf             78368984205788--73211201148--4699707875344799999999998568-011079997234
Q gi|254780606|r  389 KANLALCLGKTISG--ESVIADLANMP--HILVAGTTGSGKSVAINTMIMSLLYRLR-PDECRMIMVDPK  453 (744)
Q Consensus       389 ~~~l~~~~g~~~~g--~~~~~dl~~~P--H~lvaG~TgsGKS~~l~~~i~sl~~~~~-p~~~~~~liD~k  453 (744)
                      .+.|++-+|+-..|  +|.+-||...-  ..|+-|-.|+||+.+|+-|-.-+.+--+ =-..+..+||-.
T Consensus       110 I~slniRv~r~v~Gt~~~li~~ly~~g~lntLiigpP~~GKTTlLRdiaR~~s~g~~~~l~kkv~IiDer  179 (308)
T COG3854         110 ISSLNIRVARQVFGTANPLIKDLYQNGWLNTLIIGPPQVGKTTLLRDIARLLSDGINQFLPKKVGIIDER  179 (308)
T ss_pred             ECEEEEEEHHHHHCCCHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECC
T ss_conf             0204554114565562188999984372246996599887077999999986315112677328997150


No 297
>PRK06871 DNA polymerase III subunit delta'; Validated
Probab=93.71  E-value=0.55  Score=25.77  Aligned_cols=191  Identities=15%  Similarity=0.181  Sum_probs=90.4

Q ss_pred             HHCCC-EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-CCCCEECCCCCCCCEEEEEEECH-HHHHHHHHHHHH
Q ss_conf             11484-6997078753447999999999985680110799972-34210001257752000044441-787689999998
Q gi|254780606|r  410 ANMPH-ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-PKMLELSVYDGIPHLLTPVVTNP-KKAVMALKWAVR  486 (744)
Q Consensus       410 ~~~PH-~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-~k~~~~~~~~~~ph~~~~v~~~~-~~~~~~l~~~~~  486 (744)
                      .+.+| +|+.|..|.||+.+.+.+...|+- ..|+.-+  -++ ++.-.+..-..-|.+.  +++.. .+.         
T Consensus        20 ~r~~HA~L~~G~~G~Gk~~la~~~a~~llC-~~~~~~~--~Cg~C~sC~l~~~g~HPD~~--~i~~~~~k~---------   85 (324)
T PRK06871         20 GRGHHALLFKADSGLGTEQLIRALAQWLMC-QAPGDEQ--PCGQCHSCHLFQAGNHPDFH--ILEPIDGKD---------   85 (324)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHC-CCCCCCC--CCCCCHHHHHHHCCCCCCEE--EEECCCCCC---------
T ss_conf             995437876899997899999999999828-9999999--88889899999738999879--984678887---------


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEE
Q ss_conf             66769999998077867999998864202677666543233867999844568767531035899999999964201358
Q gi|254780606|r  487 EMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIH  566 (744)
Q Consensus       487 em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gih  566 (744)
                                 .++..|...+..+.....   .        -.+-|++||+ ||.|....   ..++-..-- -=..+.+
T Consensus        86 -----------I~vd~IR~l~~~~~~~~~---~--------g~~KV~iI~~-ae~m~~~A---aNALLKtLE-EPp~~~~  138 (324)
T PRK06871         86 -----------IGVDQVREINEKVSQFAQ---Q--------GGNKVVYIQG-AERLTEAA---ANALLKTLE-EPRPNTY  138 (324)
T ss_pred             -----------CCHHHHHHHHHHHHHCCC---C--------CCCEEEEECC-HHHHHHHH---HHHHHHHHC-CCCCCEE
T ss_conf             -----------889999999999864622---0--------5966999758-88857999---999999833-8987838


Q ss_pred             EEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCC-CCE--EEECCCCCEEEEEECCCCHHHHHH
Q ss_conf             99985165444414678850563057203681110032676316885689-846--864689843899934389889999
Q gi|254780606|r  567 LIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGR-GDM--LYMSGGGRIQRVHGPLVSDIEIEK  643 (744)
Q Consensus       567 lilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~-gd~--l~~~~~~~~~r~~~~~~~~~~~~~  643 (744)
                      +||.|.+|+ .+++ .|+.-.- ++-|+..+..+...-|-+.+    -+. .+.  .....+|.+.++. .|+.++..+.
T Consensus       139 fiL~t~~~~-~ll~-TI~SRCq-~~~~~~p~~~~~~~wL~~~~----~~~~~~~~~al~~~~g~pl~A~-~~~~~~~~~~  210 (324)
T PRK06871        139 FLLQADLSA-SLLA-TIYSRCQ-TWLIHVPEEQIALDWLQAQS----SGEIQEIQTALRINYGRPLLAL-TFLEQGLLEQ  210 (324)
T ss_pred             EEEEECCCC-CCCC-HHHHCCC-CEECCCCCHHHHHHHHHHHC----CCCHHHHHHHHHHCCCCHHHHH-HHHCCCHHHH
T ss_conf             999878701-0324-0862661-20089949999999999746----8872999999997699879999-9868779999


Q ss_pred             HHHHHH
Q ss_conf             999998
Q gi|254780606|r  644 VVQHLK  649 (744)
Q Consensus       644 ~~~~~~  649 (744)
                      --.+++
T Consensus       211 r~~~~~  216 (324)
T PRK06871        211 RKTFLR  216 (324)
T ss_pred             HHHHHH
T ss_conf             999999


No 298
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=93.70  E-value=0.55  Score=25.77  Aligned_cols=45  Identities=22%  Similarity=0.161  Sum_probs=30.6

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             6898420578873211201148469970787534479999999999
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      |.+-.|-...=+-+-+++.+.=++.+.|..|||||++++. |.+++
T Consensus         9 lt~~~g~~~~L~~vsl~i~~Ge~~~LvG~NGaGKSTL~k~-l~G~l   53 (490)
T PRK10938          9 GTFRLSDTKTLQLPSLTLNAGDSWAFVGSNGSGKSALARA-LAGEL   53 (490)
T ss_pred             EEEEECCEEEEEEEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC
T ss_conf             9999899888931598998998999997999779999999-95699


No 299
>KOG0951 consensus
Probab=93.70  E-value=0.03  Score=34.46  Aligned_cols=95  Identities=18%  Similarity=0.264  Sum_probs=60.6

Q ss_pred             EECCCCEEEEECCCCC-------CCEEEHHHH--HCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCH
Q ss_conf             5189834544268888-------870765875--1281211467836898420578873211201148469970787534
Q gi|254780606|r  355 VIPKRNAIGIELPNET-------RETVYLRQI--IESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGK  425 (744)
Q Consensus       355 ~~pg~~~~~~~~p~~~-------~~~v~~~~~--~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGK  425 (744)
                      ..-||++--|-||...       -..+.+.++  |....|....+ |     -+|.+...-.-|...-|+|+.|-||+||
T Consensus       265 rl~kk~yeevhVPa~~~~pf~~~Ekl~~iselP~Wnq~aF~g~~s-L-----NrIQS~V~daAl~~~EnmLlCAPTGaGK  338 (1674)
T KOG0951         265 RLKKKGYEEVHVPAPSYFPFHKEEKLVKISELPKWNQPAFFGKQS-L-----NRIQSKVYDAALRGDENMLLCAPTGAGK  338 (1674)
T ss_pred             EEECCCCEEEECCCCCCCCCCCCCEEEEECCCCCHHHHHCCCCHH-H-----HHHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             985588628967788888877662468604783110243034045-6-----6788777788755767378742678882


Q ss_pred             HH-HHHHHHHHHHHHCCHHHEEEEEECCCCCE
Q ss_conf             47-99999999998568011079997234210
Q gi|254780606|r  426 SV-AINTMIMSLLYRLRPDECRMIMVDPKMLE  456 (744)
Q Consensus       426 S~-~l~~~i~sl~~~~~p~~~~~~liD~k~~~  456 (744)
                      |+ .+.+||--| -.|.-.+..+.|-.+|.+-
T Consensus       339 TNVAvLtiLqel-~~h~r~dgs~nl~~fKIVY  369 (1674)
T KOG0951         339 TNVAVLTILQEL-GNHLREDGSVNLAPFKIVY  369 (1674)
T ss_pred             HHHHHHHHHHHH-HCCCCCCCCEECCCCEEEE
T ss_conf             379999999998-5354544541025613799


No 300
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=93.68  E-value=0.35  Score=27.06  Aligned_cols=150  Identities=19%  Similarity=0.310  Sum_probs=66.7

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-----CCCC------------CEECCCCCCCCEEEE
Q ss_conf             12011484699707875344799999999998568011079997-----2342------------100012577520000
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-----DPKM------------LELSVYDGIPHLLTP  469 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-----D~k~------------~~~~~~~~~ph~~~~  469 (744)
                      +++.+.--+-+.|-.|||||++|+. |.+|.   .|+.=++.+-     |.+.            .-|-.|.-+||+-  
T Consensus        19 l~i~~g~i~~l~GpsGaGKTTLl~~-iaGl~---~p~~G~I~~~g~~~~~~~~~~~l~~~~r~ig~vfQ~~~Lfphlt--   92 (352)
T PRK11144         19 LTLPAQGITAIFGRSGAGKTSLINL-ISGLT---RPQKGRIVLNGRVLFDAEKGICLPPEKRRIGYVFQDARLFPHYK--   92 (352)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCCCCCCCHHHCCEEEEECCCCCCCCCC--
T ss_conf             9988998999999999629999999-97689---99965999999998555410137676688689935763377768--


Q ss_pred             EEECHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHHHHHHHHHHHCCCCCCCC---CCCCCCCEEEEEHHH-HHHHHHH
Q ss_conf             44441787689999998667699-999980778679999988642026776665---432338679998445-6876753
Q gi|254780606|r  470 VVTNPKKAVMALKWAVREMEERY-RKMSHLSVRNIKSYNERISTMYGEKPQGCG---DDMRPMPYIVIIVDE-MADLMMV  544 (744)
Q Consensus       470 v~~~~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~---~~~~~~p~ivvviDE-~a~l~~~  544 (744)
                      |..+...   .++   +++..+. +++...+..+   +-.|....-+...+...   .-+-.-|.| ++.|| ++.|-..
T Consensus        93 V~~Nl~~---g~~---~~~~~~~~~~~~~l~l~~---l~~r~p~~LSGGq~QRvaiARAL~~~P~l-LllDEP~s~LD~~  162 (352)
T PRK11144         93 VRGNLRY---GMA---KSMPAQFDKIVSLLGIEP---LLDRYPGSLSGGEKQRVAIGRALLTAPEL-LLMDEPLASLDLP  162 (352)
T ss_pred             HHHHHHH---HCH---HHHHHHHHHHHHHCCCHH---HHHCCHHHCCCCHHHHHHHHHHHHCCCCE-EEECCCCCCCCHH
T ss_conf             8996651---000---565999999997759956---76278646592452349999987249999-9987840027977


Q ss_pred             CCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             1035899999999964201358999851654
Q gi|254780606|r  545 AGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       545 ~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ...   ..+..|.++.+..|+-+|+-|-..+
T Consensus       163 ~~~---~i~~~l~~l~~~~~~til~VTHd~~  190 (352)
T PRK11144        163 RKR---ELLPYLERLAQEINIPILYVSHSLD  190 (352)
T ss_pred             HHH---HHHHHHHHHHHHHCCEEEEEECCHH
T ss_conf             999---9999999999973988999939999


No 301
>pfam02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP. This family consists of the BtuR, CobO, CobP proteins all of which are Cob(I)alamin adenosyltransferase, EC:2.5.1.17, involved in cobalamin (vitamin B12) biosynthesis. These enzymes catalyse the adenosylation reaction: ATP + cob(I)alamin + H2O <= phosphate + diphosphate + adenosylcobalamin.
Probab=93.65  E-value=0.56  Score=25.71  Aligned_cols=134  Identities=18%  Similarity=0.296  Sum_probs=69.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC-CC----CEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999856801107999723-42----10001257752000044441787689999998667
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP-KM----LELSVYDGIPHLLTPVVTNPKKAVMALKWAVREME  489 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~-k~----~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~  489 (744)
                      +.|.=..|-|||    |..+++++|..-...+.++|-| |+    +|+..+..++.+-. ......    . -|-....+
T Consensus         6 i~iytG~GKGKT----TAAlGlalRA~G~G~rV~ivQFlKg~~~~GE~~~l~~l~~v~~-~~~g~g----f-~~~~~~~~   75 (172)
T pfam02572         6 LIVYTGNGKGKS----TAAFGMALRALGHGMRVGVVQFIKGKWETGEEAALEALPEVEW-HVMGEG----F-TWETQDRE   75 (172)
T ss_pred             EEEEECCCCCHH----HHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHHHHCCCCEE-EECCCC----C-CCCCCCCH
T ss_conf             999957999718----8999999998259988999999538877638999987899689-978899----8-58788878


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             69999998077867999998864202677666543233867999844568767531035899999999964201358999
Q gi|254780606|r  490 ERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIM  569 (744)
Q Consensus       490 ~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlil  569 (744)
                      +..+. ++      ..++.......            .-.|=+||.||+...+...--..+..+ .+. +.|.-++||||
T Consensus        76 ~d~~~-a~------~~~~~a~~~l~------------~~~~dlvVLDEi~~ai~~gli~~~~v~-~~l-~~rp~~~evVl  134 (172)
T pfam02572        76 RDIAA-AR------EAWEKAKEALA------------SGSYDLVVLDELNYALKYGYLDLEEVL-ELL-RNRPEGQHVVL  134 (172)
T ss_pred             HHHHH-HH------HHHHHHHHHHH------------CCCCCEEEEHHHHHHHHCCCCCHHHHH-HHH-HHCCCCCEEEE
T ss_conf             89999-99------99999999975------------889899973557999755996899999-999-82899877999


Q ss_pred             EECCCCCCCC
Q ss_conf             8516544441
Q gi|254780606|r  570 ATQRPSVDVI  579 (744)
Q Consensus       570 atQrp~~~vi  579 (744)
                      .-..+....+
T Consensus       135 TGr~~p~~L~  144 (172)
T pfam02572       135 TGRGAPPELI  144 (172)
T ss_pred             ECCCCCHHHH
T ss_conf             8999999999


No 302
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein; InterPro: IPR011924   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry represents LolD, a member of the ABC transporter family. LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on the residue immediately following the modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. Excluded from this entry are homologs from the archaeal genus Methanosarcina .; GO: 0005524 ATP binding, 0006810 transport, 0016020 membrane.
Probab=93.65  E-value=0.048  Score=33.01  Aligned_cols=168  Identities=18%  Similarity=0.243  Sum_probs=87.5

Q ss_pred             HCCCCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC---------
Q ss_conf             11467836898420578873211201148469970787534479999999999856801107999723421---------
Q gi|254780606|r  385 FSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML---------  455 (744)
Q Consensus       385 ~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~---------  455 (744)
                      |+..+..+-|.=|       |=+++.+.-++-|-|..|||||++|+ ++-+| =.=+.-+|-|.--+....         
T Consensus        11 Y~~G~~~~~vL~g-------~sl~i~~GE~~~IvG~SGSGKSTLLH-lLGGL-D~PT~G~v~f~G~~l~~lS~~~~~~LR   81 (221)
T TIGR02211        11 YQEGKLQTRVLKG-------VSLSIGKGEIVAIVGSSGSGKSTLLH-LLGGL-DNPTSGEVLFNGQSLSKLSSNERAKLR   81 (221)
T ss_pred             EEECCEEEEEECC-------CCCEEECCCEEEEECCCCCCHHHHHH-HHHCC-CCCCCCEEEECCCCHHHCCHHHHHHHH
T ss_conf             5408623665227-------45123066337987367871689999-87306-899631589706323440446788751


Q ss_pred             --EECCCCCCCCEEEEEEECHHHHHHHH----HHHHHHHHHHHHHHHHCCCCCHHHH---------HHHHHHHHCCCCCC
Q ss_conf             --00012577520000444417876899----9999866769999998077867999---------99886420267766
Q gi|254780606|r  456 --ELSVYDGIPHLLTPVVTNPKKAVMAL----KWAVREMEERYRKMSHLSVRNIKSY---------NERISTMYGEKPQG  520 (744)
Q Consensus       456 --~~~~~~~~ph~~~~v~~~~~~~~~~l----~~~~~em~~r~~~~~~~~~~~i~~~---------n~~~~~~~~~~~~~  520 (744)
                        .|.+-...-||+. =.|-.+..+.=+    +...+--++-|+++.+.|-.+-..+         ++|++.+|+-..  
T Consensus        82 N~~LGFiYQFHHLL~-dFtaLENVaMP~LIg~~s~~ea~~~A~~mL~~VgL~~R~~h~PSELSGGERQRvAIARALvN--  158 (221)
T TIGR02211        82 NKKLGFIYQFHHLLP-DFTALENVAMPLLIGKKSKKEAKERAYEMLEKVGLEHRINHRPSELSGGERQRVAIARALVN--  158 (221)
T ss_pred             HHHCCCEEEHHHCCC-CCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--
T ss_conf             222584443202030-00026887777753589988999999999886073344555777345633799999998618--


Q ss_pred             CCCCCCCCCEEEEEHHHHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             65432338679998445687-67531035899999999964201358999851654
Q gi|254780606|r  521 CGDDMRPMPYIVIIVDEMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       521 ~~~~~~~~p~ivvviDE~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                             -|.+| +-||=-- |=.   .-....++-|..+=|..|+=+|+.|--..
T Consensus       159 -------~P~lv-lADEPTGNLD~---~~a~~iF~L~~eLN~~~~TsflvVTHD~~  203 (221)
T TIGR02211       159 -------QPSLV-LADEPTGNLDN---NNAKSIFELMLELNRELNTSFLVVTHDLE  203 (221)
T ss_pred             -------CCCEE-ECCCCCCHHHH---HHHHHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             -------97658-61298853237---77999999999988653916999834757


No 303
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=93.62  E-value=0.33  Score=27.30  Aligned_cols=67  Identities=27%  Similarity=0.433  Sum_probs=39.4

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC----CCEE-------CCCCCCCCEEEEEEECHHHHH
Q ss_conf             11484699707875344799999999998568011079997234----2100-------012577520000444417876
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK----MLEL-------SVYDGIPHLLTPVVTNPKKAV  478 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k----~~~~-------~~~~~~ph~~~~v~~~~~~~~  478 (744)
                      .+.+=++|+|.||||||-+-.    .|+-+.   ...++=+|-.    +..-       ....++||++..++. +.+--
T Consensus         2 ~~~~ii~i~GpTasGKs~la~----~la~~~---~~eIIsaDS~QvYk~l~IgTakps~~e~~~i~Hhli~~~~-~~e~~   73 (304)
T PRK00091          2 MKPKLIVLVGPTASGKTALAI----ELAKRL---NGEIISVDSMQVYRGMDIGTAKPTAEELAGVPHHLIDILD-PTESY   73 (304)
T ss_pred             CCCCEEEEECCCCCCHHHHHH----HHHHHC---CCEEEEECHHHHHCCCCEEECCCCHHHHCCCCCEEEEEEC-CCCCE
T ss_conf             999779998988658999999----999987---9989941268874999868899999998189812434565-88754


Q ss_pred             HHHHHH
Q ss_conf             899999
Q gi|254780606|r  479 MALKWA  484 (744)
Q Consensus       479 ~~l~~~  484 (744)
                      .+-.|.
T Consensus        74 sv~~f~   79 (304)
T PRK00091         74 SAADFQ   79 (304)
T ss_pred             EHHHHH
T ss_conf             499999


No 304
>TIGR01187 potA polyamine ABC transporter, ATP-binding protein; InterPro: IPR005893   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family comprises the spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belongs to the larger ATP-Binding Cassette (ABC) transporter superfamily. Polyamines like spermidine and putrescine play a vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included).; GO: 0015417 polyamine-transporting ATPase activity, 0015846 polyamine transport, 0016020 membrane.
Probab=93.61  E-value=0.17  Score=29.30  Aligned_cols=169  Identities=20%  Similarity=0.332  Sum_probs=92.3

Q ss_pred             EECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-------CC----CCEECCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             7078753447999999999985680110799972-------34----210001257752000044441787689999998
Q gi|254780606|r  418 AGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-------PK----MLELSVYDGIPHLLTPVVTNPKKAVMALKWAVR  486 (744)
Q Consensus       418 aG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-------~k----~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~  486 (744)
                      =|..|||||++|+ +|.++-   .||.=+++|-.       |.    +.=|--|.-.||.-  |..|.-.-...-+.=..
T Consensus         2 LGpSGcGKTTlLr-lLAGf~---~pd~G~i~ldg~d~~~vPp~~R~in~vFQsYALFPHMT--v~~NvAfgLk~~k~~~~   75 (331)
T TIGR01187         2 LGPSGCGKTTLLR-LLAGFE---QPDSGSIMLDGEDVTEVPPHLRSINMVFQSYALFPHMT--VEENVAFGLKMRKVPRA   75 (331)
T ss_pred             CCCCCCCHHHHHH-HHHCCC---CCCCCEEEECCCCCCCCCCCCCCCCCEEECCCCCCCCC--HHHHCCCCCCCCCCCHH
T ss_conf             7888874799999-983458---77755077567101215722061460573543562122--77645444351788856


Q ss_pred             HHHHHH------HHHHHCCCCCHHH----HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHHHHHCCHHHHHHHH-
Q ss_conf             667699------9999807786799----99988642026776665432338679998445-68767531035899999-
Q gi|254780606|r  487 EMEERY------RKMSHLSVRNIKS----YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADLMMVAGKEIEGAIQ-  554 (744)
Q Consensus       487 em~~r~------~~~~~~~~~~i~~----~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l~~~~~~~~e~~~~-  554 (744)
                      |...|-      -.|.+++.|.+..    =.+|++-.++-..         -|.|++ .|| +..|=    +..-+.++ 
T Consensus        76 ei~~RV~e~L~~V~L~~~a~rkp~qLSGGQ~QRvAlARa~v~---------kPk~LL-lDEpLsALD----~kLR~~MQ~  141 (331)
T TIGR01187        76 EIKPRVKEALRLVQLEEFAKRKPHQLSGGQQQRVALARALVF---------KPKILL-LDEPLSALD----KKLRDQMQL  141 (331)
T ss_pred             HHHHHHHHHHHHCCCCHHHCCCCCCCCCCHHHHHHHHHHHHC---------CCCEEE-ECCCHHHHH----HHHHHHHHH
T ss_conf             688999999742130011046731046852899999999860---------895677-117722643----898998899


Q ss_pred             HHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEE----ECCCHHHCCHHCCCCCHHHH
Q ss_conf             999964201358999851654444146788505630572----03681110032676316885
Q gi|254780606|r  555 RLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISF----QVTSKIDSRTILGEHGAEQL  613 (744)
Q Consensus       555 ~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~----~v~~~~dsr~il~~~gae~l  613 (744)
                      .|-.+-|.+||=.|+-|--=+ ..||.      .-||+.    +..--.++++|-.++--+.-
T Consensus       142 ELk~~~~~LGiT~v~VTHDQ~-EA~TM------sDRI~~l~~Gki~Q~~~PeeiY~~P~~~Fv  197 (331)
T TIGR01187       142 ELKTLQEQLGITFVFVTHDQE-EALTM------SDRIAILRKGKIAQIGTPEEIYEEPSNLFV  197 (331)
T ss_pred             HHHHHHHHCCCEEEEEECCHH-HHHHH------HCEEEEECCCEEEEECCCHHHHHCCCCCCC
T ss_conf             999998726828999701848-98754------020242138758883684687517775310


No 305
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=93.59  E-value=0.32  Score=27.39  Aligned_cols=33  Identities=18%  Similarity=0.324  Sum_probs=24.1

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             7321120114846997078753447999999999
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +-+-+++.+.=.+-+.|..|||||++++. |++|
T Consensus       280 ~~vsf~v~~GEi~gl~G~nGsGKsTL~~~-l~Gl  312 (510)
T PRK09700        280 RDISFSVCRGEILGFAGLVGSGRTELMNC-LFGV  312 (510)
T ss_pred             EEEEEEECCCCEEEEECCCCCCHHHHHHH-HHCC
T ss_conf             43357874881899976888628899999-8198


No 306
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein; InterPro: IPR005968   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Thiamine pyrophosphate (TPP) is a required cofactor synthesized de novo in Salmonella typhimurium. The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and alpha-ketoglutarate dehydrogenase (1.2.4.2 from EC).    Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism.    The model describes thiamine ABC transporter, ATP-binding protein, believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane The protein belongs to the larger ABC transport system which consists of at least three components: the inner membrane permease; thiamine binding protein and an ATP-binding subunit. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate or thiamine pyrophosphate. ; GO: 0005524 ATP binding, 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=93.59  E-value=0.11  Score=30.49  Aligned_cols=162  Identities=22%  Similarity=0.297  Sum_probs=93.7

Q ss_pred             CCCCEEECCHH--HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCC-----------CCCE
Q ss_conf             78873211201--1484699707875344799999999998568011079997234210001257-----------7520
Q gi|254780606|r  400 ISGESVIADLA--NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDG-----------IPHL  466 (744)
Q Consensus       400 ~~g~~~~~dl~--~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~-----------~ph~  466 (744)
                      -...|+.|||.  ..-.+-|-|-.|+|||++|| +|.+.+   .|-.=.+.+=|-.-...++|+.           .+||
T Consensus        10 y~hlpm~F~L~V~~Ge~VAi~GpSGAGKSTLLn-LiAGF~---~PasG~i~~nd~~~t~~aPy~RPvSMLFQEnNLF~HL   85 (213)
T TIGR01277        10 YKHLPMEFDLSVEDGERVAILGPSGAGKSTLLN-LIAGFL---EPASGEIKVNDKDHTRLAPYRRPVSMLFQENNLFAHL   85 (213)
T ss_pred             CCCCCEEEECCCCCCCEEEEECCCCCCHHHHHH-HHHHHC---CCCCEEEEECCCCCCCCCCCCCCCCHHHHHHCCCCCH
T ss_conf             356740450413017768887589862788987-786404---7764058877801226888777750343221025302


Q ss_pred             EEEEEECHHHHHHH----HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCC----CCCCCCCEEEEEHHH-
Q ss_conf             00044441787689----999998667699999980778679999988642026776665----432338679998445-
Q gi|254780606|r  467 LTPVVTNPKKAVMA----LKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCG----DDMRPMPYIVIIVDE-  537 (744)
Q Consensus       467 ~~~v~~~~~~~~~~----l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~----~~~~~~p~ivvviDE-  537 (744)
                           |=.+...--    |+--.   ..+.++..-+..--|++|=+|....-+..-+...    +-+++-| | ...|| 
T Consensus        86 -----TV~~NigLGl~PgLKLnA---~q~ek~~~~A~qvGi~dyl~RLP~~LSGGQrQRVALARClvr~~P-I-lLLDEP  155 (213)
T TIGR01277        86 -----TVRQNIGLGLKPGLKLNA---VQQEKVEDVARQVGIDDYLERLPEELSGGQRQRVALARCLVREKP-I-LLLDEP  155 (213)
T ss_pred             -----HHHHHHHCCCCCCCCCCH---HHHHHHHHHHHHCCHHHHHHHCCHHCCCCHHHHHHHHHHHCCCCC-C-CCCCCC
T ss_conf             -----488886537886410156---778999999973385789872501116733789999886417887-3-001588


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC
Q ss_conf             687675310358999999999642013589998516544441
Q gi|254780606|r  538 MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI  579 (744)
Q Consensus       538 ~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi  579 (744)
                      |..|-   ++-=+++++-+++.+-.--+-|++-|-.++ |.+
T Consensus       156 FSALD---p~LR~EMLaLv~~lc~e~~~TllmVtH~~s-da~  193 (213)
T TIGR01277       156 FSALD---PKLREEMLALVKKLCDEKKLTLLMVTHSLS-DAA  193 (213)
T ss_pred             HHHCC---HHHHHHHHHHHHHHHHCCCCEEEEEECCHH-HHH
T ss_conf             11226---788999999999765103646899845889-998


No 307
>TIGR01074 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752    RepA hexameric DNA helicase contain ATP-binding domains similar to those seen in monomeric helicases but which are arranged in a ring. There is compelling evidence to suggest that a single ssDNA molecule passes through the centre of the hexameric ring. Activity of the enzyme is based upon two separate but coupled activities, ssDNA translocation and duplex destabilisation, and is driven by energy derived from the continuous ATP-binding and hydrolysis events that take place in the active-site cleft. The resulting conformational changes that accompany these events underpin the coupling process and allow the helicase to translocate along the DNA, destabilizing the duplex and separating the two strands in an active process  ; GO: 0004003 ATP-dependent DNA helicase activity, 0006268 DNA unwinding during replication, 0005737 cytoplasm.
Probab=93.56  E-value=0.16  Score=29.46  Aligned_cols=66  Identities=24%  Similarity=0.386  Sum_probs=43.3

Q ss_pred             ECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCE-----EEE-CCCCCEEEEEECCCCHHHHHHH
Q ss_conf             5165444414678850563057203681110032676316885689846-----864-6898438999343898899999
Q gi|254780606|r  571 TQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDM-----LYM-SGGGRIQRVHGPLVSDIEIEKV  644 (744)
Q Consensus       571 tQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~-----l~~-~~~~~~~r~~~~~~~~~~~~~~  644 (744)
                      --.|.-+||  .+-+|.          +.-+| ||  .-|..|.-+--+     ||. .+.|+.+||=.|==++.|-|+|
T Consensus       264 ~DfP~LKvI--KLEQNY----------RS~~R-IL--kaAN~LI~NNpH~F~K~LfS~l~~Ge~~kVi~~~NE~hEAEri  328 (677)
T TIGR01074       264 EDFPQLKVI--KLEQNY----------RSTSR-IL--KAANILIANNPHVFEKKLFSELGEGEKIKVIECRNEEHEAERI  328 (677)
T ss_pred             HCCCCCEEE--EECCCC----------CCHHH-HH--HHHHHHHHCCCCCCCCCHHHHHCCCCEEEEEECCCCHHHHHHH
T ss_conf             158644165--000066----------66466-99--9976776227420000000100169817888517863168999


Q ss_pred             HHHHHHC
Q ss_conf             9999840
Q gi|254780606|r  645 VQHLKKQ  651 (744)
Q Consensus       645 ~~~~~~~  651 (744)
                      |.-|-++
T Consensus       329 ~~ei~~~  335 (677)
T TIGR01074       329 AGEIIAH  335 (677)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 308
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.55  E-value=0.25  Score=28.15  Aligned_cols=127  Identities=20%  Similarity=0.314  Sum_probs=63.0

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC---------------CCEECCCCCCCCEEEEE
Q ss_conf             112011484699707875344799999999998568011079997234---------------21000125775200004
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK---------------MLELSVYDGIPHLLTPV  470 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k---------------~~~~~~~~~~ph~~~~v  470 (744)
                      -+++.+.--+-|-|..|+|||++|+. |.+|.   .|+.=++++-+-.               +.-|-.|.-+||+-  |
T Consensus        20 s~~i~~Ge~~~ivGpSG~GKSTllr~-i~Gl~---~p~~G~I~~~g~~i~~~~~~~~~~rr~ig~vFQ~~~L~p~~t--v   93 (178)
T cd03229          20 SLNIEAGEIVALLGPSGSGKSTLLRC-IAGLE---EPDSGSILIDGEDLTDLEDELPPLRRRIGMVFQDFALFPHLT--V   93 (178)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEECCEECCCCCCHHHHHCCCEEEEECCCCCCCCCC--H
T ss_conf             76988998999999999839999999-98599---999639999999998886102454177599926998899892--8


Q ss_pred             EECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHHHHHCCHHH
Q ss_conf             4441787689999998667699999980778679999988642026776665432338679998445-687675310358
Q gi|254780606|r  471 VTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADLMMVAGKEI  549 (744)
Q Consensus       471 ~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l~~~~~~~~  549 (744)
                      ..+.   ..-   +..-|..|-.+-                  +.-.         .-|.|+ +.|| ++.|-.....++
T Consensus        94 ~eNv---~~~---LSGGq~QRvaIA------------------RAL~---------~~P~il-l~DEPts~LD~~~~~~i  139 (178)
T cd03229          94 LENI---ALG---LSGGQQQRVALA------------------RALA---------MDPDVL-LLDEPTSALDPITRREV  139 (178)
T ss_pred             HHHH---CEE---CCCHHHHHHHHH------------------HHHH---------CCCCEE-EEECCCCCCCHHHHHHH
T ss_conf             9960---081---772688999999------------------9985---------299999-97089764799999999


Q ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             99999999964201358999851654
Q gi|254780606|r  550 EGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       550 e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .+.   |-..-+..|+-.|+.|-..+
T Consensus       140 ~~~---l~~l~~~~~~t~i~vTHd~~  162 (178)
T cd03229         140 RAL---LKSLQAQLGITVVLVTHDLD  162 (178)
T ss_pred             HHH---HHHHHHHHCCEEEEECCCHH
T ss_conf             999---99999964999999989999


No 309
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=93.53  E-value=0.27  Score=27.91  Aligned_cols=28  Identities=29%  Similarity=0.394  Sum_probs=22.9

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHH
Q ss_conf             2112011484699707875344799999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTM  432 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~  432 (744)
                      |-+++.+.=-+-|.|.+|||||++++.|
T Consensus        34 Vsl~i~~GE~lgiVGeSGsGKSTL~~~l   61 (327)
T PRK11308         34 VSFNLERGKTLAVVGESGCGKSTLARLL   61 (327)
T ss_pred             EEEEECCCCEEEEECCCCHHHHHHHHHH
T ss_conf             0679889999999999831999999999


No 310
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=93.52  E-value=0.59  Score=25.57  Aligned_cols=24  Identities=21%  Similarity=0.361  Sum_probs=12.6

Q ss_pred             CHHHCCCEEEEECCCCCHHHHHHH
Q ss_conf             201148469970787534479999
Q gi|254780606|r  408 DLANMPHILVAGTTGSGKSVAINT  431 (744)
Q Consensus       408 dl~~~PH~lvaG~TgsGKS~~l~~  431 (744)
                      ++.+.=-+-|.|..|||||++++.
T Consensus       284 ~v~~GEi~gi~G~nGsGKsTLl~~  307 (513)
T PRK13549        284 SLRRGEILGIAGLVGAGRTELVQC  307 (513)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHH
T ss_conf             886884899747988658999999


No 311
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=93.50  E-value=0.19  Score=28.91  Aligned_cols=33  Identities=24%  Similarity=0.387  Sum_probs=25.2

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             3211201148469970787534479999999999
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      -+-+++.+.--+.|.|..|||||++++. |++|+
T Consensus        18 ~vsl~i~~Gei~~iiG~nGaGKSTLl~~-i~Gl~   50 (205)
T cd03226          18 DLSLDLYAGEIIALTGKNGAGKTTLAKI-LAGLI   50 (205)
T ss_pred             EEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC
T ss_conf             0378886998999988999989999999-95685


No 312
>PRK03918 chromosome segregation protein; Provisional
Probab=93.49  E-value=0.068  Score=32.00  Aligned_cols=21  Identities=38%  Similarity=0.776  Sum_probs=10.9

Q ss_pred             EEEECCCCCHHHHHHHHHHHH
Q ss_conf             997078753447999999999
Q gi|254780606|r  416 LVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       416 lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +|.|.||||||..+-+|..+|
T Consensus        27 ~I~G~nGsGKStIlDAI~~aL   47 (882)
T PRK03918         27 LIIGQNGSGKSSLLDAILVGL   47 (882)
T ss_pred             EEECCCCCCHHHHHHHHHHHH
T ss_conf             988999998899999999998


No 313
>PRK07270 DNA polymerase III subunits gamma and tau; Validated
Probab=93.48  E-value=0.48  Score=26.18  Aligned_cols=26  Identities=27%  Similarity=0.566  Sum_probs=14.8

Q ss_pred             HCCCE-EEEECCCCCHHHHHHHHHHHH
Q ss_conf             14846-997078753447999999999
Q gi|254780606|r  411 NMPHI-LVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       411 ~~PH~-lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +.||. |-.|.-|.||+.+-+.+..+|
T Consensus        35 ri~HAyLF~GP~GtGKts~ArifAkaL   61 (557)
T PRK07270         35 KISHAYLFSGPRGTGKTSAAKIFAKAM   61 (557)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             954044210899868999999999995


No 314
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=93.45  E-value=0.069  Score=31.94  Aligned_cols=43  Identities=28%  Similarity=0.407  Sum_probs=28.5

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             112011484699707875344799999999998568011079997234
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      -+++.+.--+.+.|..|||||++++. |++|+   .|+.=++. +|-|
T Consensus        21 sl~i~~Gei~~liGpNGaGKSTLlk~-l~Gl~---~p~~G~I~-~~G~   63 (271)
T PRK13638         21 NLDFSLSPVTGLVGANGCGKSTLFMN-LSGLL---RPQKGAVL-WQGK   63 (271)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEE-ECCE
T ss_conf             87983897999999999809999999-96688---88860799-9999


No 315
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=93.42  E-value=0.44  Score=26.42  Aligned_cols=164  Identities=23%  Similarity=0.330  Sum_probs=76.6

Q ss_pred             EEEEEEECCCCCEEECCHHH--CCC--EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCC-----
Q ss_conf             68984205788732112011--484--699707875344799999999998568011079997234210001257-----
Q gi|254780606|r  392 LALCLGKTISGESVIADLAN--MPH--ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDG-----  462 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~--~PH--~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~-----  462 (744)
                      +.++.+  -++.+++.|+.-  .|-  +.|-|..|||||++++ ++++| |.-.-..+++--+|-+..+...++.     
T Consensus       477 vsf~y~--~~~~~vL~~isL~I~~Ge~vaIvG~SGsGKSTL~K-LL~gl-y~p~~G~I~~dg~dl~~i~~~~lR~~ig~V  552 (709)
T COG2274         477 VSFRYG--PDDPPVLEDLSLEIPPGEKVAIVGRSGSGKSTLLK-LLLGL-YKPQQGRILLDGVDLNDIDLASLRRQVGYV  552 (709)
T ss_pred             EEEEEC--CCCCCHHHCEEEEECCCCEEEEECCCCCCHHHHHH-HHHCC-CCCCCCEEEECCEEHHHCCHHHHHHHEEEE
T ss_conf             899817--99844121502776799889998799998899999-98367-888885599998727866999998654687


Q ss_pred             --CCCEEEE-----------EEECHHHHHHHHH-----HHHHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHCCCCCCCCC
Q ss_conf             --7520000-----------4444178768999-----999866769999998077867-99999886420267766654
Q gi|254780606|r  463 --IPHLLTP-----------VVTNPKKAVMALK-----WAVREMEERYRKMSHLSVRNI-KSYNERISTMYGEKPQGCGD  523 (744)
Q Consensus       463 --~ph~~~~-----------v~~~~~~~~~~l~-----~~~~em~~r~~~~~~~~~~~i-~~~n~~~~~~~~~~~~~~~~  523 (744)
                        -++++..           .++ .++...+++     +.+..|-.-|...-..+..|+ .+=.+|+.-.+.-.      
T Consensus       553 ~Q~~~Lf~gSI~eNi~l~~p~~~-~e~i~~A~~~ag~~~fI~~lP~gy~t~v~E~G~~LSGGQrQrlalARaLl------  625 (709)
T COG2274         553 LQDPFLFSGSIRENIALGNPEAT-DEEIIEAAQLAGAHEFIENLPMGYDTPVGEGGANLSGGQRQRLALARALL------  625 (709)
T ss_pred             CCCCHHHCCCHHHHHHCCCCCCC-HHHHHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC------
T ss_conf             46653204739879746899999-79999999983768999836054562320489888888999999999854------


Q ss_pred             CCCCCCEEEEEHHHHHHHHHHCCHHHHHHH-HHHHHHHHCCEEEEEEEECCCC
Q ss_conf             323386799984456876753103589999-9999964201358999851654
Q gi|254780606|r  524 DMRPMPYIVIIVDEMADLMMVAGKEIEGAI-QRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       524 ~~~~~p~ivvviDE~a~l~~~~~~~~e~~~-~~la~~~ra~GihlilatQrp~  575 (744)
                         .-|.| ++.||----   -..+-|..| ..|.+..  .|.-+|+.|-|++
T Consensus       626 ---~~P~I-LlLDEaTSa---LD~~sE~~I~~~L~~~~--~~~T~I~IaHRl~  669 (709)
T COG2274         626 ---SKPKI-LLLDEATSA---LDPETEAIILQNLLQIL--QGRTVIIIAHRLS  669 (709)
T ss_pred             ---CCCCE-EEEECCCCC---CCHHHHHHHHHHHHHHH--CCCEEEEEECCCH
T ss_conf             ---69998-997074223---69867999999999984--5886999976616


No 316
>KOG0345 consensus
Probab=93.38  E-value=0.62  Score=25.41  Aligned_cols=214  Identities=19%  Similarity=0.318  Sum_probs=93.4

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHC----CHHHEEEEEECCCC-CEE-------CCCCCCCCEEEEEEECHHHHHHHH
Q ss_conf             469970787534479999999999856----80110799972342-100-------012577520000444417876899
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRL----RPDECRMIMVDPKM-LEL-------SVYDGIPHLLTPVVTNPKKAVMAL  481 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~----~p~~~~~~liD~k~-~~~-------~~~~~~ph~~~~v~~~~~~~~~~l  481 (744)
                      .+.|--.||||||-.--.=++.++++.    +|-++.-++|-|-+ ...       .+...++|+.+..+.--.      
T Consensus        45 DVvveavTGSGKTlAFllP~le~i~rr~~~~~~~~vgalIIsPTRELa~QI~~V~~~F~~~l~~l~~~l~vGG~------  118 (567)
T KOG0345          45 DVVVEAVTGSGKTLAFLLPMLEIIYRREAKTPPGQVGALIISPTRELARQIREVAQPFLEHLPNLNCELLVGGR------  118 (567)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCC------
T ss_conf             56898567887106689999999986115789651247996571999999999999999850365459997686------


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHH-HCCHHHHHHHHHHHHHH
Q ss_conf             99998667699999980778679999988642026776665432338679998445687675-31035899999999964
Q gi|254780606|r  482 KWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMM-VAGKEIEGAIQRLAQMA  560 (744)
Q Consensus       482 ~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~-~~~~~~e~~~~~la~~~  560 (744)
                           ..+.-+..|.+.+..-+.+--.|....-.  .+...-+.+.|  =++|+||---|.. ...+.+...|..|- +-
T Consensus       119 -----~v~~Di~~fkee~~nIlVgTPGRL~di~~--~~~~~l~~rsL--e~LVLDEADrLldmgFe~~~n~ILs~LP-KQ  188 (567)
T KOG0345         119 -----SVEEDIKTFKEEGPNILVGTPGRLLDILQ--REAEKLSFRSL--EILVLDEADRLLDMGFEASVNTILSFLP-KQ  188 (567)
T ss_pred             -----CHHHHHHHHHHHCCCEEEECCHHHHHHHH--CHHHCCCCCCC--CEEEECCHHHHHCCCHHHHHHHHHHHCC-CC
T ss_conf             -----47779999997099589947624999984--53000361331--1577514676744327999999998662-10


Q ss_pred             HCCEEEEEEEECCCCCCCCHHHHHHCCC--CEEEEECCCH--HHCCHHCC---CCCHHHH-------CC----CCCEEEE
Q ss_conf             2013589998516544441467885056--3057203681--11003267---6316885-------68----9846864
Q gi|254780606|r  561 RAAGIHLIMATQRPSVDVITGTIKANFP--IRISFQVTSK--IDSRTILG---EHGAEQL-------LG----RGDMLYM  622 (744)
Q Consensus       561 ra~GihlilatQrp~~~vi~~~ik~n~~--~ri~~~v~~~--~dsr~il~---~~gae~l-------~g----~gd~l~~  622 (744)
                      |-.|  |--|||+=.   +..++|+++-  .||.-+..+.  .-|+.-+-   ..-.|++       .+    +. +.|.
T Consensus       189 RRTG--LFSATq~~~---v~dL~raGLRNpv~V~V~~k~~~~tPS~L~~~Y~v~~a~eK~~~lv~~L~~~~~kK~-iVFF  262 (567)
T KOG0345         189 RRTG--LFSATQTQE---VEDLARAGLRNPVRVSVKEKSKSATPSSLALEYLVCEADEKLSQLVHLLNNNKDKKC-IVFF  262 (567)
T ss_pred             CCCC--CCEEHHHHH---HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHEEEEECHHHHHHHHHHHHHCCCCCCE-EEEE
T ss_conf             0024--430021466---889998535686365412344555842311125675778889999999962454627-9993


Q ss_pred             ----------------CCCCCEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             ----------------689843899934389889999999998
Q gi|254780606|r  623 ----------------SGGGRIQRVHGPLVSDIEIEKVVQHLK  649 (744)
Q Consensus       623 ----------------~~~~~~~r~~~~~~~~~~~~~~~~~~~  649 (744)
                                      .+...+.-+||-..-..--..+-.|-+
T Consensus       263 ~TCasVeYf~~~~~~~l~~~~i~~iHGK~~q~~R~k~~~~F~~  305 (567)
T KOG0345         263 PTCASVEYFGKLFSRLLKKREIFSIHGKMSQKARAKVLEAFRK  305 (567)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCHHCCHHHHHHHHHHHH
T ss_conf             4754099999888876078747986220123468899999871


No 317
>KOG0733 consensus
Probab=93.37  E-value=0.13  Score=30.01  Aligned_cols=88  Identities=24%  Similarity=0.351  Sum_probs=52.9

Q ss_pred             EEEEHHHHHHHH---HHCCHHHHHHH--------HHHHHHHH-CCEEEEEEEECCCCCCCCHHHHH--HCCCCEEEEECC
Q ss_conf             999844568767---53103589999--------99999642-01358999851654444146788--505630572036
Q gi|254780606|r  531 IVIIVDEMADLM---MVAGKEIEGAI--------QRLAQMAR-AAGIHLIMATQRPSVDVITGTIK--ANFPIRISFQVT  596 (744)
Q Consensus       531 ivvviDE~a~l~---~~~~~~~e~~~--------~~la~~~r-a~GihlilatQrp~~~vi~~~ik--~n~~~ri~~~v~  596 (744)
                      -||+|||+-...   ..+.+|+|.-|        ..|...++ ..++-+|-||.||+  .|.+-+|  .-|..-||+.|.
T Consensus       284 civFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnRPD--slDpaLRRaGRFdrEI~l~vP  361 (802)
T KOG0733         284 CIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNRPD--SLDPALRRAGRFDREICLGVP  361 (802)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC--CCCHHHHCCCCCCCEEEECCC
T ss_conf             599851100136440457889999999999985100256666899769982478976--558777325655323530689


Q ss_pred             CHHHCCHHCCCCCHHHHCCCCCEEE
Q ss_conf             8111003267631688568984686
Q gi|254780606|r  597 SKIDSRTILGEHGAEQLLGRGDMLY  621 (744)
Q Consensus       597 ~~~dsr~il~~~gae~l~g~gd~l~  621 (744)
                      |...-.-||-. =+..|-=.||+=|
T Consensus       362 ~e~aR~~IL~~-~~~~lrl~g~~d~  385 (802)
T KOG0733         362 SETAREEILRI-ICRGLRLSGDFDF  385 (802)
T ss_pred             CHHHHHHHHHH-HHHHCCCCCCCCH
T ss_conf             66889999999-9862777877689


No 318
>PTZ00209 retrotransposon hot spot protein; Provisional
Probab=93.35  E-value=0.26  Score=27.97  Aligned_cols=54  Identities=17%  Similarity=0.357  Sum_probs=38.4

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCC
Q ss_conf             1484699707875344799999999998568011079997234210001257752
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPH  465 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph  465 (744)
                      -.+|+|| ||.|=|||.-.-|.|+--|+++.-+.|.++.-=..+..|-+|+....
T Consensus       172 P~~~vLI-GTPGIGKSm~aGSyLLYqLLHyDae~L~vVay~~g~~aylf~~k~~~  225 (693)
T PTZ00209        172 PPTHIVI-GISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVKAYLIYNKKGN  225 (693)
T ss_pred             CCCEEEE-CCCCCCCCCCCHHHHHHHHHHCCHHHCCEEEEEECCEEEEEEECCCC
T ss_conf             9852897-89975533342899999987135745858999966768999855898


No 319
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=93.32  E-value=0.079  Score=31.53  Aligned_cols=208  Identities=17%  Similarity=0.191  Sum_probs=97.2

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC---CEE--------CCCCCCCCE-EEEEE
Q ss_conf             321120114846997078753447999999999985680110799972342---100--------012577520-00044
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM---LEL--------SVYDGIPHL-LTPVV  471 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~---~~~--------~~~~~~ph~-~~~v~  471 (744)
                      -+-+++.+.-.+.|.|..|||||++++. |.+|+   .|..=++ .+|-+.   ..+        ..|++-.+. +...|
T Consensus        25 ~is~~i~~Ge~~aiiG~sGsGKSTL~~~-l~Gl~---~~~~G~I-~~~G~~i~~~~~~~~r~~ig~VfQ~p~~~l~~~tV   99 (277)
T PRK13642         25 GVSFSITKGEWVSIIGQNGSGKSTTARL-IDGLF---EEFEGIV-KIDGERLTAENVWNLRRKIGMVFQNPDNQFVGATV   99 (277)
T ss_pred             CEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEE-EECCEECCCCCHHHHHCCCEEEEECCCCCCCCCCH
T ss_conf             3079988998999999999689999999-96389---9888489-99999998578888851768999897632575508


Q ss_pred             -ECHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH-
Q ss_conf             -44178768999999866769999-99807786799---------9998864202677666543233867999844568-
Q gi|254780606|r  472 -TNPKKAVMALKWAVREMEERYRK-MSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA-  539 (744)
Q Consensus       472 -~~~~~~~~~l~~~~~em~~r~~~-~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a-  539 (744)
                       .+..........-.+++.+|... +...+..++..         =.+|+.-...         +..-|- +++.||=. 
T Consensus       100 ~e~i~~g~~~~~~~~~e~~~~v~~~l~~~~l~~~~~~~P~~LSGGqrQRvaIA~a---------La~~P~-ililDEPTs  169 (277)
T PRK13642        100 EDDVAFGMENQGIPREEMIKRVDEALLAVNMLDFKTREPARLSGGQKQRVAVAGI---------IALRPE-IIILDESTS  169 (277)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH---------HHCCCC-EEEEECCCC
T ss_conf             8889877766699999999999999987799656557912289999999999999---------966999-999958876


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCE
Q ss_conf             76753103589999999996420135899985165444414678850563057203681110032676316885689846
Q gi|254780606|r  540 DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDM  619 (744)
Q Consensus       540 ~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~  619 (744)
                      .|-.....++...|.   ++.+..|+-+|+.|...+      .+ +. .-||.+--    +-+ |+-++-.+.++.+-+.
T Consensus       170 ~LD~~~~~~i~~ll~---~L~~~~~~Tii~iTHdl~------~~-~~-aDrv~vm~----~G~-Iv~~G~~~evf~~p~~  233 (277)
T PRK13642        170 MLDPTGRSEIMRVIH---EIKDKYHLTVLSITHDLD------EA-AS-SDRILVMR----AGE-IIKEAAPSELFATSED  233 (277)
T ss_pred             CCCHHHHHHHHHHHH---HHHHHCCCEEEEEEECHH------HH-HH-CCEEEEEE----CCE-EEEECCHHHHHCCHHH
T ss_conf             589899999999999---999816989999945889------99-71-99899998----999-9997689998769677


Q ss_pred             EEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCC
Q ss_conf             8646898438999343898899999999984088
Q gi|254780606|r  620 LYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGC  653 (744)
Q Consensus       620 l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~  653 (744)
                      |...           .+.-..+-++...++..|.
T Consensus       234 l~~~-----------~l~~P~~~~l~~~L~~~g~  256 (277)
T PRK13642        234 MVEI-----------GLDVPFSSNLMKDLRTNGF  256 (277)
T ss_pred             HHHC-----------CCCCCHHHHHHHHHHHCCC
T ss_conf             9877-----------9999879999999997599


No 320
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=93.32  E-value=0.48  Score=26.14  Aligned_cols=47  Identities=23%  Similarity=0.369  Sum_probs=29.1

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             887321120----1148469970787534479999999999856801107999
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      .|..++-|+    .+.--+.+-|..|||||++++. |+++. .+.|+.=++++
T Consensus        11 g~~~vL~~vsl~v~~Gei~~iiGpnGaGKSTLl~~-i~G~~-~~~~~~G~I~~   61 (200)
T cd03217          11 GGKEILKGVNLTIKKGEVHALMGPNGSGKSTLAKT-IMGHP-KYEVTEGEILF   61 (200)
T ss_pred             CCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHH-HCCCC-CCCCCCCEEEE
T ss_conf             99998855056887998999996899999999999-70777-77852007999


No 321
>PRK13768 GTPase; Provisional
Probab=93.31  E-value=0.47  Score=26.21  Aligned_cols=44  Identities=25%  Similarity=0.403  Sum_probs=31.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC
Q ss_conf             46997078753447999999999985680110799972342100012
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY  460 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~  460 (744)
                      -.+|.|.-|||||++.+.+-.-|-.  .-..+.++=.||-. +...|
T Consensus         4 ~~~ViGpaGSGKsT~~~~l~~~l~~--~~r~~~vvNLDPA~-e~~pY   47 (253)
T PRK13768          4 IVFFLGTAGSGKTTLVGALSDWLEE--QGYDVAIVNLDPAV-EYLPY   47 (253)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHH--CCCCEEEEECCCCC-CCCCC
T ss_conf             8999899999889999999999997--69975999789866-58999


No 322
>TIGR02142 modC_ABC molybdate ABC transporter, ATP-binding protein; InterPro: IPR011868   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulphate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulphate transporter rather than by a specific molybdate transporter.; GO: 0005524 ATP binding, 0015098 molybdate ion transmembrane transporter activity, 0015689 molybdate ion transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=93.29  E-value=0.067  Score=32.02  Aligned_cols=197  Identities=23%  Similarity=0.294  Sum_probs=93.4

Q ss_pred             EEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC------CCCCEECC--------
Q ss_conf             9842057887321120114846997078753447999999999985680110799972------34210001--------
Q gi|254780606|r  394 LCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD------PKMLELSV--------  459 (744)
Q Consensus       394 ~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD------~k~~~~~~--------  459 (744)
                      +-+-.++.|+-|         +-|+|..|||||.+|| +|.+|.   .|+.=++.|=|      -|++.|..        
T Consensus        14 Ld~~~~~pg~Gv---------tAlFG~SGsGKTtli~-~iaGL~---rp~~G~i~l~G~~L~ds~k~i~Lp~ekRr~GYV   80 (361)
T TIGR02142        14 LDVDLTLPGQGV---------TALFGRSGSGKTTLIR-LIAGLT---RPDEGEIVLNGEVLFDSRKGIFLPPEKRRIGYV   80 (361)
T ss_pred             EEEEEECCCCEE---------EEEECCCCCHHHHHHH-HHHHCC---CCCCCEEEECCEEEECCCCCCCCCCCCCEEEEE
T ss_conf             777653287406---------8712589970789999-987316---756687998874620567766787201135368


Q ss_pred             CC---CCCCEEEEEEECHH----HHHHHH----HHHHHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             25---77520000444417----876899----9999866769999998077867-999998864202677666543233
Q gi|254780606|r  460 YD---GIPHLLTPVVTNPK----KAVMAL----KWAVREMEERYRKMSHLSVRNI-KSYNERISTMYGEKPQGCGDDMRP  527 (744)
Q Consensus       460 ~~---~~ph~~~~v~~~~~----~~~~~l----~~~~~em~~r~~~~~~~~~~~i-~~~n~~~~~~~~~~~~~~~~~~~~  527 (744)
                      |+   -+||+-  |-.|..    ++....    ...+-+|-.---|+.+ ..+.+ .+=.+|++-.+.--         -
T Consensus        81 FQeA~LFPHl~--Vr~NL~YG~~~~~~~~r~i~~~~v~~lLgi~hLL~R-~p~~LSGGEkQRVAIGRALL---------s  148 (361)
T TIGR02142        81 FQEARLFPHLS--VRGNLRYGMKRARPKERRISFERVIELLGIEHLLER-LPGRLSGGEKQRVAIGRALL---------S  148 (361)
T ss_pred             EECCEECCCHH--HHHHHHCCCCCCCHHHCCCCHHHHHHHHCCCCCCCC-CCCCCCCCCHHHHHHHHHHH---------C
T ss_conf             85355078523--345512572105741213788999987467511216-78875784047788998874---------1


Q ss_pred             CCEEEEEHHH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC----------HHH-----------HHH
Q ss_conf             8679998445-687675310358999999999642013589998516544441----------467-----------885
Q gi|254780606|r  528 MPYIVIIVDE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVI----------TGT-----------IKA  585 (744)
Q Consensus       528 ~p~ivvviDE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi----------~~~-----------ik~  585 (744)
                      -|.+++ .|| +|-|=+.-++||-=++.||   .+..+|=+|+-+--++ .|.          .|.           =+.
T Consensus       149 ~P~LLL-MDEPLaaLD~~rk~EilPYLerL---~~e~~iP~lyVSHsl~-Ev~rLADrvvvl~~GrV~a~G~~~~v~~~~  223 (361)
T TIGR02142       149 SPRLLL-MDEPLAALDEPRKKEILPYLERL---HAELKIPILYVSHSLD-EVARLADRVVVLEDGRVEAAGPLEEVWSSP  223 (361)
T ss_pred             CCCHHH-CCCCHHHCCHHHHHHHCCHHHHH---HHHHCCCEEEEECCHH-HHHHHHCEEEEEECCEECCCCCHHHHHCCC
T ss_conf             874111-04662340644466416167678---9872798899904979-998760747874357010368679995365


Q ss_pred             CCCCEEEEECCCHHHCCHHCCCCCHHHH----CC-CCCEE
Q ss_conf             0563057203681110032676316885----68-98468
Q gi|254780606|r  586 NFPIRISFQVTSKIDSRTILGEHGAEQL----LG-RGDML  620 (744)
Q Consensus       586 n~~~ri~~~v~~~~dsr~il~~~gae~l----~g-~gd~l  620 (744)
                      ||+.=+.+.=.+.+-+-+|..-.-.+.|    +| .|..+
T Consensus       224 ~l~p~~~~~~~g~~~~~~v~~~~~~ygL~~l~l~e~~~l~  263 (361)
T TIGR02142       224 DLPPWLEREEAGSVLEGVVAEHDQHYGLTALRLGEDGHLW  263 (361)
T ss_pred             CCCCCCCCCCCCEEEEEEEECCCCCCCCEECCCCCCCEEE
T ss_conf             7772325786633656541103865320120158883899


No 323
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=93.29  E-value=0.64  Score=25.32  Aligned_cols=26  Identities=19%  Similarity=0.432  Sum_probs=13.2

Q ss_pred             HCCC-EEEEECCCCCHHHHHHHHHHHH
Q ss_conf             1484-6997078753447999999999
Q gi|254780606|r  411 NMPH-ILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       411 ~~PH-~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +.+| .|-.|.-|.|||.+-+-+..+|
T Consensus        41 ~~~~aylf~G~rG~GKTt~Ari~ak~l   67 (507)
T PRK06645         41 RLAGGYLLTGIRGVGKTTSARIIAKAV   67 (507)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             966347745879978899999999996


No 324
>pfam05049 IIGP Interferon-inducible GTPase (IIGP). Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence. IIGP is predominantly associated with the Golgi apparatus and also localizes to the endoplasmic reticulum and exerts a distinct role in IFN-induced intracellular membrane trafficking or processing.
Probab=93.28  E-value=0.063  Score=32.20  Aligned_cols=26  Identities=38%  Similarity=0.704  Sum_probs=20.3

Q ss_pred             CHHHCC-CEEEEECCCCCHHHHHHHHH
Q ss_conf             201148-46997078753447999999
Q gi|254780606|r  408 DLANMP-HILVAGTTGSGKSVAINTMI  433 (744)
Q Consensus       408 dl~~~P-H~lvaG~TgsGKS~~l~~~i  433 (744)
                      ++.+.| ++-|.|.+|+|||.|||++-
T Consensus        30 ~~~~~~lnIavtGesG~GkSsfINalR   56 (375)
T pfam05049        30 EISSAPLKIAVTGDSGNGKSSFINALR   56 (375)
T ss_pred             HHHCCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             544382479985489986789999874


No 325
>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=93.26  E-value=0.64  Score=25.30  Aligned_cols=29  Identities=17%  Similarity=0.217  Sum_probs=23.8

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             14846997078753447999999999985
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYR  439 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~  439 (744)
                      +.-.+++.|.+|.|||-+..++...++.+
T Consensus        46 ~~~Nlll~G~~GtGKThLA~Ai~~~~~~~   74 (178)
T pfam01695        46 QAENLLLLGPPGVGKTHLACALGHQACRA   74 (178)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             58768998999987899999999999986


No 326
>pfam05673 DUF815 Protein of unknown function (DUF815). This family consists of several bacterial proteins of unknown function.
Probab=93.24  E-value=0.12  Score=30.23  Aligned_cols=68  Identities=19%  Similarity=0.349  Sum_probs=39.6

Q ss_pred             CCCEEEHHHHHCCHHHCCC--CCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             8870765875128121146--78368984205788732112011484699707875344799999999998568011079
Q gi|254780606|r  370 TRETVYLRQIIESRSFSHS--KANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       370 ~~~~v~~~~~~~~~~~~~~--~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      ....|.|.+|+.-+.-+..  .....+     +.|.       ..-|+|+-|+-|.|||.++++++    ..+.++.|+|
T Consensus        21 ~~d~v~l~~L~Gie~Qk~~l~~NT~~F-----~~G~-------pAnnvLLwG~RGtGKSSlVKall----~~~~~~gLrl   84 (248)
T pfam05673        21 HPDPVDLDDLVGIDRQKEALLRNTEQF-----LAGL-------PANNVLLWGARGTGKSSLVKALL----NEYADQGLRL   84 (248)
T ss_pred             CCCCCCHHHHCCHHHHHHHHHHHHHHH-----HCCC-------CCCCEEEECCCCCCHHHHHHHHH----HHHHHCCCEE
T ss_conf             889899889349399999999999999-----8089-------86136767689898889999999----9863149569


Q ss_pred             EEECCC
Q ss_conf             997234
Q gi|254780606|r  448 IMVDPK  453 (744)
Q Consensus       448 ~liD~k  453 (744)
                      |=|+-.
T Consensus        85 IEv~k~   90 (248)
T pfam05673        85 IEVDKD   90 (248)
T ss_pred             EEECHH
T ss_conf             998788


No 327
>PRK02362 ski2-like helicase; Provisional
Probab=93.23  E-value=0.6  Score=25.47  Aligned_cols=48  Identities=17%  Similarity=0.171  Sum_probs=25.2

Q ss_pred             CCEEEEEHHHHHHHHHHCC---HHHHHHHHHHHHHHH----CCEEEEEEEECCCC
Q ss_conf             8679998445687675310---358999999999642----01358999851654
Q gi|254780606|r  528 MPYIVIIVDEMADLMMVAG---KEIEGAIQRLAQMAR----AAGIHLIMATQRPS  575 (744)
Q Consensus       528 ~p~ivvviDE~a~l~~~~~---~~~e~~~~~la~~~r----a~GihlilatQrp~  575 (744)
                      ||---|||..+...-...+   -.+-++.+-++|-||    ..|.-+|+|.++..
T Consensus       345 LPAr~VIi~~~~~~~~~~g~~~l~~~e~~QM~GRAGRpg~D~~G~aili~~~~~~  399 (736)
T PRK02362        345 LPARRVIIRDYRRYDSGAGMQPIPVLEYHQMAGRAGRPRLDPYGEAVLLAKSYDE  399 (736)
T ss_pred             CCEEEEEEECCEEECCCCCCEECCHHHHHHHHHHCCCCCCCCCCEEEEEECCHHH
T ss_conf             8526999804367369888336889999999852489988988629999678278


No 328
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=93.22  E-value=0.57  Score=25.63  Aligned_cols=29  Identities=21%  Similarity=0.226  Sum_probs=22.6

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             112011484699707875344799999999
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMS  435 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~s  435 (744)
                      -+++.+.=.+.|.|..|||||++++.| ++
T Consensus        26 sl~i~~Gei~aiiG~nGsGKSTL~~~i-~G   54 (252)
T CHL00131         26 NLSINAGEIHAIMGPNGSGKSTLSKVI-AG   54 (252)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHH-CC
T ss_conf             778879989999999999999999997-27


No 329
>PRK09183 transposase/IS protein; Provisional
Probab=93.20  E-value=0.66  Score=25.23  Aligned_cols=28  Identities=18%  Similarity=0.254  Sum_probs=20.9

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             1484699707875344799999999998
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLY  438 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~  438 (744)
                      +.=++++.|.||.|||-+-.++-...+.
T Consensus       100 ~~~Nvil~G~~GtGKThLA~Alg~~A~~  127 (258)
T PRK09183        100 RNENIVLLGPSGVGKTHLAIALGYEAVR  127 (258)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             5886799899998689999999999998


No 330
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=93.19  E-value=0.11  Score=30.61  Aligned_cols=34  Identities=32%  Similarity=0.358  Sum_probs=25.4

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             2112011484699707875344799999999998
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLY  438 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~  438 (744)
                      +-+++.+.=.+.|.|..|||||++|+.++...+.
T Consensus        14 vsl~i~~G~~~aIiG~sGsGKSTLl~~~L~~~~~   47 (261)
T cd03271          14 IDVDIPLGVLTCVTGVSGSGKSSLINDTLYPALA   47 (261)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             5889889999999879998699999999888541


No 331
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=93.18  E-value=0.66  Score=25.21  Aligned_cols=127  Identities=19%  Similarity=0.274  Sum_probs=67.2

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC-----------CCEECCCCCCCCEEEEEEECHHHH
Q ss_conf             011484699707875344799999999998568011079997234-----------210001257752000044441787
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK-----------MLELSVYDGIPHLLTPVVTNPKKA  477 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k-----------~~~~~~~~~~ph~~~~v~~~~~~~  477 (744)
                      |.+.--.||.|.+|+|||+|--..+..-+.+  -+.+-++.++-.           +.+|..|..--.+.. +..++.+.
T Consensus       263 l~~GsstLi~Gp~GtGKTtla~qFl~~~a~~--GE~~l~~~FeE~~~~l~~~a~~~G~dl~~~~~~G~l~i-~~~~p~~~  339 (501)
T PRK09302        263 FFRGSIILVSGATGTGKTLLVSKFAEAACRR--GERCLLFAFEESRAQLVRNATSWGIDLEEMERKGLLKI-ICARPEST  339 (501)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHC--CCCEEEEEEECCHHHHHHHHHHCCCCHHHHHHCCCEEE-EEECCCCC
T ss_conf             7589469998899988899999999999865--99089999967999999999973998488874894799-98370005


Q ss_pred             H-HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHC-CHHHHHHHHH
Q ss_conf             6-8999999866769999998077867999998864202677666543233867999844568767531-0358999999
Q gi|254780606|r  478 V-MALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVA-GKEIEGAIQR  555 (744)
Q Consensus       478 ~-~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~-~~~~e~~~~~  555 (744)
                      . ..+-+.+.+.              +   ++.                  -+ -.||||=+..+.... ..++...+.+
T Consensus       340 ~~~e~~~~i~~~--------------v---~~~------------------~~-~rVvIDsls~~~~~~~~~~~r~~l~~  383 (501)
T PRK09302        340 GLEDHLQIIKRE--------------I---EEF------------------KP-SRVAVDPLSALARGGSLNEFRQFVIR  383 (501)
T ss_pred             CHHHHHHHHHHH--------------H---HHC------------------CC-CEEEECCHHHHHHHCCHHHHHHHHHH
T ss_conf             989999999999--------------9---972------------------99-89999580687652685999999999


Q ss_pred             HHHHHHCCEEEEEEEECCC
Q ss_conf             9996420135899985165
Q gi|254780606|r  556 LAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       556 la~~~ra~GihlilatQrp  574 (744)
                      |...=+..||-.|+.....
T Consensus       384 L~~~Lk~~gvT~l~t~~~~  402 (501)
T PRK09302        384 LTDYLKQEEITGLFTNLTP  402 (501)
T ss_pred             HHHHHHHCCCEEEEEEECC
T ss_conf             9999976897899976123


No 332
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=93.17  E-value=0.66  Score=25.20  Aligned_cols=46  Identities=15%  Similarity=0.286  Sum_probs=30.4

Q ss_pred             CEEEEEHHHHHHHHHHC----CH------HHHHHHHHHHHHHHCCEEEEEEEECCC
Q ss_conf             67999844568767531----03------589999999996420135899985165
Q gi|254780606|r  529 PYIVIIVDEMADLMMVA----GK------EIEGAIQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~----~~------~~e~~~~~la~~~ra~GihlilatQrp  574 (744)
                      ++-+||||-++.++...    ++      ..-..+..|.++|+..+|-+++..|--
T Consensus       199 ~v~LvVvDSi~alfR~e~~grg~l~~Rq~~L~~~l~~L~~lA~~~niaVvvTNQV~  254 (318)
T PRK04301        199 NIKLVIVDSLTAHFRAEYVGRGNLAERQQKLNKHLHDLLRLADLYNAAVVVTNQVM  254 (318)
T ss_pred             CCEEEEEECCHHHEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             80499994342321210468530999999999999999999998595799961367


No 333
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]
Probab=93.09  E-value=0.055  Score=32.62  Aligned_cols=42  Identities=19%  Similarity=0.407  Sum_probs=27.3

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             3211201148469970787534479999999999856801107999
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      ||-..+.+.--+.+.|.-|||||+|+. ++++|   +.|+.=++++
T Consensus       341 PiNl~ikrGelvFliG~NGsGKST~~~-LLtGL---~~PqsG~I~l  382 (546)
T COG4615         341 PINLTIKRGELVFLIGGNGSGKSTLAM-LLTGL---YQPQSGEILL  382 (546)
T ss_pred             CEEEEEECCCEEEEECCCCCCHHHHHH-HHHHC---CCCCCCCEEE
T ss_conf             613687337389998889963889999-99706---6888882667


No 334
>pfam01637 Arch_ATPase Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family.
Probab=93.08  E-value=0.68  Score=25.12  Aligned_cols=42  Identities=14%  Similarity=0.230  Sum_probs=24.0

Q ss_pred             EEEEEHHHHHHHHHHC-CHHHHHHHHHHHHH-HHCCEEEEEEEE
Q ss_conf             7999844568767531-03589999999996-420135899985
Q gi|254780606|r  530 YIVIIVDEMADLMMVA-GKEIEGAIQRLAQM-ARAAGIHLIMAT  571 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~-~~~~e~~~~~la~~-~ra~Gihlilat  571 (744)
                      .++||||||..+.... .+.+...++++-.. -...-+.+|+|.
T Consensus       110 ~~iiviDEfq~l~~~~~~~~~~~~l~~~~d~~~~~~~~~~I~~G  153 (223)
T pfam01637       110 KIAIIIDEVQYAIGLNGAESYVKLLLNLIDYPPKEYHLIVVLCG  153 (223)
T ss_pred             CEEEEEECHHHHHHCCCCHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             65999701677640244305999999999975245775899972


No 335
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=93.08  E-value=0.37  Score=26.93  Aligned_cols=70  Identities=17%  Similarity=0.321  Sum_probs=38.8

Q ss_pred             CEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCC
Q ss_conf             679998445687675310358999999999642013589998516544441467885056305720368111003267
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILG  606 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~  606 (744)
                      .|-|+|||+.-+|..    +....+-.+---= .....+||.|-.|+ .+++ .|++-. -++.|+--+..+-...|-
T Consensus       139 ~~kV~IId~ad~mn~----~aaNALLK~LEEP-P~~t~fiLit~~~~-~llp-TI~SRC-q~~~~~~l~~~~~~~~L~  208 (363)
T PRK07471        139 GWRVVIVDTADEMNA----NAANALLKVLEEP-PARSLLLLVSHAPA-RLLP-TIRSRC-RKLRLRPLAPEDVIAALA  208 (363)
T ss_pred             CCEEEEEECHHHHCH----HHHHHHHHHHCCC-CCCEEEEEEECCHH-HCHH-HHHHHC-CCCCCCCCCHHHHHHHHH
T ss_conf             966999868787388----9999999972158-98838998639977-7779-999735-242589959999999999


No 336
>PTZ00243 ABC transporter; Provisional
Probab=93.03  E-value=0.088  Score=31.21  Aligned_cols=27  Identities=30%  Similarity=0.479  Sum_probs=18.1

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             114846997078753447999999999
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      .+.=...|.|.+|||||.+|++|+--|
T Consensus       684 ~~G~L~~IvG~vGSGKSSLL~aiLGE~  710 (1560)
T PTZ00243        684 PRGKLTVVLGATGSGKSTLLQSLLSQF  710 (1560)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             599789998999987999999996888


No 337
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=93.01  E-value=0.37  Score=26.91  Aligned_cols=155  Identities=21%  Similarity=0.390  Sum_probs=77.2

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC------CEEC---CC-----CCCCCEEEEEEECH
Q ss_conf             0114846997078753447999999999985680110799972342------1000---12-----57752000044441
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM------LELS---VY-----DGIPHLLTPVVTNP  474 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~------~~~~---~~-----~~~ph~~~~v~~~~  474 (744)
                      +.+.--+.+-|..|||||+.|+ ||-.|+   .|+.=+ ++||-+.      ++|-   .|     --.||+-  |..|.
T Consensus        24 I~~gef~vliGpSGsGKTTtLk-MINrLi---ept~G~-I~i~g~~i~~~d~~~LRr~IGYviQqigLFPh~T--v~eNI   96 (309)
T COG1125          24 IEEGEFLVLIGPSGSGKTTTLK-MINRLI---EPTSGE-ILIDGEDISDLDPVELRRKIGYVIQQIGLFPHLT--VAENI   96 (309)
T ss_pred             ECCCEEEEEECCCCCCHHHHHH-HHHCCC---CCCCCE-EEECCEECCCCCHHHHHHHHHHHHHHCCCCCCCC--HHHHH
T ss_conf             6597289998789975787999-996055---888853-8989904465888999875335422215677635--98778


Q ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHHHHHHHHHHHCCCCCCCC---CCCCCCCEEEEEHHH-HHHHHHHCCHHH
Q ss_conf             787689999998667699-999980778679999988642026776665---432338679998445-687675310358
Q gi|254780606|r  475 KKAVMALKWAVREMEERY-RKMSHLSVRNIKSYNERISTMYGEKPQGCG---DDMRPMPYIVIIVDE-MADLMMVAGKEI  549 (744)
Q Consensus       475 ~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~---~~~~~~p~ivvviDE-~a~l~~~~~~~~  549 (744)
                      .-....++|-.++.+.|. ++|...|.. -..|-.|....-+.......   .-+..-|-|+ ..|| |..|--..-+..
T Consensus        97 a~VP~L~~w~k~~i~~r~~ELl~lvgL~-p~~~~~RyP~eLSGGQQQRVGv~RALAadP~il-LMDEPFgALDpI~R~~l  174 (309)
T COG1125          97 ATVPKLLGWDKERIKKRADELLDLVGLD-PSEYADRYPHELSGGQQQRVGVARALAADPPIL-LMDEPFGALDPITRKQL  174 (309)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHCCC-HHHHHHCCCHHCCCCHHHHHHHHHHHHCCCCEE-EECCCCCCCCHHHHHHH
T ss_conf             7615541779899999999999984989-789732092221862135888999974198868-63488554476549999


Q ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             99999999964201358999851654
Q gi|254780606|r  550 EGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       550 e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      ...   +..+-|-.|--.|+-|---+
T Consensus       175 Q~e---~~~lq~~l~kTivfVTHDid  197 (309)
T COG1125         175 QEE---IKELQKELGKTIVFVTHDID  197 (309)
T ss_pred             HHH---HHHHHHHHCCEEEEEECCHH
T ss_conf             999---99999985987999935788


No 338
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=93.00  E-value=0.41  Score=26.66  Aligned_cols=24  Identities=29%  Similarity=0.602  Sum_probs=18.4

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             484699707875344799999999
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMS  435 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~s  435 (744)
                      ..=..+-|..|||||++|++|...
T Consensus        22 ~~itaivG~NGaGKSTLl~~i~~~   45 (204)
T cd03240          22 SPLTLIVGQNGAGKTTIIEALKYA   45 (204)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHC
T ss_conf             888999989999999999998630


No 339
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I; InterPro: IPR011913    RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis. RfaE is a bifunctional protein in Escherichia coli, and separate proteins in some other genome. The longer, N-terminal domain I (this family) is suggested to act in D-glycero-D-manno-heptose 1-phosphate biosynthesis, while domain II (IPR011914 from INTERPRO) adds ADP to yield ADP-D-glycero-D-manno-heptose .; GO: 0016773 phosphotransferase activity alcohol group as acceptor, 0016779 nucleotidyltransferase activity, 0005975 carbohydrate metabolic process.
Probab=92.95  E-value=0.059  Score=32.41  Aligned_cols=147  Identities=25%  Similarity=0.365  Sum_probs=81.8

Q ss_pred             HHHHHHHHHHHCCCC--EEEEEEEECCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEEECCCCC
Q ss_conf             899999987403551--389867648925899975488863999985999999871477632775189834544268888
Q gi|254780606|r  293 NAGSLETILEEFGIK--GEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNET  370 (744)
Q Consensus       293 ~~~~l~~~l~~~~~~--~~~~~~~~gp~~~~~~~~~~~g~~~~~~~~~~~d~~~~~~~~~~~~~~~pg~~~~~~~~p~~~  370 (744)
                      .+..|+..|+..||+  ..++...-=||++.-++                 |+++ .-.=+||             -...
T Consensus        75 ~g~~L~~ll~~~g~~~~~~l~~d~~rpT~~K~Rv-----------------~a~~-~QQllR~-------------D~E~  123 (321)
T TIGR02198        75 AGKALEALLKEEGIDDTSGLIRDKSRPTTTKTRV-----------------LARA-NQQLLRV-------------DFEE  123 (321)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEECCCCCEEEEEE-----------------EECC-CEEEEEE-------------EEEC
T ss_conf             8999999997458643300277689894488888-----------------6046-5058997-------------4102


Q ss_pred             CCEEE---HHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             87076---587512812114678368984205788732112011484699707875344799999999998568011079
Q gi|254780606|r  371 RETVY---LRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       371 ~~~v~---~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      +....   ...|++  .|...-...-+         .|+-|              .||-++-++++..++-.+.-.. +.
T Consensus       124 ~~~~~~~~~~~L~~--~~~~~l~~~d~---------VvLSD--------------YaKGvLt~~v~~~~I~~Ar~~~-~p  177 (321)
T TIGR02198       124 RKPINAEEEARLLA--AIKEQLASADA---------VVLSD--------------YAKGVLTPSVVQEVIAAAREAG-KP  177 (321)
T ss_pred             CCCCCHHHHHHHHH--HHHHHHCCCCE---------EEEEE--------------CCCCCCCHHHHHHHHHHHHHCC-CC
T ss_conf             77689778999999--99997232878---------99986--------------6876358578999999999668-91


Q ss_pred             EEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHH----HHH--HHHHHH-HHHHHHCCC
Q ss_conf             99723421000125775200004444178768999----999--866769-999998077
Q gi|254780606|r  448 IMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALK----WAV--REMEER-YRKMSHLSV  500 (744)
Q Consensus       448 ~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~----~~~--~em~~r-~~~~~~~~~  500 (744)
                      +|||||+.+|+.|.|-= |++|   |.+++..++.    .+.  .|...+ .+|+.++..
T Consensus       178 VlVDPKg~df~~Y~GAt-l~TP---N~~E~~~avG~~~~~~~~~~~~~~aa~~L~~~~~l  233 (321)
T TIGR02198       178 VLVDPKGKDFSRYRGAT-LITP---NRKEAEAAVGIKFIACENEAELVKAAEKLLEELDL  233 (321)
T ss_pred             EEEECCCCCHHHHCCCC-CCCC---CHHHHHHHHCCCCHHCCCCHHHHHHHHHHHHHCCC
T ss_conf             99807876234514664-2366---87999998588701105817899999999997099


No 340
>KOG0991 consensus
Probab=92.94  E-value=0.076  Score=31.66  Aligned_cols=41  Identities=29%  Similarity=0.560  Sum_probs=31.3

Q ss_pred             ECCCCCEEECCH-------HHCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             057887321120-------11484699707875344799999999998
Q gi|254780606|r  398 KTISGESVIADL-------ANMPHILVAGTTGSGKSVAINTMIMSLLY  438 (744)
Q Consensus       398 ~~~~g~~~~~dl-------~~~PH~lvaG~TgsGKS~~l~~~i~sl~~  438 (744)
                      .||-|+--..+.       .+|||++++|..|.||+.++.++..-||-
T Consensus        27 ~dIVGNe~tv~rl~via~~gnmP~liisGpPG~GKTTsi~~LAr~LLG   74 (333)
T KOG0991          27 QDIVGNEDTVERLSVIAKEGNMPNLIISGPPGTGKTTSILCLARELLG   74 (333)
T ss_pred             HHHHCCHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             882177989999999997289986675279998616489999999838


No 341
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=92.94  E-value=0.17  Score=29.23  Aligned_cols=40  Identities=20%  Similarity=0.238  Sum_probs=27.0

Q ss_pred             EECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             2057887321120----1148469970787534479999999999
Q gi|254780606|r  397 GKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       397 g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      -.+-..++++-|+    .+.=.+.|.|.+|||||++++.|+ +|+
T Consensus        28 ~Y~~~~~~vL~~inl~I~~Ge~vaIvG~sGsGKSTL~~ll~-gl~   71 (257)
T cd03288          28 RYENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFF-RMV   71 (257)
T ss_pred             EECCCCCCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHH-HCC
T ss_conf             93989957310538998799999999999981999999996-056


No 342
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=92.92  E-value=0.69  Score=25.07  Aligned_cols=138  Identities=17%  Similarity=0.274  Sum_probs=67.9

Q ss_pred             HHCCC-EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             11484-69970787534479999999999856801107999723421000125775200004444178768999999866
Q gi|254780606|r  410 ANMPH-ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREM  488 (744)
Q Consensus       410 ~~~PH-~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em  488 (744)
                      .+.|| .|..|.-|.||+.+-+.+..+|+-. ..+.           +      -|.++.   -++....          
T Consensus        23 ~rl~HAyLF~Gp~G~GK~~~A~~~A~~ll~~-~~~~-----------~------~~D~~~---~~~~~~~----------   71 (313)
T PRK05564         23 GKFSHASLIVGEDGIGKSILAKEIANKILGK-SEQR-----------E------YVDIIE---YKPINKK----------   71 (313)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCC-CCCC-----------C------CCCEEE---EECCCCC----------
T ss_conf             9987504327999850999999999998289-9778-----------8------986588---6332256----------


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             76999999807786799999886420267766654323386799984456876753103589999999996420135899
Q gi|254780606|r  489 EERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLI  568 (744)
Q Consensus       489 ~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihli  568 (744)
                              ..++..|.+..+++...   ...        -.|-|+||||...|...    ...++-..--- =.-....|
T Consensus        72 --------~I~vd~IR~l~~~~~~~---p~~--------g~~KV~II~~ae~m~~~----AaNALLKtLEE-PP~~t~fI  127 (313)
T PRK05564         72 --------SIGVDDIRNIIEEVNKK---PYE--------GDKKVIIIYKSEKMTEQ----AQNAFLKTIEE-PPKGVFII  127 (313)
T ss_pred             --------CCCHHHHHHHHHHHHHC---CCC--------CCCEEEEECCHHHHCHH----HHHHHHHCCCC-CCCCEEEE
T ss_conf             --------99989999999998408---625--------89569998077775899----99998455036-89985899


Q ss_pred             EEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHC
Q ss_conf             9851654444146788505630572036811100326
Q gi|254780606|r  569 MATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTIL  605 (744)
Q Consensus       569 latQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il  605 (744)
                      |+|..|+ .++++ |+.=. -++-|+--+..+-...|
T Consensus       128 L~t~~~~-~lLpT-I~SRC-Q~~~f~~l~~~~i~~~L  161 (313)
T PRK05564        128 LLCENLE-QILDT-IKSRC-QIYKLNRLSKEDIEKFI  161 (313)
T ss_pred             EEECCHH-HCCCH-HHCCC-EEEECCCCCHHHHHHHH
T ss_conf             8649835-47577-87065-35668998999999999


No 343
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=92.91  E-value=0.2  Score=28.81  Aligned_cols=50  Identities=24%  Similarity=0.345  Sum_probs=30.6

Q ss_pred             CCCEEECC----HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC
Q ss_conf             88732112----01148469970787534479999999999856801107999723
Q gi|254780606|r  401 SGESVIAD----LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP  452 (744)
Q Consensus       401 ~g~~~~~d----l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~  452 (744)
                      .|+.++-|    +.+.-.+-|.|..|||||++++. |++++. -.--++.+.-.|.
T Consensus        13 g~~~~L~~vsl~i~~Gei~~liGpNGaGKSTLlk~-i~Gl~~-p~~G~I~~~g~~i   66 (257)
T PRK13548         13 GGKTVLDDVSLTLRPGEVVAILGPNGAGKSTLLRA-LSGELP-PSSGEVRLFGRPL   66 (257)
T ss_pred             CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCCC-CCCCEEEEECEEC
T ss_conf             99998803378986998999999999879999999-856757-7875699936576


No 344
>pfam02562 PhoH PhoH-like protein. PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation.
Probab=92.90  E-value=0.72  Score=24.94  Aligned_cols=43  Identities=19%  Similarity=0.285  Sum_probs=30.2

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             011484699707875344799999999998568011079997234
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      |.+.+.+.+.|..|+|||-+--+.-+.++....=  =+++++-|-
T Consensus        16 l~~~~iv~~~GpAGtGKT~la~~~al~~l~~~~~--~kiii~Rp~   58 (205)
T pfam02562        16 IRKNDIVFGIGPAGTGKTYLAVAAAVDALKDGKV--KRIILTRPA   58 (205)
T ss_pred             HHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCC--CEEEEEECC
T ss_conf             7179807998999860999999999999971894--379997577


No 345
>PRK05642 DNA replication initiation factor; Validated
Probab=92.89  E-value=0.24  Score=28.26  Aligned_cols=64  Identities=17%  Similarity=0.369  Sum_probs=38.0

Q ss_pred             EEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCC--CHHHHHHCCCCEEEEECCC
Q ss_conf             99844568767531035899999999964201358999851654444--1467885056305720368
Q gi|254780606|r  532 VIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDV--ITGTIKANFPIRISFQVTS  597 (744)
Q Consensus       532 vvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~v--i~~~ik~n~~~ri~~~v~~  597 (744)
                      +|+||.+..+.  ...+.|..+-.|--..+..|-.||+++-+|-.+.  .-..++.-|.+=..|++..
T Consensus       100 ~l~IDDi~~i~--g~~~~e~~lF~l~N~~~~~~~~llits~~~P~~l~~~l~DL~SRl~~~~~~~i~~  165 (234)
T PRK05642        100 LVCIDDLDVIA--GKADWEEALFHLFNRLRDSGRRLLLAASKSPRELPVKLPDLKSRLTLALVFQMRG  165 (234)
T ss_pred             EEEEECHHHHC--CCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHHHCCCEEEECC
T ss_conf             89893645546--8859999999999999983995999578795552300167999995781275148


No 346
>PRK10865 protein disaggregation chaperone; Provisional
Probab=92.88  E-value=0.18  Score=29.07  Aligned_cols=62  Identities=18%  Similarity=0.304  Sum_probs=30.4

Q ss_pred             CEEEEEEECCCCCEEECCHHH--CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHH---HEEEEEECC
Q ss_conf             368984205788732112011--48469970787534479999999999856801---107999723
Q gi|254780606|r  391 NLALCLGKTISGESVIADLAN--MPHILVAGTTGSGKSVAINTMIMSLLYRLRPD---ECRMIMVDP  452 (744)
Q Consensus       391 ~l~~~~g~~~~g~~~~~dl~~--~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~---~~~~~liD~  452 (744)
                      +|--++|+|-+=+-++-=|++  -...++-|-.|-|||..+..+..-++...-|+   ..+++-+|.
T Consensus       176 kldpvIGRd~EI~r~i~IL~RR~KNNpiLvGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~I~~LDl  242 (857)
T PRK10865        176 KLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDM  242 (857)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCCEEEEEH
T ss_conf             9998858299999999997025789975878999889999999999998389997881690247338


No 347
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=92.85  E-value=0.71  Score=24.99  Aligned_cols=149  Identities=17%  Similarity=0.277  Sum_probs=68.4

Q ss_pred             CHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-----CC---CCEECCCCCCCCEEEEEEECHHHHHH
Q ss_conf             20114846997078753447999999999985680110799972-----34---21000125775200004444178768
Q gi|254780606|r  408 DLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-----PK---MLELSVYDGIPHLLTPVVTNPKKAVM  479 (744)
Q Consensus       408 dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-----~k---~~~~~~~~~~ph~~~~v~~~~~~~~~  479 (744)
                      ++.+.--+-|-|.+|.|||++|| +|.+|.   .|+.=.+.+-+     |+   ++-|-.|.-+|.+ + |..|..-...
T Consensus        25 ~v~~GEfvsilGpSGcGKSTLLr-iiAGL~---~p~~G~V~~~g~~v~~p~~~~~~vFQ~~~LlPW~-T-v~~NV~l~l~   98 (248)
T COG1116          25 SVEKGEFVAILGPSGCGKSTLLR-LIAGLE---KPTSGEVLLDGRPVTGPGPDIGYVFQEDALLPWL-T-VLDNVALGLE   98 (248)
T ss_pred             EECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCCCEEEECCCCCCCCCCCEEEEECCCCCCCHH-H-HHHHHEEHHH
T ss_conf             87799799998999788999999-996878---7777559988821578998779992667645146-6-8844350441


Q ss_pred             HHHHHHHHHH-HHHHHHHHCCCCCHH---------HHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHHHHHCCHH
Q ss_conf             9999998667-699999980778679---------999988642026776665432338679998445-68767531035
Q gi|254780606|r  480 ALKWAVREME-ERYRKMSHLSVRNIK---------SYNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADLMMVAGKE  548 (744)
Q Consensus       480 ~l~~~~~em~-~r~~~~~~~~~~~i~---------~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l~~~~~~~  548 (744)
                      .-.....|.+ +-.+++...|.....         +-.+|++-.+.-.         .-|.|+ ..|| |..|-......
T Consensus        99 ~~~~~~~e~~~~a~~~L~~VgL~~~~~~~P~qLSGGMrQRVaiARAL~---------~~P~lL-LlDEPFgALDalTR~~  168 (248)
T COG1116          99 LRGKSKAEARERAKELLELVGLAGFEDKYPHQLSGGMRQRVAIARALA---------TRPKLL-LLDEPFGALDALTREE  168 (248)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCHHHCCCCCCCHHHHHHHHHHHHHH---------CCCCEE-EECCCCCHHHHHHHHH
T ss_conf             256561768999999999759742101696001847999999999971---------499979-8769741201999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             899999999964201358999851654
Q gi|254780606|r  549 IEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       549 ~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      +.+.+.+|-+.-|   .-+++-|-.-+
T Consensus       169 lq~~l~~lw~~~~---~TvllVTHdi~  192 (248)
T COG1116         169 LQDELLRLWEETR---KTVLLVTHDVD  192 (248)
T ss_pred             HHHHHHHHHHHHC---CEEEEEECCHH
T ss_conf             9999999999649---88999908989


No 348
>PRK09270 frcK putative fructose transport system kinase; Reviewed
Probab=92.83  E-value=0.14  Score=29.80  Aligned_cols=37  Identities=24%  Similarity=0.251  Sum_probs=25.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             6997078753447999999999985680110799972
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
                      +-|||.+|||||++-+.++..|-.......+-++=.|
T Consensus        37 IgIaG~pGSGKSTlA~~l~~~L~~~~~~~~~~~vpmD   73 (230)
T PRK09270         37 VGIAGPPGAGKSTLAETLWEALSQQGPELPAIQVPMD   73 (230)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             9998999889999999999998623799857997365


No 349
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=92.83  E-value=0.74  Score=24.87  Aligned_cols=188  Identities=15%  Similarity=0.152  Sum_probs=82.1

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE-----------ECCCCCCCCEEEEE-EECHHH
Q ss_conf             011484699707875344799999999998568011079997234210-----------00125775200004-444178
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE-----------LSVYDGIPHLLTPV-VTNPKK  476 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~-----------~~~~~~~ph~~~~v-~~~~~~  476 (744)
                      +-+.--+||.|..|+|||.|...++...+-.  -+.+-++-+|-...+           +..|...-++...- ......
T Consensus        20 ~p~g~~~lI~G~pGsGKT~f~~qfl~~~~~~--ge~vlyvs~~e~~~~l~~~~~~~g~d~~~~~~~g~l~i~d~~~~~~~   97 (260)
T COG0467          20 LPRGSVVLITGPPGTGKTIFALQFLYEGARE--GEPVLYVSTEESPEELLENARSFGWDLEVYIEKGKLAILDAFLSEKG   97 (260)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHC--CCEEEEEEEECCHHHHHHHHHHCCCCHHHHHHCCEEEEEECCCCCCC
T ss_conf             8899789999389986899999999977626--98589999206989999999880997789754440687631211125


Q ss_pred             HHH-HHH--HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHH--HCCHHHHH
Q ss_conf             768-999--9998667699999980778679999988642026776665432338679998445687675--31035899
Q gi|254780606|r  477 AVM-ALK--WAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMM--VAGKEIEG  551 (744)
Q Consensus       477 ~~~-~l~--~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~--~~~~~~e~  551 (744)
                      ... ...  ....++..+           |..+-                  ..++..++|||-+..+..  ......-.
T Consensus        98 ~~~~~~~~~~~~~~l~~~-----------I~~~~------------------~~~~~~~~ViDsi~~~~~~~~~~~~~r~  148 (260)
T COG0467          98 LVSIVVGDPLDLEELLDR-----------IREIV------------------EKEGADRVVIDSITELTLYLNDPALVRR  148 (260)
T ss_pred             CCCCCCCCCCCHHHHHHH-----------HHHHH------------------HHCCCCEEEEECCHHHHHHCCCHHHHHH
T ss_conf             420104665228999999-----------99999------------------8628988999663077665278257899


Q ss_pred             HHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEE-EECCC-CCEE
Q ss_conf             999999964201358999851654444146788505630572036811100326763168856898468-64689-8438
Q gi|254780606|r  552 AIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDML-YMSGG-GRIQ  629 (744)
Q Consensus       552 ~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l-~~~~~-~~~~  629 (744)
                      .+.++.+.-+..|+-.++.++-+....-.+       .+.-+    -+|.-+.|+....+....+.-|. ++..+ ....
T Consensus       149 ~~~~l~~~~~~~~~t~~~~~~~~~~~~~~~-------~~~~~----~vdgvI~l~~~~~~~~~~r~~~~i~k~r~~~~~~  217 (260)
T COG0467         149 ILLLLKRFLKKLGVTSLLTTEAPVEERGES-------GVEEY----IVDGVIRLDLKEIEGGGDRRYLRILKMRGTPHSL  217 (260)
T ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCCCCC-------CCEEE----EEEEEEEEEEEECCCCEEEEEEEEEECCCCCCCC
T ss_conf             999999876506848999974433466656-------61421----6899999977722572488899998346733577


Q ss_pred             EEEECCCCH
Q ss_conf             999343898
Q gi|254780606|r  630 RVHGPLVSD  638 (744)
Q Consensus       630 r~~~~~~~~  638 (744)
                      +.+-.-+.+
T Consensus       218 ~~~~~~i~~  226 (260)
T COG0467         218 KVIPFEITD  226 (260)
T ss_pred             CEEEEEEEC
T ss_conf             459999827


No 350
>COG1204 Superfamily II helicase [General function prediction only]
Probab=92.81  E-value=0.4  Score=26.71  Aligned_cols=43  Identities=21%  Similarity=0.150  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCHH
Q ss_conf             78899889999998740355138986764892589997548886399
Q gi|254780606|r  287 HEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSS  333 (744)
Q Consensus       287 ~~~~~~~~~~l~~~l~~~~~~~~~~~~~~gp~~~~~~~~~~~g~~~~  333 (744)
                      +.-.+++.+.+. .|+.||+++.+.   .|=.-..+|.....+|=|.
T Consensus        86 kALa~Ek~~~~~-~~~~~GirV~~~---TgD~~~~~~~l~~~~ViVt  128 (766)
T COG1204          86 KALAEEKYEEFS-RLEELGIRVGIS---TGDYDLDDERLARYDVIVT  128 (766)
T ss_pred             HHHHHHHHHHHH-HHHHCCCEEEEE---CCCCCCCHHHHCCCCEEEE
T ss_conf             999999999866-688659779996---4886555334145887997


No 351
>PRK07667 uridine kinase; Provisional
Probab=92.72  E-value=0.091  Score=31.10  Aligned_cols=22  Identities=18%  Similarity=0.289  Sum_probs=18.9

Q ss_pred             EEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9970787534479999999999
Q gi|254780606|r  416 LVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       416 lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      -|+|.+|||||.|-+.|.-.|-
T Consensus        18 gIaG~sgSGKTTla~~L~~~l~   39 (190)
T PRK07667         18 GIDGLSRSGKTTFVANLKENMK   39 (190)
T ss_pred             EEECCCCCCHHHHHHHHHHHHH
T ss_conf             9779897889999999999986


No 352
>COG0714 MoxR-like ATPases [General function prediction only]
Probab=92.70  E-value=0.45  Score=26.34  Aligned_cols=199  Identities=22%  Similarity=0.272  Sum_probs=96.1

Q ss_pred             EEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHH
Q ss_conf             42057887321120114846997078753447999999999985680110799972342100012577520000444417
Q gi|254780606|r  396 LGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPK  475 (744)
Q Consensus       396 ~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~  475 (744)
                      +|++..-.-+...+..+-|+|+-|-+|.|||.+.+++...+-       ..|+-|.+.          +++      ++.
T Consensus        27 ~g~~~~~~~~l~a~~~~~~vll~G~PG~gKT~la~~lA~~l~-------~~~~~i~~t----------~~l------~p~   83 (329)
T COG0714          27 VGDEEVIELALLALLAGGHVLLEGPPGVGKTLLARALARALG-------LPFVRIQCT----------PDL------LPS   83 (329)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHC-------CCCEEEECC----------CCC------CHH
T ss_conf             266999999999998599778779898777999999999838-------981899568----------998------888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEE---EEEHHHHHHHHHHCCHHHHHH
Q ss_conf             87689999998667699999980778679999988642026776665432338679---998445687675310358999
Q gi|254780606|r  476 KAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYI---VIIVDEMADLMMVAGKEIEGA  552 (744)
Q Consensus       476 ~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~i---vvviDE~a~l~~~~~~~~e~~  552 (744)
                      .......+...+.+        .+...              +.  .    .+++.=   ++.+||+..    +..++...
T Consensus        84 d~~G~~~~~~~~~~--------~~~~~--------------~~--~----gpl~~~~~~ill~DEInr----a~p~~q~a  131 (329)
T COG0714          84 DLLGTYAYAALLLE--------PGEFR--------------FV--P----GPLFAAVRVILLLDEINR----APPEVQNA  131 (329)
T ss_pred             HHCCHHHHHHHHCC--------CCEEE--------------EE--C----CCCCCCCCEEEEEECCCC----CCHHHHHH
T ss_conf             82056888766425--------77189--------------84--6----873345133899870345----89889999


Q ss_pred             HHHHHHH----------HHCCEEEEEEEECCC----CCCCCHHHHHHCCCCEEEEECC-CHHHCCHHCCCCCH-HHHCCC
Q ss_conf             9999996----------420135899985165----4444146788505630572036-81110032676316-885689
Q gi|254780606|r  553 IQRLAQM----------ARAAGIHLIMATQRP----SVDVITGTIKANFPIRISFQVT-SKIDSRTILGEHGA-EQLLGR  616 (744)
Q Consensus       553 ~~~la~~----------~ra~GihlilatQrp----~~~vi~~~ik~n~~~ri~~~v~-~~~dsr~il~~~ga-e~l~g~  616 (744)
                      +...-+.          -+.--..+++|||.|    ...-++--++..|..++-+.-. +...-+.|+-..+. ..+.  
T Consensus       132 Ll~~l~e~~vt~~~~~~~~~~~~f~viaT~Np~e~~g~~~l~eA~ldRf~~~~~v~yp~~~~e~~~i~~~~~~~~~~~--  209 (329)
T COG0714         132 LLEALEERQVTVPGLTTIRLPPPFIVIATQNPGEYEGTYPLPEALLDRFLLRIYVDYPDSEEEERIILARVGGVDELD--  209 (329)
T ss_pred             HHHHHHHCEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCCCHHHHCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCC--
T ss_conf             999997268970796653379987899826867657887899888810388776489973889999987365644320--


Q ss_pred             CCEEEE--CCCCCEEE----EEECCCCHHHHHHHHHHHHHC
Q ss_conf             846864--68984389----993438988999999999840
Q gi|254780606|r  617 GDMLYM--SGGGRIQR----VHGPLVSDIEIEKVVQHLKKQ  651 (744)
Q Consensus       617 gd~l~~--~~~~~~~r----~~~~~~~~~~~~~~~~~~~~~  651 (744)
                      ...+-.  ..-...+|    +.+..++++-+..++..+..-
T Consensus       210 ~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  250 (329)
T COG0714         210 LESLVKPVLSDEELLRLQKEVKKVPVSDEVIDYIVTLVAAL  250 (329)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             23446654287999987665248876199999999999830


No 353
>pfam10443 RNA12 RNA12 protein. This family includes RNA12 from S. cerevisiae. That protein contains an RRM domain. This region is C-terminal to that and includes a P-loop motif suggesting this region binds to NTP. The RNA12 proteins is involved in pre-rRNA maturation.
Probab=92.69  E-value=0.58  Score=25.61  Aligned_cols=54  Identities=17%  Similarity=0.212  Sum_probs=31.2

Q ss_pred             HHHHHHHHH-CCCEEEEEEECCCCCCHHH-HHHHHHHHHHCCCCCHHHCCC-CCCCE
Q ss_conf             999999997-4986232200000100789-999999999879757021688-62321
Q gi|254780606|r  686 AKAVDLVID-NQRCSTSFIQRRLQIGYNR-AALLVERMEQEGLVSEADHVG-KRHVF  739 (744)
Q Consensus       686 ~~~~~~~~~-~~~~s~s~~qr~~~~g~~r-a~~~~~~~e~~g~~~~~~~~~-~r~~~  739 (744)
                      +||..+|.. .+..|++|-+=-|+-=|.- .-..+..||+.++|+=....| |..|-
T Consensus       320 eQaW~lIk~La~~~~v~Y~~ll~~~lFk~~~E~~l~~LE~aeLIsv~~~~Grp~~I~  376 (428)
T pfam10443       320 EQAWELIKKLSKNGSIPYNELLLSPLFKGSGETALRALEQAELISVTRDNGRPSKIR  376 (428)
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCCC
T ss_conf             999999999713895319998843102698279999998679479982488356654


No 354
>KOG2655 consensus
Probab=92.67  E-value=0.088  Score=31.21  Aligned_cols=27  Identities=33%  Similarity=0.525  Sum_probs=23.9

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             469970787534479999999999856
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRL  440 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~  440 (744)
                      -+||+|..|.|||.|+|+|...-++.+
T Consensus        23 tlmvvG~sGlGKsTfiNsLf~~~l~~~   49 (366)
T KOG2655          23 TLMVVGESGLGKSTFINSLFLTDLSGN   49 (366)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             899855887638899988886532577


No 355
>PRK01172 ski2-like helicase; Provisional
Probab=92.50  E-value=0.56  Score=25.70  Aligned_cols=33  Identities=24%  Similarity=0.261  Sum_probs=18.0

Q ss_pred             HHHHHHHHHH----CCEEEEEEEECCCCCCCCHHHHH
Q ss_conf             9999999642----01358999851654444146788
Q gi|254780606|r  552 AIQRLAQMAR----AAGIHLIMATQRPSVDVITGTIK  584 (744)
Q Consensus       552 ~~~~la~~~r----a~GihlilatQrp~~~vi~~~ik  584 (744)
                      ..+-.+|-||    ..|.-+|+|.+.-..+.+...+.
T Consensus       353 ~~QM~GRAGR~g~D~~G~~ii~~~~~~~~~~~~~~l~  389 (674)
T PRK01172        353 IKQMIGRAGRPGYDQYGIGYIYAASPASYDAAKKYLS  389 (674)
T ss_pred             HHHHCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHC
T ss_conf             9986135899999988708999728228999999852


No 356
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]
Probab=92.48  E-value=0.82  Score=24.57  Aligned_cols=34  Identities=32%  Similarity=0.571  Sum_probs=24.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             46997078753447999999999985680110799972
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
                      -+.|-|--|||||+..+.++.|+.    -|++-.++||
T Consensus        53 ~~~vtGevGsGKTv~~Ral~~s~~----~d~~~~v~i~   86 (269)
T COG3267          53 ILAVTGEVGSGKTVLRRALLASLN----EDQVAVVVID   86 (269)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCC----CCCEEEEEEC
T ss_conf             599974477763699999998557----8851799835


No 357
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=92.41  E-value=0.18  Score=29.06  Aligned_cols=37  Identities=32%  Similarity=0.584  Sum_probs=30.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             699707875344799999999998568011079997234
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      +=|.|..|+|||.|++.++..|.-+  -..+-++-+||-
T Consensus         2 iGitG~pGaGKStLi~~l~~~~~~~--g~~VaVlavDPs   38 (148)
T cd03114           2 IGITGVPGAGKSTLIDALITALRAR--GKRVAVLAIDPS   38 (148)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHC--CCEEEEEEECCC
T ss_conf             7625899787899999999999978--983799996888


No 358
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=92.37  E-value=0.84  Score=24.48  Aligned_cols=40  Identities=23%  Similarity=0.372  Sum_probs=23.0

Q ss_pred             CEEEEECCCCCHHHH-HHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             469970787534479-9999999998568011079997234
Q gi|254780606|r  414 HILVAGTTGSGKSVA-INTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       414 H~lvaG~TgsGKS~~-l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      ++++..-||||||.+ +-.++-.+......+..+.+++=|-
T Consensus        38 dvi~~a~TGSGKTlay~lpil~~l~~~~~~~~~~alil~PT   78 (203)
T cd00268          38 DVIGQAQTGSGKTAAFLIPILEKLDPSPKKDGPQALILAPT   78 (203)
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECC
T ss_conf             88997579972228888699999861667689669999687


No 359
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=92.35  E-value=0.12  Score=30.20  Aligned_cols=52  Identities=23%  Similarity=0.272  Sum_probs=31.2

Q ss_pred             CCCCEEECC----HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             788732112----011484699707875344799999999998568011079997234
Q gi|254780606|r  400 ISGESVIAD----LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       400 ~~g~~~~~d----l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      -++++++-|    +.+.=++.|.|.+|||||++++. |++|+ ...--++.+--.|.+
T Consensus        14 ~~~~~vL~~isl~i~~Ge~v~ivG~sGsGKSTLl~l-l~gl~-~p~~G~I~i~g~~i~   69 (221)
T cd03244          14 PNLPPVLKNISFSIKPGEKVGIVGRTGSGKSSLLLA-LFRLV-ELSSGSILIDGVDIS   69 (221)
T ss_pred             CCCCCCEEEEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC-CCCCCEEEECCEECC
T ss_conf             999751754489986998999999999989999999-96797-189848999999966


No 360
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=92.33  E-value=0.12  Score=30.24  Aligned_cols=36  Identities=22%  Similarity=0.439  Sum_probs=26.7

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             887321120----1148469970787534479999999999
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      .|.++.-|+    .+.=.+.|.|.+|||||++|+. |++++
T Consensus        12 ~~~~vL~~inl~i~~Ge~~~IvG~sGsGKSTLl~~-l~g~~   51 (218)
T cd03290          12 SGLATLSNINIRIPTGQLTMIVGQVGCGKSSLLLA-ILGEM   51 (218)
T ss_pred             CCCEEEECEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC
T ss_conf             99905647699986999999999999809999999-85556


No 361
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=92.32  E-value=0.12  Score=30.40  Aligned_cols=31  Identities=23%  Similarity=0.405  Sum_probs=23.6

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             11201148469970787534479999999999
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      -+++.+.-.+.|-|.+|||||++++.|+ +++
T Consensus        25 sl~i~~Ge~~~IvG~sGsGKSTLl~~i~-G~~   55 (204)
T cd03250          25 NLEVPKGELVAIVGPVGSGKSSLLSALL-GEL   55 (204)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHC-CCC
T ss_conf             8997699899999999985899999981-895


No 362
>PRK11784 tRNA 2-selenouridine synthase; Provisional
Probab=92.31  E-value=0.08  Score=31.48  Aligned_cols=21  Identities=33%  Similarity=0.705  Sum_probs=18.0

Q ss_pred             CCEEEEECCCCCHHHHHHHHH
Q ss_conf             846997078753447999999
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMI  433 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i  433 (744)
                      +-++++|.||+|||.+|+.+-
T Consensus       138 ~~~vl~G~TG~GKT~lL~~L~  158 (333)
T PRK11784        138 PLVVLGGMTGSGKTRLLQALA  158 (333)
T ss_pred             CCEEEECCCCCCHHHHHHHHH
T ss_conf             859986788877899999999


No 363
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]
Probab=92.30  E-value=0.1  Score=30.70  Aligned_cols=27  Identities=37%  Similarity=0.511  Sum_probs=23.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             469970787534479999999999856
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRL  440 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~  440 (744)
                      -+|++|..|+|||+|+|+++-..+...
T Consensus        25 ~im~~G~sG~GKttfiNtL~~~~l~~~   51 (373)
T COG5019          25 TIMVVGESGLGKTTFINTLFGTSLVDE   51 (373)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             899962788755578876567652577


No 364
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents the ATP-binding subunit DevA, found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The ABC transporter encoded by the devBCA operon is induced by nitrogen deficiency and is necessary for the formation of the laminated layer which envelops heterocysts , . It is thought to be involved in the export of either the heterocyst-specific glycolipids found in the laminated layer, or an enzyme essential for their formation..
Probab=92.29  E-value=0.86  Score=24.42  Aligned_cols=168  Identities=20%  Similarity=0.312  Sum_probs=99.0

Q ss_pred             CEEEEEEECCCCCEEECCHH----HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC--------
Q ss_conf             36898420578873211201----148469970787534479999999999856801107999723421000--------
Q gi|254780606|r  391 NLALCLGKTISGESVIADLA----NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS--------  458 (744)
Q Consensus       391 ~l~~~~g~~~~g~~~~~dl~----~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~--------  458 (744)
                      .|.=..|.+..-+=|.+|+.    ..==++..|..|||||++|. +|-+| .....-.|+++--+.++..-.        
T Consensus         6 ~LnHyyG~G~~rkQvL~di~L~i~~GEiViltGPSGSGKTTLLt-LiG~L-R~~Q~G~L~vlg~~L~ga~~~~l~~~RR~   83 (220)
T TIGR02982         6 NLNHYYGEGSLRKQVLFDINLEINPGEIVILTGPSGSGKTTLLT-LIGGL-RSVQEGSLKVLGQELKGASKKELVQVRRN   83 (220)
T ss_pred             CCCCEECCCCCCCEEECCCCEEECCCEEEEEECCCCCCHHHHHH-HHHHH-CCCCCCEEEEECCHHCCCCHHHHHHHHHH
T ss_conf             34411146874210012763177176479843788984688999-88762-56555604782201026788899999876


Q ss_pred             ---CCCCCCCEEEEEEE---CHHHHHHHHHHH-HHHHH-HHHHHHHHCCCCCHHHHH---------HHHHHHHCCCCCCC
Q ss_conf             ---12577520000444---417876899999-98667-699999980778679999---------98864202677666
Q gi|254780606|r  459 ---VYDGIPHLLTPVVT---NPKKAVMALKWA-VREME-ERYRKMSHLSVRNIKSYN---------ERISTMYGEKPQGC  521 (744)
Q Consensus       459 ---~~~~~ph~~~~v~~---~~~~~~~~l~~~-~~em~-~r~~~~~~~~~~~i~~~n---------~~~~~~~~~~~~~~  521 (744)
                         +|.. -.|+. ..|   |...+......+ ..++. +-.+++...|..+--.|.         +|++..+.=     
T Consensus        84 iGyIFQ~-HNLl~-~LTA~QNVqM~~eL~~~~~~~~~~~~a~~~L~~VGL~~~~~y~P~~LSGGQKQRVAIARAL-----  156 (220)
T TIGR02982        84 IGYIFQA-HNLLG-FLTARQNVQMALELQPNLSAQEAREKARAMLEAVGLGDRLDYYPENLSGGQKQRVAIARAL-----  156 (220)
T ss_pred             CCCEECC-CHHCH-HHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCHHHHHHHCCCCCCCCCHHHHHHHHHH-----
T ss_conf             3914412-00010-0017788864898876116889999999999860601255405243678616899999997-----


Q ss_pred             CCCCCCCCEEEEEHHH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             5432338679998445-68767531035899999999964201358999851654
Q gi|254780606|r  522 GDDMRPMPYIVIIVDE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       522 ~~~~~~~p~ivvviDE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                          -.-|.||.. || -|.|=...+++|-+.+.+|   ||--|.=+++-|--+.
T Consensus       157 ----v~~P~LvLA-DEPTAALD~~SGr~VV~Lm~~l---A~eqGc~iL~VTHD~R  203 (220)
T TIGR02982       157 ----VARPKLVLA-DEPTAALDSKSGRDVVELMQKL---AREQGCTILLVTHDNR  203 (220)
T ss_pred             ----HCCCCEEEC-CCCCHHHHHCCCHHHHHHHHHH---HHHHCCEEEEEECCCC
T ss_conf             ----338976762-5772332211338999999998---8771988999836731


No 365
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=92.29  E-value=0.5  Score=26.04  Aligned_cols=39  Identities=21%  Similarity=0.370  Sum_probs=26.6

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             1120114846997078753447999999999985680110799
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      -+++.+.-.+-+.|..|||||++++. |++++   .|+.=++.
T Consensus        20 sl~i~~Gei~~lvG~nGaGKSTl~~~-i~Gl~---~p~~G~i~   58 (163)
T cd03216          20 SLSVRRGEVHALLGENGAGKSTLMKI-LSGLY---KPDSGEIL   58 (163)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEE
T ss_conf             88987998999998899899999999-95776---89857899


No 366
>KOG0952 consensus
Probab=92.27  E-value=0.15  Score=29.72  Aligned_cols=56  Identities=18%  Similarity=0.284  Sum_probs=33.1

Q ss_pred             EEEEHHHHHHHHHHCCHHHHHHHHHHHHHH--HCCEEEEEEE-ECCCCCCCCHHHHHHC
Q ss_conf             999844568767531035899999999964--2013589998-5165444414678850
Q gi|254780606|r  531 IVIIVDEMADLMMVAGKEIEGAIQRLAQMA--RAAGIHLIMA-TQRPSVDVITGTIKAN  586 (744)
Q Consensus       531 ivvviDE~a~l~~~~~~~~e~~~~~la~~~--ra~Gihlila-tQrp~~~vi~~~ik~n  586 (744)
                      -+|||||..-|-..-|.-+|..++|.-++-  -..+|++|-- .-=|.-.-+-.-+|.|
T Consensus       240 ~LviIDEVHlLhd~RGpvlEtiVaRtlr~vessqs~IRivgLSATlPN~eDvA~fL~vn  298 (1230)
T KOG0952         240 RLVIIDEVHLLHDDRGPVLETIVARTLRLVESSQSMIRIVGLSATLPNYEDVARFLRVN  298 (1230)
T ss_pred             EEEEEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHEEEEEEECCCCCHHHHHHHHCCC
T ss_conf             04885300121576640699999999999885420057888624578779999986678


No 367
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]
Probab=92.24  E-value=0.57  Score=25.67  Aligned_cols=153  Identities=20%  Similarity=0.300  Sum_probs=65.2

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHC-----CHHHEEEEEEC--CCC--CEEC---CCCCCC
Q ss_conf             887321120----1148469970787534479999999999856-----80110799972--342--1000---125775
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRL-----RPDECRMIMVD--PKM--LELS---VYDGIP  464 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~-----~p~~~~~~liD--~k~--~~~~---~~~~~p  464 (744)
                      +|...+-++    ...-|+||-|..|+|||.++++| .+|=-..     .|.+.+++.+=  |+.  +.|.   .|-+..
T Consensus       404 ~~~~ll~~l~~~v~~G~~llI~G~SG~GKTsLlRai-aGLWP~g~G~I~~P~~~~~lflpQ~PY~p~GtLre~l~YP~~~  482 (604)
T COG4178         404 DGQTLLSELNFEVRPGERLLITGESGAGKTSLLRAL-AGLWPWGSGRISMPADSALLFLPQRPYLPQGTLREALCYPNAA  482 (604)
T ss_pred             CCCEEECCCEEEECCCCEEEEECCCCCCHHHHHHHH-HCCCCCCCCCEECCCCCCEEEECCCCCCCCCCHHHHHHCCCCC
T ss_conf             987421465265479987998789998788999999-6458567874416898755771488777876589998089997


Q ss_pred             CEEEEEEECHHHHHHHHHH-----HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH
Q ss_conf             2000044441787689999-----99866769999998077867999998864202677666543233867999844568
Q gi|254780606|r  465 HLLTPVVTNPKKAVMALKW-----AVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA  539 (744)
Q Consensus       465 h~~~~v~~~~~~~~~~l~~-----~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a  539 (744)
                      |   . +. .++...+|..     ++..|++--+.-....    .+-.+|++..+.-..         -| -+||+||--
T Consensus       483 ~---~-~~-d~~l~~vL~~vgL~~L~~rl~~~~~W~~vLS----~GEqQRlafARilL~---------kP-~~v~LDEAT  543 (604)
T COG4178         483 P---D-FS-DAELVAVLHKVGLGDLAERLDEEDRWDRVLS----GGEQQRLAFARLLLH---------KP-KWVFLDEAT  543 (604)
T ss_pred             C---C-CC-HHHHHHHHHHCCCHHHHHHHHCCCCHHHHCC----HHHHHHHHHHHHHHC---------CC-CEEEEECCH
T ss_conf             7---7-99-5999999998191989998733275766458----527899999999970---------99-989980601


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHC--CEEEEEEEECCCCCCCC
Q ss_conf             76753103589999999996420--13589998516544441
Q gi|254780606|r  540 DLMMVAGKEIEGAIQRLAQMARA--AGIHLIMATQRPSVDVI  579 (744)
Q Consensus       540 ~l~~~~~~~~e~~~~~la~~~ra--~GihlilatQrp~~~vi  579 (744)
                      .-+.   .+.|.   ++-|+-+.  -++-+|--.+|++...+
T Consensus       544 sALD---e~~e~---~l~q~l~~~lp~~tvISV~Hr~tl~~~  579 (604)
T COG4178         544 SALD---EETED---RLYQLLKEELPDATVISVGHRPTLWNF  579 (604)
T ss_pred             HCCC---HHHHH---HHHHHHHHHCCCCEEEEECCCHHHHHH
T ss_conf             1259---57899---999999854899789995560005788


No 368
>PRK09435 arginine/ornithine transport system ATPase; Provisional
Probab=92.12  E-value=0.22  Score=28.53  Aligned_cols=37  Identities=32%  Similarity=0.520  Sum_probs=31.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             699707875344799999999998568011079997234
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      +-|.|..|+|||.|+..++..|.  ..-..|-++-|||.
T Consensus        52 iGiTG~pG~GKStli~~l~~~~~--~~g~~v~vlavDPs   88 (325)
T PRK09435         52 IGITGVPGVGKSTFIEALGMHLI--EQGHKVAVLAVDPS   88 (325)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHH--HCCCEEEEEEECCC
T ss_conf             97427999868899999999999--67985899997899


No 369
>pfam00580 UvrD-helicase UvrD/REP helicase. The Rep family helicases are composed of four structural domains. The Rep family function as dimers. REP helicases catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. Bacillus subtilis addA and Escherichia coli exodeoxyribonuclease V beta have large insertions near to the carboxy-terminus relative to other members of the family.
Probab=92.10  E-value=0.66  Score=25.23  Aligned_cols=14  Identities=36%  Similarity=0.491  Sum_probs=10.0

Q ss_pred             EEEEEHHHHHHHHH
Q ss_conf             79998445687675
Q gi|254780606|r  530 YIVIIVDEMADLMM  543 (744)
Q Consensus       530 ~ivvviDE~a~l~~  543 (744)
                      |-.|+||||.|.-.
T Consensus       213 ~~~ilVDEfQDtn~  226 (494)
T pfam00580       213 FKYILVDEFQDTNP  226 (494)
T ss_pred             CCEEECHHHCCCHH
T ss_conf             72654034302649


No 370
>PRK07429 phosphoribulokinase; Provisional
Probab=92.08  E-value=0.17  Score=29.20  Aligned_cols=213  Identities=20%  Similarity=0.262  Sum_probs=94.9

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC-CCCEE--CCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999856801107999723-42100--0125775200004444178768999999866769
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP-KMLEL--SVYDGIPHLLTPVVTNPKKAVMALKWAVREMEER  491 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~-k~~~~--~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r  491 (744)
                      +-|||.+|||||.+.+.|+--    ...+.+-++-.|- -..+.  ....++-|+ .|-..|.+           .|..-
T Consensus        11 IGIAGgSGSGKTTv~r~I~~~----fg~~~VtvI~~DdYhk~dr~~r~~~~~t~l-hP~And~d-----------Ll~e~   74 (331)
T PRK07429         11 IGVAGDSGCGKSTFLRRLADL----FGEELVTVICLDDYHSLDRKQRKEIGITAL-DPRANNFD-----------LMYEQ   74 (331)
T ss_pred             EEEECCCCCCHHHHHHHHHHH----HCCCCEEEEECCCCCCCCHHHHHHCCCCCC-CCCHHCHH-----------HHHHH
T ss_conf             998578877899999999998----388877999478677788788987189878-96400599-----------99999


Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHH--------HHHHHHH-----HCCHH----------
Q ss_conf             999998077867999998864202677666543233867999844--------5687675-----31035----------
Q gi|254780606|r  492 YRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVD--------EMADLMM-----VAGKE----------  548 (744)
Q Consensus       492 ~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviD--------E~a~l~~-----~~~~~----------  548 (744)
                      ...+.....-++--||..-.    .+.  ....+.  |.=||||+        ++.++|.     +...+          
T Consensus        75 L~~Lk~Gk~I~~PvYdh~tg----~~~--~~~~I~--P~~vIIvEGLh~L~~~~lR~l~DlKIFVD~d~diR~~rRI~RD  146 (331)
T PRK07429         75 LKALKTGQPILKPIYNHETG----KID--PPEYIK--PNKIVVVEGLHPLYDERVRDLYDFKVYLDPPDEVKIAWKIKRD  146 (331)
T ss_pred             HHHHHCCCCCCCCCCCCCCC----CCC--CCEEEC--CCCEEEEECCHHCCCHHHHHHCCEEEEECCCHHHHHHHHHHHH
T ss_conf             99998599725652356478----778--866606--8867999161212879899754937996487889999988877


Q ss_pred             -------HHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHH----------HCCCCEEEEECCC-HHHCCHHCCCCCH
Q ss_conf             -------899999999964201358999851654444146788----------5056305720368-1110032676316
Q gi|254780606|r  549 -------IEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIK----------ANFPIRISFQVTS-KIDSRTILGEHGA  610 (744)
Q Consensus       549 -------~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik----------~n~~~ri~~~v~~-~~dsr~il~~~ga  610 (744)
                             .|..+..|-+  |.--..--+..|+--+|+|=..+-          -.+..|+-+|-.- .-|.--++|++.-
T Consensus       147 v~ERG~s~E~Vl~qi~~--RkpD~~~yI~PQk~~ADiVI~~~p~~~~~~~~~~~~l~vrli~~~~~~~~~~~~~~d~~s~  224 (331)
T PRK07429        147 MAERGHTYEDVLAEIEK--REPDFEAYIDPQRQYADVVIQVLPTQLIDNDKENKVLRVRLVQRPGIPHPDPVYLFDEGST  224 (331)
T ss_pred             HHHHCCCHHHHHHHHHH--CCHHHHHHCCCCHHCCCEEEEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCEEECCCCC
T ss_conf             86618999999999985--1178997668041127289996276678888888558899995079889983244057763


Q ss_pred             -----HHHCC--CCCEEEE-CC--CCC---EEEEEECCCCHHHHHHHHHHHHHCCCC
Q ss_conf             -----88568--9846864-68--984---389993438988999999999840887
Q gi|254780606|r  611 -----EQLLG--RGDMLYM-SG--GGR---IQRVHGPLVSDIEIEKVVQHLKKQGCP  654 (744)
Q Consensus       611 -----e~l~g--~gd~l~~-~~--~~~---~~r~~~~~~~~~~~~~~~~~~~~~~~~  654 (744)
                           .+|..  .|-++++ +.  -|+   .+-+-|-|- .+|+..|-.++..-+.-
T Consensus       225 i~w~p~~l~~~~pg~~~~~~~d~~~g~~v~vle~Dg~~~-~~~~~~~E~~l~~~~~k  280 (331)
T PRK07429        225 IDWRPRKLTCSYPGIALRYGPDRYMGKPVSVLEVDGQFD-NEEVIYLEDHLSNTSTK  280 (331)
T ss_pred             CCCCCCCCCCCCCCCEEEECCHHHCCCEEEEEEECCCCC-HHHHHHHHHHHHCCCCC
T ss_conf             124543357899774689646244596404998558769-89999999997535772


No 371
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR); InterPro: IPR005291   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    These proteins are integral membrane proteins and they are involved in the transport of chloride ions. Many of these proteins are the cystis fibrosis transmembrane conductor regulators (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se.; GO: 0005254 chloride channel activity, 0006811 ion transport, 0016020 membrane.
Probab=92.07  E-value=0.1  Score=30.78  Aligned_cols=110  Identities=20%  Similarity=0.234  Sum_probs=58.3

Q ss_pred             CCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCC--CC-----CEEE
Q ss_conf             7887321120----11484699707875344799999999998568011079997234210001257--75-----2000
Q gi|254780606|r  400 ISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDG--IP-----HLLT  468 (744)
Q Consensus       400 ~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~--~p-----h~~~  468 (744)
                      ..+.||.-|+    -|.--+-|||.||||||.+|. ||++=|   -|.+=|+-  --.+..|+.=-.  .|     ..+.
T Consensus       436 L~vTPVLK~I~~~lEkG~lLAvAGSTGsGKsSLLM-MI~GEL---~PSeGKIk--HSGRISfs~Q~sWIMPGTIkdNI~F  509 (1534)
T TIGR01271       436 LYVTPVLKNISFKLEKGQLLAVAGSTGSGKSSLLM-MILGEL---EPSEGKIK--HSGRISFSPQVSWIMPGTIKDNIIF  509 (1534)
T ss_pred             HHCCCEEEECCEEEECCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCCEEE--EEEEEEECCCCCCCCCCCCHHCEEE
T ss_conf             41164334010143044157874367750789999-986034---37997163--1004752578885578740001455


Q ss_pred             EEEECHHHHHHHHHHHHHHHHH------HHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             0444417876899999986676------9999998077867999998864202
Q gi|254780606|r  469 PVVTNPKKAVMALKWAVREMEE------RYRKMSHLSVRNIKSYNERISTMYG  515 (744)
Q Consensus       469 ~v~~~~~~~~~~l~~~~~em~~------r~~~~~~~~~~~i~~~n~~~~~~~~  515 (744)
                      .+-.|.-....+.+.|.-|-+-      =...+.+.|+.-=.+=++|+.-.+.
T Consensus       510 GlsYDEyRY~SVi~ACQLEED~~~~p~KD~~~L~eGGiTLSGGQRARIsLARA  562 (1534)
T TIGR01271       510 GLSYDEYRYTSVIKACQLEEDIALFPEKDKTVLGEGGITLSGGQRARISLARA  562 (1534)
T ss_pred             CCCCCHHHHHHHHHHHCHHHHHHHCCCCCCEEECCCCEECCCCHHHHHHHHHH
T ss_conf             13221024455654522035676354447602147776424740578888887


No 372
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=92.06  E-value=0.78  Score=24.72  Aligned_cols=33  Identities=21%  Similarity=0.310  Sum_probs=22.8

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             3211201148469970787534479999999999
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      .+-+++.+.=-+-|.|..|||||.+++. |++|+
T Consensus       266 ~vsf~v~~GEivgl~G~nGsGKsTL~~~-l~Gl~  298 (491)
T PRK10982        266 DVSFDLHKGEILGIAGLVGAKRTDIVET-LFGIR  298 (491)
T ss_pred             EEEEEEECCCEEEEECCCCCCHHHHHHH-HHCCC
T ss_conf             2679996896899778999978899999-81986


No 373
>pfam03205 MobB Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop.
Probab=92.06  E-value=0.34  Score=27.21  Aligned_cols=46  Identities=26%  Similarity=0.270  Sum_probs=31.0

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC
Q ss_conf             84699707875344799999999998568011079997234210001
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV  459 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~  459 (744)
                      |-++|.|..+||||.+++.++-.++-+. -.-+-+.=.|+...+|+.
T Consensus         1 p~v~i~G~~~sGKttl~~~L~~~~~~~g-~~~~~~~~~d~gq~~~~~   46 (122)
T pfam03205         1 PIVLVVGPKDSGKTTLIRKLLNYLKRRG-YRVAVVKHLDHGQGEIDK   46 (122)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCC
T ss_conf             9799994899989999999999999879-944899989999877689


No 374
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=92.05  E-value=0.18  Score=29.10  Aligned_cols=33  Identities=33%  Similarity=0.464  Sum_probs=24.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             6997078753447999999999985680110799972
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
                      +-|||.+|||||.+.+++.-- +   ..+.+.++-.|
T Consensus         2 IgVaG~SGSGKTTv~~~i~~i-f---g~~~v~vI~~D   34 (273)
T cd02026           2 IGVAGDSGCGKSTFLRRLTSL-F---GSDLVTVICLD   34 (273)
T ss_pred             EEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECC
T ss_conf             899788878699999999998-5---84876999657


No 375
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=92.04  E-value=0.23  Score=28.32  Aligned_cols=38  Identities=32%  Similarity=0.521  Sum_probs=31.4

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             4699707875344799999999998568011079997234
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      -+=|.|..|+|||.|++.++..|+-  .-..|-++-|||.
T Consensus        31 ~iGiTG~PGaGKStli~~l~~~~~~--~g~~vaVlAvDPS   68 (267)
T pfam03308        31 RVGITGVPGAGKSTLIEALGMELRR--RGHRVAVLAVDPS   68 (267)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHH--CCCEEEEEEECCC
T ss_conf             9987689988799999999999996--8986899997899


No 376
>TIGR01631 Trypano_RHS trypanosome RHS family; InterPro: IPR006518   These sequences are full-length and part-length members of the RHS (retrotransposon hot spot) family in Trypanosoma brucei and Trypanosoma cruzi. Members of this family are frequently interrupted by non-LTR retrotransposons inserted at exactly the same relative position. .
Probab=92.02  E-value=0.72  Score=24.94  Aligned_cols=76  Identities=16%  Similarity=0.111  Sum_probs=58.8

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEE--ECHHHHHHHHHHHHH
Q ss_conf             1484699707875344799999999998568011079997234210001257752000044--441787689999998
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVV--TNPKKAVMALKWAVR  486 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~--~~~~~~~~~l~~~~~  486 (744)
                      ...-.++-||-|=|||..+-|.|+--|++|.-+.|+++.-=-++-.+-++...+...+.|.  .+.+.+..++..++.
T Consensus       306 ~~~~~vliGTPGIGKS~~vGSfLLy~LLHyd~e~L~~vAYF~~g~AY~F~k~~~G~~G~V~~Y~~~~~a~~~v~~l~~  383 (814)
T TIGR01631       306 IPERRVLIGTPGIGKSFGVGSFLLYKLLHYDAEKLQVVAYFVKGRAYIFEKSSGGREGRVKFYEKEKAALDVVEALVS  383 (814)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHHCHHCCCCEEEEEECCEEEEEECCCCCCCEEEEEECCCCHHHHHHHHHHC
T ss_conf             787728881788525566899997554211000375589997467999971788963057762444036777553550


No 377
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]
Probab=91.99  E-value=0.17  Score=29.20  Aligned_cols=29  Identities=38%  Similarity=0.471  Sum_probs=23.8

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             84699707875344799999999998568
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMIMSLLYRLR  441 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i~sl~~~~~  441 (744)
                      --..|.|-.|||||.+||.++.-.+.++-
T Consensus       628 ~~t~VTGVSGSGKSTLIn~tL~~a~~~~l  656 (935)
T COG0178         628 VFTCVTGVSGSGKSTLINDTLVPALARHL  656 (935)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             37999836878777869999999999986


No 378
>PHA00350 putative assembly protein
Probab=91.99  E-value=0.11  Score=30.45  Aligned_cols=55  Identities=16%  Similarity=0.093  Sum_probs=36.2

Q ss_pred             EEEHHHHHHHHHHCCH-------------------HHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCC
Q ss_conf             9984456876753103-------------------58999999999642013589998516544441467885056
Q gi|254780606|r  532 VIIVDEMADLMMVAGK-------------------EIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFP  588 (744)
Q Consensus       532 vvviDE~a~l~~~~~~-------------------~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~  588 (744)
                      ++||||..++.-....                   +-...+...=.+-|-.|.-+||.||...  -|...||+-.-
T Consensus        84 liviDE~q~~~~~~~~~~~~~~~~~p~~~~~~~~~~~p~~~~~~~~~HRh~~wDI~L~Tp~~~--~i~~~ir~~~e  157 (402)
T PHA00350         84 LYVIDEAQMIFPKRLGFKMANIFKRPFTDFEPHLPEGPENFLEAFMRHRHYNWDIILLTPNIR--KIHSDIRAMIE  157 (402)
T ss_pred             EEEEECHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCHH--HHHHHHHHHHH
T ss_conf             899963133246543300233212666420002678845699999973215866799678878--98599999998


No 379
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional
Probab=91.96  E-value=0.88  Score=24.34  Aligned_cols=154  Identities=14%  Similarity=0.240  Sum_probs=67.5

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHH
Q ss_conf             21120114846997078753447999999999985680110799972342100012577520000444417876899999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWA  484 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~  484 (744)
                      |-+++.+.--+-|-|.-|||||++|+ +|.+++   .|+.=++. ++-+..-+....++-+-++ -..+..-...++..-
T Consensus        43 VSFeV~kGE~vGIIG~NGAGKSTLLK-iIaGI~---~PTsG~V~-V~Gk~sLL~lgaGf~~eLT-GrENI~L~g~~lGls  116 (549)
T PRK13545         43 ISFEVPEGEIVGIVGLNGSGKSTLSN-LIAGVT---MPNKGTVD-IKGSAALIAISSGLNGQLT-GIENIELKGLMMGIT  116 (549)
T ss_pred             CEEEECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCCEEEE-ECCEEEEEEECCCCCCCCC-HHHHHHHHHHHHCCC
T ss_conf             25786489899998899998999999-996898---89860899-9468987740557697762-999999889984989


Q ss_pred             HHHHHHHHHHH---HHCC---CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             98667699999---9807---78679999988642026776665432338679998445687675310358999999999
Q gi|254780606|r  485 VREMEERYRKM---SHLS---VRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQ  558 (744)
Q Consensus       485 ~~em~~r~~~~---~~~~---~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~  558 (744)
                      ..++++++...   ++.|   -+-+..|-.... .+..+......    -|-| ++|||.  |......+.+.++.|+..
T Consensus       117 k~eI~~~~deIiEFAELGdFid~PVKtYSSGMk-aRLgFAIA~~~----dPDI-LIIDEa--LSVGD~~F~~Kc~~rm~e  188 (549)
T PRK13545        117 KEKIKEIIPEIIDFADIGKFMYQPVKTYSSGMK-SRLGFAISVHI----NPDI-LVIDEA--LSVGDQTFTKKCLDKMNE  188 (549)
T ss_pred             HHHHHHHHHHHHHHHCHHHHHHCHHHHHCHHHH-HHHHHHHHHHC----CCCE-EEEECC--CCCCCHHHHHHHHHHHHH
T ss_conf             999999899999985678887382634088689-99999999824----9999-999462--005789999999999999


Q ss_pred             HHHCCEEEEEEEECC
Q ss_conf             642013589998516
Q gi|254780606|r  559 MARAAGIHLIMATQR  573 (744)
Q Consensus       559 ~~ra~GihlilatQr  573 (744)
                      + +.-|--+++.+.-
T Consensus       189 f-~e~gkTIvfVSHs  202 (549)
T PRK13545        189 F-KEQGKTIFFISHS  202 (549)
T ss_pred             H-HHCCCEEEEEECC
T ss_conf             9-9789889999588


No 380
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=91.94  E-value=0.12  Score=30.39  Aligned_cols=63  Identities=21%  Similarity=0.240  Sum_probs=38.0

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC-------CEECCCCCCCCEEEE
Q ss_conf             21120114846997078753447999999999985680110799972342-------100012577520000
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM-------LELSVYDGIPHLLTP  469 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~-------~~~~~~~~~ph~~~~  469 (744)
                      +-++++..-|+-|-|.||||||++++-+.-.  |.....++.+--++.+.       -.+++...-+|++..
T Consensus       357 ~~l~l~~GEkvAIlG~SGsGKSTllqLl~~~--~~~~~G~i~~~g~~~~~l~~~~~~e~i~vl~Qr~hlF~~  426 (573)
T COG4987         357 FNLTLAQGEKVAILGRSGSGKSTLLQLLAGA--WDPQQGSITLNGVEIASLDEQALRETISVLTQRVHLFSG  426 (573)
T ss_pred             CCEEECCCCEEEEECCCCCCHHHHHHHHHHC--CCCCCCEEEECCCCHHHCCHHHHHHHHHHHCCCHHHHHH
T ss_conf             6513258876888779998789999999723--587887365788673318836689987541232177777


No 381
>KOG0054 consensus
Probab=91.94  E-value=0.15  Score=29.72  Aligned_cols=30  Identities=23%  Similarity=0.421  Sum_probs=24.1

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             120114846997078753447999999999
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      ++..+.-.+.|.|.+|||||.+|.+|+-.|
T Consensus       542 ~~i~~G~lvaVvG~vGsGKSSLL~AiLGEm  571 (1381)
T KOG0054         542 FEIKKGQLVAVVGPVGSGKSSLLSAILGEM  571 (1381)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             896289889998999888899999996587


No 382
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=91.91  E-value=0.95  Score=24.12  Aligned_cols=32  Identities=13%  Similarity=0.170  Sum_probs=20.6

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             321120114846997078753447999999999
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      ++-+++.+.-=+-|.|..|||||++++. |++|
T Consensus       271 ~vsl~v~~GEivgivG~nGsGKSTL~k~-L~Gl  302 (501)
T PRK11288        271 PISFAVRRGEIVGFFGLVGAGRSELMKL-LYGA  302 (501)
T ss_pred             CEEEEEECCEEEEEECCCCCCHHHHHHH-HCCC
T ss_conf             6347870883999756888648799998-4387


No 383
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Escherichia coli YbbB protein was shown to encode a selenophosphate-dependent tRNA 2-selenouridine synthase, essential for modification of some tRNAs to replace a sulfur atom with selenium. This enzyme works with SelD, the selenium donor protein, which also acts in selenocysteine incorporation. Although the members of this protein family show a fairly deep split, sequences from both sides of the split are supported by co-occurence with, and often proximity to, the selD gene.
Probab=91.90  E-value=0.13  Score=30.08  Aligned_cols=24  Identities=33%  Similarity=0.645  Sum_probs=19.4

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             484699707875344799999999
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMS  435 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~s  435 (744)
                      .+-++++|.||+|||.+|+.+-.+
T Consensus       127 ~~~~vl~G~TG~GKT~iL~~L~~~  150 (311)
T TIGR03167       127 FPLIVLGGMTGSGKTELLHALANA  150 (311)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHC
T ss_conf             876998788887789999999976


No 384
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=91.89  E-value=0.14  Score=29.76  Aligned_cols=48  Identities=23%  Similarity=0.400  Sum_probs=30.3

Q ss_pred             EEECCCCCEEECC----HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             4205788732112----011484699707875344799999999998568011079
Q gi|254780606|r  396 LGKTISGESVIAD----LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       396 ~g~~~~g~~~~~d----l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      ....-..++++-|    +.+.-.+.|-|.+|||||++++. |++++   .|+.=++
T Consensus         8 f~Y~~~~~~~L~~i~l~i~~Ge~~aivG~sGsGKSTLl~~-l~G~~---~p~~G~i   59 (178)
T cd03247           8 FSYPEQEQQVLKNLSLELKQGEKIALLGRSGSGKSTLLQL-LTGDL---KPQQGEI   59 (178)
T ss_pred             EECCCCCCCCEECEEEEECCCCEEEEECCCCCHHHHHHHH-HHHCC---CCCCCEE
T ss_conf             9879999863325589986999999999998759999999-98617---6678869


No 385
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.89  E-value=0.15  Score=29.70  Aligned_cols=36  Identities=28%  Similarity=0.518  Sum_probs=25.7

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             887321120----1148469970787534479999999999
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      .+++++-|+    .+.-.+-|.|.+|||||++++. |++|+
T Consensus        14 ~~~~vL~~inl~i~~Ge~vaivG~sGsGKSTLl~l-l~gl~   53 (229)
T cd03254          14 EKKPVLKDINFSIKPGETVAIVGPTGAGKTTLINL-LMRFY   53 (229)
T ss_pred             CCCEEEECEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC
T ss_conf             89908746299987999999999999809999999-96686


No 386
>KOG0064 consensus
Probab=91.80  E-value=0.98  Score=24.04  Aligned_cols=150  Identities=22%  Similarity=0.305  Sum_probs=71.9

Q ss_pred             CCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHH-----CCHHHEEEEEECCCCCEECCCCCCCCEEEE
Q ss_conf             57887321120----114846997078753447999999999985-----680110799972342100012577520000
Q gi|254780606|r  399 TISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYR-----LRPDECRMIMVDPKMLELSVYDGIPHLLTP  469 (744)
Q Consensus       399 ~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~-----~~p~~~~~~liD~k~~~~~~~~~~ph~~~~  469 (744)
                      +-.|+.++-.|    ...-|+||-|--|-|||.+-+ |+.+|---     +.|...+++.|--+     +|-..--+...
T Consensus       491 tP~~~vvv~~Ltf~i~~G~hLLItGPNGCGKSSLfR-ILggLWPvy~g~L~~P~~~~mFYIPQR-----PYms~gtlRDQ  564 (728)
T KOG0064         491 TPAGDVLVPKLTFQIEPGMHLLITGPNGCGKSSLFR-ILGGLWPVYNGLLSIPRPNNIFYIPQR-----PYMSGGTLRDQ  564 (728)
T ss_pred             CCCCCEEECCEEEEECCCCEEEEECCCCCCHHHHHH-HHHCCCCCCCCEEECCCCCCEEECCCC-----CCCCCCCCCCE
T ss_conf             567546522215874588269987899765889999-986447232775634897636853688-----75676753121


Q ss_pred             EEE-C----HH-------HHHHHHHHHHHHHHHHHHHH-HHCCCCCHHHHH--------HHHHHHHCCCCCCCCCCCCCC
Q ss_conf             444-4----17-------87689999998667699999-980778679999--------988642026776665432338
Q gi|254780606|r  470 VVT-N----PK-------KAVMALKWAVREMEERYRKM-SHLSVRNIKSYN--------ERISTMYGEKPQGCGDDMRPM  528 (744)
Q Consensus       470 v~~-~----~~-------~~~~~l~~~~~em~~r~~~~-~~~~~~~i~~~n--------~~~~~~~~~~~~~~~~~~~~~  528 (744)
                      ||. |    .+       +....|+.+.     .+.+. .+.|+.-+.++.        +|+.-.+..+++         
T Consensus       565 IIYPdS~e~m~~kg~td~dL~~IL~~V~-----Lehi~qR~~g~dav~dWkDvLSgGeKQRm~mARmfYHr---------  630 (728)
T KOG0064         565 IIYPDSSEQMKRKGYTDQDLEAILDIVH-----LEHILQREGGWDAVRDWKDVLSGGEKQRMGMARMFYHR---------  630 (728)
T ss_pred             EECCCCHHHHHHCCCCHHHHHHHHHHHH-----HHHHHHHCCCHHHHHCHHHHCCHHHHHHHHHHHHHHCC---------
T ss_conf             3358869999866996788999999973-----99999741671354057877050388888899997428---------


Q ss_pred             CEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             67999844568767531035899999999964201358999851654
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      | ...+.||.-   ....-++|..|   =|.+.-+||.||--|+||+
T Consensus       631 P-kyalLDEcT---SAVSiDvE~~i---fq~aK~~gisllSIthRps  670 (728)
T KOG0064         631 P-KYALLDECT---SAVSIDVEGKI---FQAAKDAGISLLSITHRPS  670 (728)
T ss_pred             C-CHHHHHHHH---CCCCCCHHHHH---HHHHHHCCCEEEEEECCCC
T ss_conf             5-147777673---02661247899---9998745924998516851


No 387
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=91.77  E-value=0.088  Score=31.21  Aligned_cols=52  Identities=15%  Similarity=0.148  Sum_probs=31.6

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHH--EEEEEECCCCCEECCC
Q ss_conf             2112011484699707875344799999999998568011--0799972342100012
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDE--CRMIMVDPKMLELSVY  460 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~--~~~~liD~k~~~~~~~  460 (744)
                      +-+.+.+.-++.|-|.||||||++++- |+.   -+.|++  +.+--+|-+...+..+
T Consensus       342 isl~i~~Ge~vaiVG~SGsGKSTL~~L-L~r---~y~p~~G~I~idG~di~~~~~~~l  395 (547)
T PRK10522        342 INLTIKRGELLFLIGGNGSGKSTLAML-LTG---LYQPQSGEILLDGKPVTAEQPEDY  395 (547)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHH-HHC---CCCCCCCEEEECCEECCCCCHHHH
T ss_conf             047985998899989999977999999-828---966999869899999996899999


No 388
>PRK05917 DNA polymerase III subunit delta'; Validated
Probab=91.74  E-value=0.77  Score=24.74  Aligned_cols=35  Identities=20%  Similarity=0.253  Sum_probs=28.4

Q ss_pred             HHCCCE-EEEECCCCCHHHHHHHHHHHHHHHCCHHH
Q ss_conf             114846-99707875344799999999998568011
Q gi|254780606|r  410 ANMPHI-LVAGTTGSGKSVAINTMIMSLLYRLRPDE  444 (744)
Q Consensus       410 ~~~PH~-lvaG~TgsGKS~~l~~~i~sl~~~~~p~~  444 (744)
                      .++||. |+.|..|.||+.+-..+...|+....|+.
T Consensus        16 ~Rl~HAyLf~Gp~G~GK~~~A~~~A~~LLc~~~p~~   51 (290)
T PRK05917         16 QKVPSAILLHGQDLSNLSQYAYELASLILLESSPEA   51 (290)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCH
T ss_conf             996606876899986599999999999857899616


No 389
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=91.74  E-value=0.2  Score=28.75  Aligned_cols=47  Identities=17%  Similarity=0.190  Sum_probs=30.3

Q ss_pred             ECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEE
Q ss_conf             057887321120----1148469970787534479999999999856801107
Q gi|254780606|r  398 KTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECR  446 (744)
Q Consensus       398 ~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~  446 (744)
                      +...|+.++-|+    .+.=.+-|.|..|||||++++.| +++ ..+.|+.=.
T Consensus         9 ~~~~~~~vL~~isl~i~~Gei~~iiG~nGaGKSTLl~~i-~G~-~~~~~~~G~   59 (248)
T PRK09580          9 VSVEDKAILRGLNLEVRPGEVHAIMGPNGSGKSTLSATL-AGR-EDYEVTGGT   59 (248)
T ss_pred             EEECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHH-HCC-CCCCCCCCE
T ss_conf             998999999651889849979999999999999999998-377-556875235


No 390
>pfam03354 Terminase_1 Phage Terminase. The majority of the members of this family are bacteriophage proteins, several of which are thought to be terminase large subunit proteins. There are also a number of bacterial proteins of unknown function.
Probab=91.73  E-value=0.99  Score=23.99  Aligned_cols=140  Identities=17%  Similarity=0.123  Sum_probs=64.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999856801107999723421000125775200004444178768999999866769999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRK  494 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~  494 (744)
                      .+|-=+-|.|||.+.-.|.+-+++.           |..        .-+. +..+.++.+.|..+.+.+....+ +-..
T Consensus        25 ~~i~v~RkNGKS~l~a~i~ly~~~~-----------~ge--------~~~e-i~~~A~~~~QA~~~f~~~~~mi~-~~p~   83 (473)
T pfam03354        25 AYVSVGRKNGKSYLMAIRVLYELLL-----------GGK--------SNQE-ILVAATTFKQAEKLFKYVKNQVK-LSPF   83 (473)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHH-----------CCC--------CCCE-EEEEECCHHHHHHHHHHHHHHHH-CCHH
T ss_conf             9999826860269999999999970-----------998--------3874-99997989999999999999997-3987


Q ss_pred             HHHC-CCCCHHHHHHHHHHHH--CCCC--CCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             9980-7786799999886420--2677--666543233867999844568767531035899999999964201358999
Q gi|254780606|r  495 MSHL-SVRNIKSYNERISTMY--GEKP--QGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIM  569 (744)
Q Consensus       495 ~~~~-~~~~i~~~n~~~~~~~--~~~~--~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlil  569 (744)
                      +++. +......+...+....  ....  -.....+..+-..++|+||++..-   ..++-+.| +-++.+|.-.+.+++
T Consensus        84 l~~~~~~~~~~~~~~~i~~~~t~s~~~~ls~~~~~~dG~~~~~~i~DE~h~~~---~~~~~~~l-~sg~~~r~~~l~~~I  159 (473)
T pfam03354        84 LSIANENKLLKSQKDGIEMKINNNVFKALSNNGDQYDGGNPSLAIFDEMHEFK---DRELVSTI-VTGMRKQDNPQTIQI  159 (473)
T ss_pred             HHHHHHCCCCCCCCEEEEECCCCCEEEEEECCCCCCCCCCCCEEEEEECCCCC---CHHHHHHH-HHHHHCCCCCEEEEE
T ss_conf             77553011013100158980789689998578987669987289987223048---82789999-876316888719997


Q ss_pred             EECCCCCCCC
Q ss_conf             8516544441
Q gi|254780606|r  570 ATQRPSVDVI  579 (744)
Q Consensus       570 atQrp~~~vi  579 (744)
                      .|+-+..+.+
T Consensus       160 TTag~~~~~~  169 (473)
T pfam03354       160 TTAGPNRGGP  169 (473)
T ss_pred             CCCCCCCCCH
T ss_conf             6778898871


No 391
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.72  E-value=0.15  Score=29.56  Aligned_cols=208  Identities=14%  Similarity=0.162  Sum_probs=91.8

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE------E---------CCCCCCCCEEEE
Q ss_conf             2112011484699707875344799999999998568011079997234210------0---------012577520000
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE------L---------SVYDGIPHLLTP  469 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~------~---------~~~~~~ph~~~~  469 (744)
                      |-+++.+.=-+-|.|.+|||||+++++ |.+|+   .|+.=++.+-|.....      .         ..+..+-..++-
T Consensus        45 Is~~i~~Ge~vaIIG~nGsGKSTL~~~-l~Gll---~p~~G~I~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~lr~~vg~  120 (320)
T PRK13631         45 ISYTFEKNKIYFIIGNSGSGKSTLVTH-FNGLI---KSKYGTIQVGDIYIGDKKNNHELITNPYSKKIKNFKELRRRVSM  120 (320)
T ss_pred             CEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEEECCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCEEE
T ss_conf             455885998999994999849999999-97588---89983599865871454456310025026677789997534899


Q ss_pred             EEECH-------------HHHHHHHHHHHHHHHHHHH-HHHHCCCCC-H-HH--------HHHHHHHHHCCCCCCCCCCC
Q ss_conf             44441-------------7876899999986676999-999807786-7-99--------99988642026776665432
Q gi|254780606|r  470 VVTNP-------------KKAVMALKWAVREMEERYR-KMSHLSVRN-I-KS--------YNERISTMYGEKPQGCGDDM  525 (744)
Q Consensus       470 v~~~~-------------~~~~~~l~~~~~em~~r~~-~~~~~~~~~-i-~~--------~n~~~~~~~~~~~~~~~~~~  525 (744)
                      |.-++             ......+.+-..|+.+|.. .+...|... + +.        =.+|++-...         +
T Consensus       121 VfQ~P~~~lf~~tV~~di~fg~~~~g~~~~e~~~r~~~~L~~vgl~~~~~~r~p~~LSGGqkQRVaIA~a---------L  191 (320)
T PRK13631        121 VFQFPEYQLFKDTIEKDIMFGPVALGVKKSEAKKLAKFYLNKMGLDDSYLERSPFGLSGGQKRRVAIAGI---------L  191 (320)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHHHHHHHHHH---------H
T ss_conf             9607430316528999999889985999999999999999887997467437822099999999999999---------7


Q ss_pred             CCCCEEEEEHHHHHHHHH-HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHH
Q ss_conf             338679998445687675-3103589999999996420135899985165444414678850563057203681110032
Q gi|254780606|r  526 RPMPYIVIIVDEMADLMM-VAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTI  604 (744)
Q Consensus       526 ~~~p~ivvviDE~a~l~~-~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~i  604 (744)
                      .--|. +++.||=..-+. ....++-..|.+    -+.-|+-+|+.|...+  .+     +.+.-||.+--    +.+ |
T Consensus       192 a~~P~-iLilDEPTagLDp~~~~~i~~li~~----l~~~g~TiilvTHdm~--~v-----~~~aDrviVm~----~Gk-I  254 (320)
T PRK13631        192 AIQPE-ILIFDEPTAGLDPKGEHEMMQLILD----AKANNKTVFVITHTME--HV-----LEVADEVIVMD----KGK-I  254 (320)
T ss_pred             HCCCC-EEEECCCCCCCCHHHHHHHHHHHHH----HHHCCCEEEEECCCHH--HH-----HHHCCEEEEEE----CCE-E
T ss_conf             23999-9997587555998999999999999----9962999999947899--99-----99799999998----988-9


Q ss_pred             CCCCCHHHHCCCCCEEEECCCCCEEEEEECCCCHHHHHHHHHHHHHCCC
Q ss_conf             6763168856898468646898438999343898899999999984088
Q gi|254780606|r  605 LGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGC  653 (744)
Q Consensus       605 l~~~gae~l~g~gd~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~  653 (744)
                      +.++-.+.++..-++|...+=.           -..+-++...+++.|-
T Consensus       255 v~~Gtp~eiF~~~~~l~~~~l~-----------~P~~~~l~~~L~~~g~  292 (320)
T PRK13631        255 LKTGTPYEIFTDQHIINSTSIQ-----------VPRVIQVINDLIKKDP  292 (320)
T ss_pred             EEECCHHHHHCCHHHHHHCCCC-----------CCCHHHHHHHHHHCCC
T ss_conf             9975889986599999977999-----------9929999999997399


No 392
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family. In Arabidopsis the region carries two binding domains, a phosphoribosylpyrophosphate-binding domain and, at the very C-terminus, a uracil-binding domain.
Probab=91.67  E-value=0.17  Score=29.22  Aligned_cols=22  Identities=36%  Similarity=0.601  Sum_probs=18.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHH
Q ss_conf             6997078753447999999999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +.|+|.+|||||.+-+.|.-.|
T Consensus         2 IgIaG~SgSGKTT~a~~L~~~l   23 (196)
T pfam00485         2 IGVAGSSGAGKTTVARTFVSIF   23 (196)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
T ss_conf             8998998571999999999996


No 393
>TIGR01166 cbiO cobalt ABC transporter, ATP-binding protein; InterPro: IPR005876   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry represents the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. This superfamily includes two groups, one which catalyses the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drives both the process of uptake and efflux.; GO: 0006824 cobalt ion transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=91.65  E-value=0.36  Score=27.04  Aligned_cols=156  Identities=19%  Similarity=0.241  Sum_probs=83.4

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECC-------------CCCC-CCEEEEEE-
Q ss_conf             12011484699707875344799999999998568011079997234210001-------------2577-52000044-
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSV-------------YDGI-PHLLTPVV-  471 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~-------------~~~~-ph~~~~v~-  471 (744)
                      ++..+.+-+-+-|.=|||||+++.+ +-++|   .|.. =-+++|-+-+.++.             |++- -++|.+-| 
T Consensus        13 ~~~~~G~~~aLlG~NGaGKsTLl~~-LnG~L---rP~~-G~v~~dG~~l~YsrkgL~~~R~~V~~VfQdPDDQlF~a~V~   87 (190)
T TIGR01166        13 FAVERGEVLALLGANGAGKSTLLLH-LNGLL---RPQS-GKVLLDGEPLDYSRKGLLEVRQRVGLVFQDPDDQLFAADVD   87 (190)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHHH-HCCCC---CCCC-CEEEECCEECCCCCHHHHHHCCEEEEEEECHHHHCCCCCCC
T ss_conf             0220571689872899857899887-43677---7975-55876785403572446752503003762634420267622


Q ss_pred             ECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCC--CCCCEEEEEHHHHHHHHHHCCHHH
Q ss_conf             441787689999998667699999980778679999988642026776665432--338679998445687675310358
Q gi|254780606|r  472 TNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDM--RPMPYIVIIVDEMADLMMVAGKEI  549 (744)
Q Consensus       472 ~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~--~~~p~ivvviDE~a~l~~~~~~~~  549 (744)
                      .|....-..|.---.|.++|  .......=.+.+|.+|....-+...+....--  =.|--=|+|.||=..=+.   .+-
T Consensus        88 ~DVaFGPlNLGL~e~Ev~~R--V~eAL~~vg~~~~~~rp~h~LS~GekkRvAIAGAvAM~Pd~l~LDEPTAGLD---p~G  162 (190)
T TIGR01166        88 QDVAFGPLNLGLSEAEVERR--VREALTAVGISGLEERPTHLLSGGEKKRVAIAGAVAMRPDVLLLDEPTAGLD---PAG  162 (190)
T ss_pred             CCCCCCCCCCCCCHHHHHHH--HHHHHHHCCHHHHHHCCHHHCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCC---HHH
T ss_conf             10033545673371576787--8999986063224412241155861357777758861663466427888978---747


Q ss_pred             HHHHHHHHHHHHCCEEEEEEEEC
Q ss_conf             99999999964201358999851
Q gi|254780606|r  550 EGAIQRLAQMARAAGIHLIMATQ  572 (744)
Q Consensus       550 e~~~~~la~~~ra~GihlilatQ  572 (744)
                      ...|.+|-.+=|+.|.|+|++|-
T Consensus       163 ~~q~~~~l~~L~~~G~tvv~STH  185 (190)
T TIGR01166       163 AEQLLAILRRLRAEGTTVVISTH  185 (190)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             99999998878723998999725


No 394
>PRK07773 replicative DNA helicase; Validated
Probab=91.62  E-value=1  Score=23.91  Aligned_cols=29  Identities=31%  Similarity=0.194  Sum_probs=24.0

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             48469970787534479999999999856
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRL  440 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~  440 (744)
                      .--++|||.+|+|||.|..+|....+..+
T Consensus       203 ~~l~i~a~rp~~GKt~~~~~~a~~~a~~~  231 (868)
T PRK07773        203 GQMIIVAARPGVGKSTLGLDFARSCSIRH  231 (868)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             76799982897777789999999999865


No 395
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=91.62  E-value=0.15  Score=29.71  Aligned_cols=22  Identities=27%  Similarity=0.377  Sum_probs=17.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHH
Q ss_conf             6997078753447999999999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +-|+|.||||||.+-+.|...|
T Consensus         2 IgIaG~S~SGKTTla~~L~~~l   23 (187)
T cd02024           2 VGISGVTNSGKTTLAKLLQRIL   23 (187)
T ss_pred             EEEECCCCCCHHHHHHHHHHHC
T ss_conf             8996888875999999999987


No 396
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=91.62  E-value=0.21  Score=28.56  Aligned_cols=42  Identities=26%  Similarity=0.371  Sum_probs=30.4

Q ss_pred             EEECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             42057887321120----11484699707875344799999999998
Q gi|254780606|r  396 LGKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLY  438 (744)
Q Consensus       396 ~g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~  438 (744)
                      |.+..+|++++-|+    .+.=-+.|.|..|||||++++. |++|+.
T Consensus         6 ls~~~g~~~il~~vs~~i~~Ge~~~l~G~NGsGKSTLlk~-i~Gl~~   51 (201)
T cd03231           6 LTCERDGRALFSGLSFTLAAGEALQVTGPNGSGKTTLLRI-LAGLSP   51 (201)
T ss_pred             EEEEECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHH-HHCCCC
T ss_conf             9999999999953078887995999999999999999999-966778


No 397
>PRK01156 chromosome segregation protein; Provisional
Probab=91.58  E-value=0.17  Score=29.30  Aligned_cols=15  Identities=33%  Similarity=0.771  Sum_probs=4.8

Q ss_pred             EEECCCCCHHHHHHH
Q ss_conf             970787534479999
Q gi|254780606|r  417 VAGTTGSGKSVAINT  431 (744)
Q Consensus       417 vaG~TgsGKS~~l~~  431 (744)
                      |.|.||||||..+-+
T Consensus        28 I~G~NGaGKStIldA   42 (895)
T PRK01156         28 ITGKNGAGKSSIVDA   42 (895)
T ss_pred             EECCCCCCHHHHHHH
T ss_conf             889999987899999


No 398
>pfam10923 DUF2791 Protein of unknown function (DUF2791). This is a family of proteins found in archaea and bacteria. Some of the proteins in this family are annotated as being methyl-accepting chemotaxis proteins and ATP/GTP binding proteins.
Probab=91.56  E-value=0.49  Score=26.10  Aligned_cols=97  Identities=16%  Similarity=0.271  Sum_probs=59.4

Q ss_pred             EEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH-HHHHHHH-HHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHC-C
Q ss_conf             4444178768999999866769999998077867-9999988-64202677666543233867999844568767531-0
Q gi|254780606|r  470 VVTNPKKAVMALKWAVREMEERYRKMSHLSVRNI-KSYNERI-STMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVA-G  546 (744)
Q Consensus       470 v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i-~~~n~~~-~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~-~  546 (744)
                      .-.|...+..+|+|+..|-.-.....+.+|+|.| ++.|..- -..-..+....|     ..=++|++||+--|.... .
T Consensus        33 ~~gd~~~~~~al~WLrGe~~~kt~ar~~lGVr~iIdd~~~~d~Lk~l~~fv~~aG-----y~GLli~lDE~~nL~ki~~~  107 (267)
T pfam10923        33 AEGDEELKAAALRWLRGEPNTKTEAKRALGVRGIIDDDSAYDFLKLLATFVRDAG-----YAGLLVVLDEAVNLYKLRNS  107 (267)
T ss_pred             HCCCHHHHHHHHHHHCCCCCCHHHHHHHCCCCEEECCCCHHHHHHHHHHHHHHCC-----CCCEEEEHHHHHHHHHCCCH
T ss_conf             6476999999999984899606899998599856667109999999999999859-----88068741657898714324


Q ss_pred             HHHHHHHHHH------HHHHHCCEEEEEEEE
Q ss_conf             3589999999------996420135899985
Q gi|254780606|r  547 KEIEGAIQRL------AQMARAAGIHLIMAT  571 (744)
Q Consensus       547 ~~~e~~~~~l------a~~~ra~Gihlilat  571 (744)
                      +--+.....|      .-.||+-|+.++++-
T Consensus       108 ~~R~knye~il~i~nd~~qG~~~~L~~~~~G  138 (267)
T pfam10923       108 QARDKNYEALLQILNDILQGRAPGLGFVIGG  138 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             7788789999999989866988870588637


No 399
>pfam03266 DUF265 Protein of unknown function, DUF265.
Probab=91.56  E-value=1  Score=23.87  Aligned_cols=24  Identities=29%  Similarity=0.559  Sum_probs=21.2

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             469970787534479999999999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      |++|-|.-|+|||++++-++-.|-
T Consensus         1 ki~ITG~pGvGKTTli~kv~~~l~   24 (168)
T pfam03266         1 RIFITGPPGVGKTTLVKKVIELLK   24 (168)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             989978999889999999999998


No 400
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=91.54  E-value=0.32  Score=27.32  Aligned_cols=28  Identities=18%  Similarity=0.271  Sum_probs=22.5

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             4846997078753447999999999985
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYR  439 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~  439 (744)
                      -+-+++.|.+|+|||-+|+++--..+..
T Consensus       113 ~nplfi~G~~GlGKTHLl~Aign~~~~~  140 (408)
T COG0593         113 YNPLFIYGGVGLGKTHLLQAIGNEALAN  140 (408)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             8957998799997899999999999862


No 401
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=91.53  E-value=0.17  Score=29.22  Aligned_cols=44  Identities=25%  Similarity=0.410  Sum_probs=30.0

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             887321120----114846997078753447999999999985680110799
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      +|++++-|+    .+.-.+.|-|.+|||||++++. |++|+   .|+.=++.
T Consensus        12 ~~~~il~~isl~i~~Ge~v~i~G~sGsGKSTLl~~-l~Gl~---~~~~G~i~   59 (166)
T cd03223          12 DGRVLLKDLSFEIKPGDRLLITGPSGTGKSSLFRA-LAGLW---PWGSGRIG   59 (166)
T ss_pred             CCCEEEEEEEEEECCCCEEEEECCCCCCHHHHHHH-HCCCC---CCCCCEEE
T ss_conf             99988944588988999999995899988999999-86987---69986799


No 402
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=91.50  E-value=0.33  Score=27.25  Aligned_cols=151  Identities=18%  Similarity=0.258  Sum_probs=71.9

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHH--CCHHHEEEEEE--CCCCCE---------ECCCCCCCCEEEEEEEC
Q ss_conf             120114846997078753447999999999985--68011079997--234210---------00125775200004444
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYR--LRPDECRMIMV--DPKMLE---------LSVYDGIPHLLTPVVTN  473 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~--~~p~~~~~~li--D~k~~~---------~~~~~~~ph~~~~v~~~  473 (744)
                      +++.+.=-+-|-|..|||||++|+ +|.+|+..  ..|+.=++++-  |.....         .+....-|+++.  .|=
T Consensus        21 l~i~~Ge~~~iiG~SGsGKSTll~-~i~gL~~~~~~~p~~G~I~~~g~~i~~~~~~~~~~R~~ig~VfQ~~~lf~--~TV   97 (227)
T cd03260          21 LDIPKGEITALIGPSGCGKSTLLR-LLNRLNDLIPGAPDEGEVLLDGKDIYDLDVDVLELRRRVGMVFQKPNPFP--GSI   97 (227)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHH-HHHHHHHCCCCCCCCEEEEECCEECCCCCCCHHHHHHCCEEECCCCCCCC--CCH
T ss_conf             788799899999999981999999-99744502689981469999999998899587889628268764776677--809


Q ss_pred             HHHHHHHHHH----HHHHHHHH-HHHHHHCCCCC----------HH-HHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH
Q ss_conf             1787689999----99866769-99999807786----------79-999988642026776665432338679998445
Q gi|254780606|r  474 PKKAVMALKW----AVREMEER-YRKMSHLSVRN----------IK-SYNERISTMYGEKPQGCGDDMRPMPYIVIIVDE  537 (744)
Q Consensus       474 ~~~~~~~l~~----~~~em~~r-~~~~~~~~~~~----------i~-~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE  537 (744)
                      .+.....|+.    -.++++.| .+.+...|..+          +. +-.+|++-.+.-         -.-|.| ++.||
T Consensus        98 ~eNi~~~l~~~~~~~~~~~~~~v~~~L~~vgL~~~~~~~~~p~~LSGGq~QRvaIArAL---------~~~P~i-LllDE  167 (227)
T cd03260          98 YDNVAYGLRLHGIKLKEELDERVEEALRKAALWDEVKDRLHALGLSGGQQQRLCLARAL---------ANEPEV-LLLDE  167 (227)
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCHHHHHHHHHHHHH---------HCCCCE-EEECC
T ss_conf             99999999983899999999999999987799758844568022899999999999998---------359999-99689


Q ss_pred             H-HHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             6-8767531035899999999964201358999851654
Q gi|254780606|r  538 M-ADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       538 ~-a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      = +.|-.....++...|.+|.+.     +-+|+.|-+..
T Consensus       168 PTs~LD~~~~~~i~~li~~l~~~-----~Tii~vTHdl~  201 (227)
T cd03260         168 PTSALDPISTAKIEELIAELKKE-----YTIVIVTHNMQ  201 (227)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHC-----CEEEEEECCHH
T ss_conf             87657989999999999999668-----88999936999


No 403
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=91.45  E-value=0.54  Score=25.80  Aligned_cols=69  Identities=20%  Similarity=0.203  Sum_probs=39.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE----ECCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             699707875344799999999998568011079997234210----00125775200004444178768999999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE----LSVYDGIPHLLTPVVTNPKKAVMALKWAV  485 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~----~~~~~~~ph~~~~v~~~~~~~~~~l~~~~  485 (744)
                      +++.|-||+|||..+-=|..-+.  .....+-|+=.|..+..    |..|..+-.+-...+.+.......+++..
T Consensus         3 i~lvGptGvGKTTTiaKLA~~~~--~~~~kV~lit~Dt~R~gA~eQL~~~a~~l~v~~~~~~~~~~~~~~~~~~~   75 (173)
T cd03115           3 ILLVGLQGVGKTTTAAKLALYLK--KKGKKVLLVAADTYRPAAIEQLRVLGEQVGVPVFEEGEGKDPVSIAKRAI   75 (173)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHH--HCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHH
T ss_conf             99989999988999999999999--76992899974887577999999999974985992277558799999999


No 404
>PRK13850 type IV secretion system protein VirD4; Provisional
Probab=91.44  E-value=0.96  Score=24.10  Aligned_cols=112  Identities=16%  Similarity=0.176  Sum_probs=73.1

Q ss_pred             EEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC-CCCH-----HHHHHCCCCEEEEECCCHHHCCH
Q ss_conf             79998445687675310358999999999642013589998516544-4414-----67885056305720368111003
Q gi|254780606|r  530 YIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV-DVIT-----GTIKANFPIRISFQVTSKIDSRT  603 (744)
Q Consensus       530 ~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~-~vi~-----~~ik~n~~~ri~~~v~~~~dsr~  603 (744)
                      .+++..|||..|=..  +.+|..+.-    -+.+||.+++-.|-.+- +-+=     ..|-+|...||.|.+.+..+.+.
T Consensus       390 ~vLlLLDEF~aLGkL--~iie~Ala~----mAGYGiRl~lI~Qsl~QL~~~YGe~~a~tilsN~~vrI~fapnD~eTAk~  463 (670)
T PRK13850        390 EVLFLLDEFKHLGKL--EAIETAITT----IAGYKGRFMFIIQSLSALTGTYDEAGKQNFLSNTGVQVFMATADDETPTY  463 (670)
T ss_pred             EEEEEECCCCCCCCH--HHHHHHHHH----HCCCCCEEEEEEECHHHHHHHHCHHHHHHHHHCCCEEEEECCCCHHHHHH
T ss_conf             079986064105874--899999998----62568789999847999998858415678872572699965797766999


Q ss_pred             HCCCCCH----------------------------------HHHCCCCCEEEECCCCCEEEEEEC-CCCHHHHHHHHHH
Q ss_conf             2676316----------------------------------885689846864689843899934-3898899999999
Q gi|254780606|r  604 ILGEHGA----------------------------------EQLLGRGDMLYMSGGGRIQRVHGP-LVSDIEIEKVVQH  647 (744)
Q Consensus       604 il~~~ga----------------------------------e~l~g~gd~l~~~~~~~~~r~~~~-~~~~~~~~~~~~~  647 (744)
                      |=+.-|-                                  -..|+.-|.|.+..|..|||..-. |..|.+.+++-+-
T Consensus       464 iS~~LG~~T~~~~s~S~~~~r~~~~s~s~seq~RpLLtP~Evr~Lp~d~eIvlv~G~~PI~akKirYY~D~~fk~i~~~  542 (670)
T PRK13850        464 ISKAIGDYTFKARSTSYSQARMFDHNIQISDQGAPLLRPEQVRLLDDDYEIVLIKGQPPLKLRKVRYYSDRELKRIFEA  542 (670)
T ss_pred             HHHHHCHHHEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCEEEEECCCCCEEECEEEECCCHHHHHHHHH
T ss_conf             9998482134533110367877788744002667689978995399876699806999703333154158888888874


No 405
>PRK08727 hypothetical protein; Validated
Probab=91.40  E-value=0.59  Score=25.53  Aligned_cols=42  Identities=26%  Similarity=0.394  Sum_probs=27.4

Q ss_pred             EEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             99844568767531035899999999964201358999851654
Q gi|254780606|r  532 VIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       532 vvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      +|+||.+-.+.  ..++.|..+=.|--..|..|..|++++..+-
T Consensus        96 ll~iDDid~i~--g~~~~e~aLFhL~N~~~~~~~~ll~ts~~~P  137 (233)
T PRK08727         96 LVALDGVDSIA--GQREDEVALFDFHNRARAAGITLLYTARQMP  137 (233)
T ss_pred             EEEEECCHHCC--CCHHHHHHHHHHHHHHHHCCCEEEEECCCCH
T ss_conf             78985501126--9827999999999999861983899779895


No 406
>pfam09140 MipZ ATPase MipZ. MipZ is an ATPase that forms a complex with the chromosome partitioning protein ParB near the chromosomal origin of replication. It is responsible for the temporal and spatial regulation of FtsZ ring formation.
Probab=91.37  E-value=0.6  Score=25.48  Aligned_cols=86  Identities=23%  Similarity=0.291  Sum_probs=45.5

Q ss_pred             EEEEHHHHHHHHHHCCHHHHH----------HHHHHHHHHH----CCEEEEEEEECCCCC-----CCCHHHHHHCCCCEE
Q ss_conf             999844568767531035899----------9999999642----013589998516544-----441467885056305
Q gi|254780606|r  531 IVIIVDEMADLMMVAGKEIEG----------AIQRLAQMAR----AAGIHLIMATQRPSV-----DVITGTIKANFPIRI  591 (744)
Q Consensus       531 ivvviDE~a~l~~~~~~~~e~----------~~~~la~~~r----a~GihlilatQrp~~-----~vi~~~ik~n~~~ri  591 (744)
                      |+=+-|||-||-..+.-+.+.          .+..-+++.|    ..-|.-|+-..|-+.     +--.+....++.-||
T Consensus       125 IiPlq~sf~dld~L~~vd~~~~~i~~~s~y~e~vw~~r~~ra~~~~~~idwivlrnRl~~~~~rnk~~~~~~l~~Ls~ri  204 (261)
T pfam09140       125 VTPLNDSFVDFDLLGQVDPETFKVTRPSFYAEMVWEARKKRAQADRAPIDWIVLRNRLSTLEARNKRRVEDALNELSKRV  204 (261)
T ss_pred             EECCCHHHHHHHHHHHCCHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             63244015514335213703432136217899999999987436898864799805621888788899999999997640


Q ss_pred             EEECCCHHHCCHHCCCCCHHHHCCCCCEEE
Q ss_conf             720368111003267631688568984686
Q gi|254780606|r  592 SFQVTSKIDSRTILGEHGAEQLLGRGDMLY  621 (744)
Q Consensus       592 ~~~v~~~~dsr~il~~~gae~l~g~gd~l~  621 (744)
                      +||+.....-|+|.-+     |.-+|=-|+
T Consensus       205 gfr~~~g~~eRviyRe-----lfp~gltl~  229 (261)
T pfam09140       205 GFRVAPGFSERVIYRE-----LFPRGLTLL  229 (261)
T ss_pred             CCCCCCCCCHHHHHHH-----HCCCCCCHH
T ss_conf             7522577431357877-----624677141


No 407
>TIGR00630 uvra excinuclease ABC, A subunit; InterPro: IPR004602   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).  During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products . The UvrC protein contain 4 conserved regions: a central region which interact with UvrB (Uvr domain), a Helix hairpin Helix (HhH) domain important for 5 prime incision of damage DNA and the homology regions 1 and 2 of unknown function. UvrC homology region 2 is specific for UvrC proteins, whereas UvrC homology region 1 is also shared by few other nucleases.; GO: 0009381 excinuclease ABC activity, 0006289 nucleotide-excision repair, 0009380 excinuclease repair complex.
Probab=91.34  E-value=0.23  Score=28.34  Aligned_cols=122  Identities=21%  Similarity=0.290  Sum_probs=61.5

Q ss_pred             CCCCEEEEECCCCCCCEEEHHHHHCCHHHCC--CCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             8983454426888887076587512812114--67836898420578873211201148469970787534479999999
Q gi|254780606|r  357 PKRNAIGIELPNETRETVYLRQIIESRSFSH--SKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIM  434 (744)
Q Consensus       357 pg~~~~~~~~p~~~~~~v~~~~~~~~~~~~~--~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~  434 (744)
                      -|+  --|+||..+|..=.-|-|.=..+-.+  .+-.+.|+||+               =..|-|-.|||||.+||-++.
T Consensus       625 ~G~--~~I~vP~~R~~~~g~r~l~~~gA~~nNLK~i~v~iPLG~---------------~t~iTGVSGSGKSTLind~L~  687 (956)
T TIGR00630       625 SGK--KKIEVPKERRKGNGKRVLTLKGARENNLKNITVSIPLGL---------------FTCITGVSGSGKSTLINDTLY  687 (956)
T ss_pred             CCC--EECCCCCCCCCCCCCEEEEEEECCCCCCCCCEEEECCCE---------------EEEEECCCCCCHHHHHHHHHH
T ss_conf             785--103676311258895599984201056402117740771---------------799974458745777999999


Q ss_pred             HHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEE-------EEE----ECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             9998568011079997234210001257752000-------044----44178768999999866769999998077867
Q gi|254780606|r  435 SLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLT-------PVV----TNPKKAVMALKWAVREMEERYRKMSHLSVRNI  503 (744)
Q Consensus       435 sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~-------~v~----~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i  503 (744)
                      -.+++.      |..-.-+.+.+..-+|+-||--       ||=    .||-...       .-++.=..||++.--...
T Consensus       688 ~~~~~~------L~~~~~~~g~~~~I~G~e~lDKvi~iDQsPIGRTPRSNPATYt-------gvFd~IR~LFA~~PeAk~  754 (956)
T TIGR00630       688 PALARR------LNGAKTEPGRYKDIEGLEHLDKVIEIDQSPIGRTPRSNPATYT-------GVFDEIRELFAETPEAKA  754 (956)
T ss_pred             HHHHHH------HHCCCCCCCCCEEEEEECCCCCEEEECCCCCCCCCCCCCCCCC-------CCCHHHHHHHHCCCHHHH
T ss_conf             999999------8527645665203630002384688657743434688643201-------343057776405853787


Q ss_pred             HHHHH
Q ss_conf             99999
Q gi|254780606|r  504 KSYNE  508 (744)
Q Consensus       504 ~~~n~  508 (744)
                      .+|+.
T Consensus       755 RGY~~  759 (956)
T TIGR00630       755 RGYKP  759 (956)
T ss_pred             CCCCC
T ss_conf             38899


No 408
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP. This family consists of the BtuR, CobO, CobP proteins all of which are Cob(I)alamin (vitamin B12) adenosyltransferase, which is involved in cobalamin (vitamin B12) biosynthesis. This enzyme is a homodimer,  which catalyzes the adenosylation reaction: ATP + cob(I)alamin + H2O <= phosphate + diphosphate + adenosylcobalamin.
Probab=91.22  E-value=1.1  Score=23.64  Aligned_cols=134  Identities=19%  Similarity=0.246  Sum_probs=70.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC-CC----CEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999856801107999723-42----10001257752000044441787689999998667
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP-KM----LELSVYDGIPHLLTPVVTNPKKAVMALKWAVREME  489 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~-k~----~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~  489 (744)
                      +.|.=..|-|||    |-.+++++|..-.-.+.+++-| |+    +|+..+..++.+........ .     .| ..++.
T Consensus         5 i~vytG~GKGKT----TAAlG~alRA~G~G~rV~ivQFlKg~~~~GE~~~l~~l~~i~~~~~g~~-~-----~~-~~~~~   73 (159)
T cd00561           5 IQVYTGNGKGKT----TAALGLALRALGHGYRVGVVQFLKGGWKYGELKALERLPNIEIHRMGRG-F-----FW-TTEND   73 (159)
T ss_pred             EEEEECCCCCHH----HHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHHHHCCCCEEEECCCC-C-----CC-CCCCC
T ss_conf             999957999708----9999999998449998999998158987559999984899689988999-7-----32-27987


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEE
Q ss_conf             69999998077867999998864202677666543233867999844568767531035899999999964201358999
Q gi|254780606|r  490 ERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIM  569 (744)
Q Consensus       490 ~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlil  569 (744)
                      .+....++.      .++.......            .-.|=+||.||+...+...--..++ +..+-. .|.-++|+||
T Consensus        74 ~~~~~~a~~------~~~~a~~~l~------------~~~~dlvVLDEi~~a~~~gli~~~~-v~~~l~-~rp~~~evVl  133 (159)
T cd00561          74 EEDIAAAAE------GWAFAKEAIA------------SGEYDLVILDEINYALGYGLLDVEE-VVDLLK-AKPEDLELVL  133 (159)
T ss_pred             HHHHHHHHH------HHHHHHHHHH------------CCCCCEEEEHHHHHHHHCCCCCHHH-HHHHHH-HCCCCCEEEE
T ss_conf             999999999------9999999986------------8898999736689999859917999-999998-4899978999


Q ss_pred             EECCCCCCCC
Q ss_conf             8516544441
Q gi|254780606|r  570 ATQRPSVDVI  579 (744)
Q Consensus       570 atQrp~~~vi  579 (744)
                      .-..+....+
T Consensus       134 TGr~~p~~L~  143 (159)
T cd00561         134 TGRNAPKELI  143 (159)
T ss_pred             ECCCCCHHHH
T ss_conf             6999999999


No 409
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]
Probab=91.22  E-value=0.57  Score=25.66  Aligned_cols=73  Identities=27%  Similarity=0.411  Sum_probs=42.2

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC----CCCCE-------ECCCCCCCCEEEEEEE--CHHHH
Q ss_conf             14846997078753447999999999985680110799972----34210-------0012577520000444--41787
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD----PKMLE-------LSVYDGIPHLLTPVVT--NPKKA  477 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD----~k~~~-------~~~~~~~ph~~~~v~~--~~~~~  477 (744)
                      +++=++|+|.|+||||-    +-..|+.+..-   .++=+|    .|+.+       ..-..++||++..++.  +.-.+
T Consensus         2 ~~~~i~I~GPTAsGKT~----lai~LAk~~~~---eIIs~DSmQvYr~mdIGTAKps~~e~~~vpHhliDi~~p~e~ysa   74 (308)
T COG0324           2 KPKLIVIAGPTASGKTA----LAIALAKRLGG---EIISLDSMQVYRGLDIGTAKPSLEELAGVPHHLIDIRDPTESYSA   74 (308)
T ss_pred             CCCEEEEECCCCCCHHH----HHHHHHHHCCC---CEEECCHHHHCCCCCCCCCCCCHHHHCCCCEEEECCCCCCCCCCH
T ss_conf             96379998988757789----99999998299---289302355318886307999999985899787545683225549


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             6899999986676
Q gi|254780606|r  478 VMALKWAVREMEE  490 (744)
Q Consensus       478 ~~~l~~~~~em~~  490 (744)
                      ....+.+..+|++
T Consensus        75 ~~f~~~a~~~i~~   87 (308)
T COG0324          75 AEFQRDALAAIDD   87 (308)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 410
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=91.22  E-value=0.21  Score=28.57  Aligned_cols=41  Identities=17%  Similarity=0.326  Sum_probs=28.2

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             211201148469970787534479999999999856801107999
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      |-+++.+.=.+-|.|..|||||++++.| .+|   ..|+.=++.+
T Consensus        20 vsl~i~~Ge~~aliG~sGsGKSTLl~~l-~gl---~~p~~G~i~~   60 (248)
T PRK11264         20 IDLEVKPGEVVAIIGPSGSGKTTLLRCI-NLL---EQPEAGTIRV   60 (248)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHH-HCC---CCCCCCEEEE
T ss_conf             1779879989999999998099999999-758---9999867999


No 411
>PRK09694 hypothetical protein; Provisional
Probab=91.21  E-value=0.9  Score=24.28  Aligned_cols=76  Identities=13%  Similarity=0.115  Sum_probs=35.5

Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEE
Q ss_conf             99999980778679999988642026776665432338679998445687675310358999999999642013589998
Q gi|254780606|r  491 RYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMA  570 (744)
Q Consensus       491 r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihlila  570 (744)
                      +..+++..+|..|+..=--+-..+...-+     +-.|-.-||||||....-    ..+-.+|.++-+.=+++|.+.||-
T Consensus       408 Kr~LLap~~VGTiDQaLla~L~~kH~~LR-----~~gLa~kvvIiDEVHAYD----~Ym~~lL~~lL~wl~~~g~~viLL  478 (878)
T PRK09694        408 KRVFLGQIGVCTIDQVLISVLPVKHRFIR-----GLGIGRSVLIVDEVHAYD----AYMNGLLEAVLKAQAQVGGSVILL  478 (878)
T ss_pred             HHHHCCCCEECCHHHHHHHHHCCCHHHHH-----HHHHCCCEEEEECCCCCC----HHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             22313771546799999987461489999-----998628748972533345----889999999999999839988999


Q ss_pred             ECCCC
Q ss_conf             51654
Q gi|254780606|r  571 TQRPS  575 (744)
Q Consensus       571 tQrp~  575 (744)
                      |=.-.
T Consensus       479 SATLP  483 (878)
T PRK09694        479 SATLP  483 (878)
T ss_pred             ECCCC
T ss_conf             27898


No 412
>PRK02224 chromosome segregation protein; Provisional
Probab=91.16  E-value=0.24  Score=28.19  Aligned_cols=23  Identities=30%  Similarity=0.537  Sum_probs=9.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             46997078753447999999999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +.+|.|-+|||||..+-+|..+|
T Consensus        25 i~~I~G~NGsGKSsIldAI~~aL   47 (880)
T PRK02224         25 VTVIHGLNGSGKSSLLEACFFAL   47 (880)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH
T ss_conf             58998999998899999999998


No 413
>PRK05986 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated
Probab=91.14  E-value=1.1  Score=23.59  Aligned_cols=134  Identities=16%  Similarity=0.236  Sum_probs=67.0

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC-CC----CEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             469970787534479999999999856801107999723-42----1000125775200004444178768999999866
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP-KM----LELSVYDGIPHLLTPVVTNPKKAVMALKWAVREM  488 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~-k~----~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em  488 (744)
                      -+.|.=..|-|||    |..++|++|..-...+.+++-| |+    +|...+. .+.+.. ......     .-|-....
T Consensus        24 li~VytG~GKGKT----TAAlGlalRA~G~G~rV~ivQFlKg~~~~GE~~~l~-~~~i~~-~~~g~g-----~~~~~~~~   92 (190)
T PRK05986         24 LLIVHTGNGKGKS----TAAFGMALRAVGHGKKVGVVQFIKGAWSTGERNLLE-GPGVEF-HVMGTG-----FTWETQDR   92 (190)
T ss_pred             EEEEEECCCCCHH----HHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHC-CCCCEE-EECCCC-----CCCCCCCC
T ss_conf             7999806998718----899999999836998899999944885457788743-798289-987899-----85778971


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             76999999807786799999886420267766654323386799984456876753103589999999996420135899
Q gi|254780606|r  489 EERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLI  568 (744)
Q Consensus       489 ~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gihli  568 (744)
                      ++... .++.      .++.-.....            .-.|=+||.||+...+...--+.++.+ .+- ..|.-++|||
T Consensus        93 e~d~~-~a~~------~~~~a~~~l~------------~~~~dlvVLDEi~~Al~~gll~~eevi-~~L-~~rp~~~evV  151 (190)
T PRK05986         93 ERDIA-AARE------GWEEAKRMLA------------DESYDLVVLDELTYALKYGYLDLEEVL-EAL-NNRPGMQHVV  151 (190)
T ss_pred             HHHHH-HHHH------HHHHHHHHHH------------CCCCCEEEHHHHHHHHHCCCCCHHHHH-HHH-HHCCCCCEEE
T ss_conf             89999-9999------9999999985------------888888953767999855995899999-999-8289987699


Q ss_pred             EEECCCCCCCC
Q ss_conf             98516544441
Q gi|254780606|r  569 MATQRPSVDVI  579 (744)
Q Consensus       569 latQrp~~~vi  579 (744)
                      |.-..+....+
T Consensus       152 LTGR~~p~~L~  162 (190)
T PRK05986        152 ITGRGAPRELI  162 (190)
T ss_pred             EECCCCCHHHH
T ss_conf             97999999999


No 414
>pfam04317 DUF463 YcjX-like family, DUF463. Some members of this family are thought to possess an ATP-binding domain towards their N-terminus.
Probab=91.13  E-value=0.19  Score=28.96  Aligned_cols=88  Identities=18%  Similarity=0.324  Sum_probs=41.5

Q ss_pred             HHHHHCCHHHEEEEEECCCCCEE-CCCCCCCCE-EEEEEEC-HHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             99985680110799972342100-012577520-0004444-17876899999986676999999807786799999886
Q gi|254780606|r  435 SLLYRLRPDECRMIMVDPKMLEL-SVYDGIPHL-LTPVVTN-PKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERIS  511 (744)
Q Consensus       435 sl~~~~~p~~~~~~liD~k~~~~-~~~~~~ph~-~~~v~~~-~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~  511 (744)
                      ..|..+..+. .|.++-|.+.-+ ..+++-|-| +.|.... ...+  .-..+..+|++||+..++.=|+-.  |...+ 
T Consensus       180 ~yL~~~r~~~-gls~lqPGRFLLPGdleGaP~L~F~PL~~~~~~~~--~~~Sl~~~l~rRye~Yk~~VVkPF--fr~hF-  253 (443)
T pfam04317       180 AYLHACKEEQ-GLSFLQPGRFLLPGELEGAPALTFFPLPHLSEEQA--PKGSLYAMLERRYEAYKQHVVKPF--YRDHF-  253 (443)
T ss_pred             HHHHHHHHHC-CCCCCCCCEEECCCCCCCCCCEEEECCCCCCCCCC--CCCCHHHHHHHHHHHHHHHHCCHH--HHHHH-
T ss_conf             9999999854-86426884164366557885125524766554567--777489999999999999753588--99998-


Q ss_pred             HHHCCCCCCCCCCCCCCCEEEEEHHHHHHHH
Q ss_conf             4202677666543233867999844568767
Q gi|254780606|r  512 TMYGEKPQGCGDDMRPMPYIVIIVDEMADLM  542 (744)
Q Consensus       512 ~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~  542 (744)
                                    ..+=+-||.||=+..|.
T Consensus       254 --------------~r~DRQIVLVD~L~aLn  270 (443)
T pfam04317       254 --------------ARFDRQIVLVDCLQALN  270 (443)
T ss_pred             --------------HCCCCEEEHHHHHHHHH
T ss_conf             --------------60163343887677875


No 415
>COG1201 Lhr Lhr-like helicases [General function prediction only]
Probab=91.12  E-value=1.1  Score=23.58  Aligned_cols=17  Identities=35%  Similarity=0.565  Sum_probs=9.5

Q ss_pred             HCCCEEEEECCCCCHHH
Q ss_conf             14846997078753447
Q gi|254780606|r  411 NMPHILVAGTTGSGKSV  427 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~  427 (744)
                      ..=|+||.--||||||.
T Consensus        36 ~G~nvLiiAPTGsGKTe   52 (814)
T COG1201          36 SGENVLIIAPTGSGKTE   52 (814)
T ss_pred             CCCCEEEECCCCCCHHH
T ss_conf             89846998689997379


No 416
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=91.12  E-value=0.39  Score=26.75  Aligned_cols=64  Identities=22%  Similarity=0.304  Sum_probs=35.6

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE-------ECCCCCCCCEEE
Q ss_conf             732112011484699707875344799999999998568011079997234210-------001257752000
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE-------LSVYDGIPHLLT  468 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~-------~~~~~~~ph~~~  468 (744)
                      +.+-+++.+.-|.-+.|.+|+|||.+++. |++++-- .-.++++--+|-....       .+....-||++.
T Consensus       338 ~~l~~t~~~g~~talvG~SGaGKSTLl~l-L~G~~~~-~~G~I~vng~~l~~l~~~~~~k~i~~v~Q~p~lf~  408 (559)
T COG4988         338 SDLNLTIKAGQLTALVGASGAGKSTLLNL-LLGFLAP-TQGEIRVNGIDLRDLSPEAWRKQISWVSQNPYLFA  408 (559)
T ss_pred             CCCEEEECCCCEEEEECCCCCCHHHHHHH-HHCCCCC-CCCEEEECCCCCCCCCHHHHHHHEEEECCCCCCCC
T ss_conf             67106754896799988999978999999-8475777-78448889931000687788867246279984056


No 417
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=91.10  E-value=0.22  Score=28.42  Aligned_cols=54  Identities=24%  Similarity=0.433  Sum_probs=33.1

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             6898420578873211201148469970787534479999999999856801107999
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      |.+..|...-=+-+-+++.+.=.+.|-|-.|||||++|++ |.+++   .|..=++++
T Consensus        13 Ls~~yg~~~~l~~isl~I~~Ge~~~iiGpNGaGKSTLlk~-i~Gll---~p~~G~I~l   66 (265)
T PRK10253         13 LTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRT-LSRLM---TPAHGHVWL   66 (265)
T ss_pred             EEEEECCEEEEEEEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEE
T ss_conf             9999999999840288985997999999988399999999-97498---888529999


No 418
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=91.09  E-value=1.1  Score=23.56  Aligned_cols=51  Identities=20%  Similarity=0.361  Sum_probs=38.9

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             732112011484699707875344799999999998568011079997234
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      +.++..|..-|+++..|..|.|||-+-+-+--+|+-...++.++++=+-+-
T Consensus       185 ~~~~~sLktKknvIL~G~pGtGKT~lAk~lA~~l~g~~~~~rv~~Vqfhps  235 (459)
T PRK11331        185 ETILKRLTIKKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQS  235 (459)
T ss_pred             HHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCC
T ss_conf             999998545882796589998878999999999707887784689983588


No 419
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=91.08  E-value=0.1  Score=30.72  Aligned_cols=119  Identities=13%  Similarity=0.229  Sum_probs=59.2

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEE-EEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHH--
Q ss_conf             48469970787534479999999999856801107-999723421000125775200004444178768999999866--
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECR-MIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREM--  488 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~-~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em--  488 (744)
                      .--|-|.|..|.|||..++..|..|-....-.++. |-.|.--|.-              ++++..+-..|......-  
T Consensus       293 G~cLYISGVPGTGKTATV~eVIr~L~~~~~~~~lp~F~fVEINGMk--------------Lt~P~qaY~~L~e~Ltg~k~  358 (650)
T PTZ00112        293 GQILYISGVPGTGKTATVYMVIKELQNKKLKGQLPWFNLFEINGVN--------------LVHPNAAYRVFYKKLFNKKP  358 (650)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCEE--------------CCCHHHHHHHHHHHHHCCCC
T ss_conf             6569997899998003699999999999970899981599973637--------------79878899999999848988


Q ss_pred             ---HHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEE
Q ss_conf             ---76999999807786799999886420267766654323386799984456876753103589999999996420135
Q gi|254780606|r  489 ---EERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGI  565 (744)
Q Consensus       489 ---~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~Gi  565 (744)
                         ...+.++.+.           +.       .      .. ...|+++||+- ++.+..+.+--.|-.+..+-.|-=|
T Consensus       359 ~~~~~A~~lL~k~-----------F~-------~------~r-~p~VlLvDELD-~LvTkkQ~VlYNLFdWPT~~~SkLI  412 (650)
T PTZ00112        359 PNALNSYKELDKL-----------FN-------N------NR-TPSILIVDEAD-YIVTKTQKVLFTLFDWPTKKNSKLI  412 (650)
T ss_pred             CCHHHHHHHHHHH-----------HC-------C------CC-CCEEEEECHHH-HHHHCCCCEEEECCCCCCCCCCEEE
T ss_conf             8678999999998-----------26-------8------99-71899971577-7763677457773668898887079


Q ss_pred             EEEEE
Q ss_conf             89998
Q gi|254780606|r  566 HLIMA  570 (744)
Q Consensus       566 hlila  570 (744)
                      -+-+|
T Consensus       413 VIaIA  417 (650)
T PTZ00112        413 LIIIS  417 (650)
T ss_pred             EEEEE
T ss_conf             99985


No 420
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=91.07  E-value=0.33  Score=27.26  Aligned_cols=22  Identities=41%  Similarity=0.622  Sum_probs=17.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHH
Q ss_conf             6997078753447999999999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      +.|+|.+|||||.+-+.|.-.|
T Consensus         2 IgI~G~sgsGKTT~a~~L~~~l   23 (198)
T cd02023           2 IGIAGGSGSGKTTVAEEIIEQL   23 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
T ss_conf             8988999885999999999980


No 421
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=91.05  E-value=0.64  Score=25.29  Aligned_cols=40  Identities=23%  Similarity=0.283  Sum_probs=27.7

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             21120114846997078753447999999999985680110799
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      +-+++.+.=.+.|.|.-|+|||++|+. |++++   .|+.=++.
T Consensus       343 vs~~i~~Ge~iaivG~NGsGKSTLlk~-l~G~~---~p~~G~i~  382 (556)
T PRK11819        343 LSFKLPPGGIVGIIGPNGAGKSTLFKM-ITGQE---QPDSGTIK  382 (556)
T ss_pred             ECCCCCCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEE
T ss_conf             402357882478988987758899999-83865---68885599


No 422
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=91.03  E-value=0.39  Score=26.80  Aligned_cols=44  Identities=23%  Similarity=0.473  Sum_probs=30.2

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             2112011484699707875344799999999998568011079997234
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      |-.+++..--+.+-|..|+|||.+|| ++.+++   .|+.=++ .+|-+
T Consensus        24 vsL~ia~ge~vv~lGpSGcGKTTLLn-l~AGf~---~P~~G~i-~l~~r   67 (259)
T COG4525          24 VSLTIASGELVVVLGPSGCGKTTLLN-LIAGFV---TPSRGSI-QLNGR   67 (259)
T ss_pred             CCEEECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCCCEE-EECCE
T ss_conf             55023589789997688865788999-986275---8566648-88998


No 423
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345   These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. .
Probab=91.02  E-value=0.98  Score=24.02  Aligned_cols=223  Identities=19%  Similarity=0.205  Sum_probs=104.5

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC--CCCCCEEEEEEECHHHHHHHHHH
Q ss_conf             1120114846997078753447999999999985680110799972342100012--57752000044441787689999
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY--DGIPHLLTPVVTNPKKAVMALKW  483 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~--~~~ph~~~~v~~~~~~~~~~l~~  483 (744)
                      +.+++.-==+++.|..|.|||+.++.+|--...-.+++ +     |     ...|  ++.+   ...+--..+|+.-|..
T Consensus       359 L~~~~~~Kv~iLTGGPGTGKtT~t~~i~~~~~~~~gl~-l-----~-----~~~~vndd~~---v~LaAPTGrAAkRl~E  424 (769)
T TIGR01448       359 LKTAIQDKVVILTGGPGTGKTTITKAIIELYEELKGLD-L-----D-----KDDYVNDDLP---VVLAAPTGRAAKRLAE  424 (769)
T ss_pred             HHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCC-C-----C-----CCCCCCCCCE---EEEECCCHHHHHHCCC
T ss_conf             99986094899857788861689999999998716877-5-----5-----3124567764---8873774378885110


Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCC-CCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHC
Q ss_conf             998667699999980778679999988642026776665-4323386799984456876753103589999999996420
Q gi|254780606|r  484 AVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCG-DDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARA  562 (744)
Q Consensus       484 ~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~-~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra  562 (744)
                      +-.+--.--.  +.+      +|+..        ..... .-.+++++=+|||||+.  ||+   +  -++.+|-+ +=.
T Consensus       425 ~TG~~a~TIH--RLl------G~~~~--------~~~~~k~~~~~~~~DL~IvDE~S--M~D---t--~L~~~lL~-a~P  480 (769)
T TIGR01448       425 VTGLEALTIH--RLL------GYGSD--------TKSENKNLEDPIDADLLIVDESS--MVD---T--WLASSLLA-AVP  480 (769)
T ss_pred             CCCCHHHHHH--HHH------CCCCC--------CCCCCHHHCCCCCCCEEEEECCC--HHH---H--HHHHHHHH-HCC
T ss_conf             0262123477--863------68988--------87321101134787769981462--188---9--99999986-179


Q ss_pred             CEEEEEE---EECCCCCC---CCHHHHHHCCCCEEEEE-C-CCHHHCCHHCCCCCH--------HHHCCCCCEEEEC-CC
Q ss_conf             1358999---85165444---41467885056305720-3-681110032676316--------8856898468646-89
Q gi|254780606|r  563 AGIHLIM---ATQRPSVD---VITGTIKANFPIRISFQ-V-TSKIDSRTILGEHGA--------EQLLGRGDMLYMS-GG  625 (744)
Q Consensus       563 ~Gihlil---atQrp~~~---vi~~~ik~n~~~ri~~~-v-~~~~dsr~il~~~ga--------e~l~g~gd~l~~~-~~  625 (744)
                      -+-.|||   +-|=|||+   |+..+|.+|.==++-|- | --...|.+|....+-        ..--+++|+.|.. ..
T Consensus       481 ~~a~lllVGD~DQLPSV~pG~VL~DLi~s~~iP~~~LT~vyRQ~~~S~Ii~~Ah~~~~G~~Pvlnss~~~~Df~~~~~~~  560 (769)
T TIGR01448       481 DHARLLLVGDADQLPSVGPGQVLKDLIQSKVIPVTRLTKVYRQAEGSSIITLAHKILQGEAPVLNSSSAKKDFKFLKLDR  560 (769)
T ss_pred             CCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCEEECCCEEEECCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             77779888376888988644089999846886612121112411366467888987317887523244676677776400


Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             8438999343898899999999984088753111124555544
Q gi|254780606|r  626 GRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDK  668 (744)
Q Consensus       626 ~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  668 (744)
                      +.+--.+..-  -.=|++|+.-.+..|-+--+-.++.....+.
T Consensus       561 s~~e~~~~~i--~~~v~~~~~~a~~~Gi~~~dIQVLaPM~kG~  601 (769)
T TIGR01448       561 SEPEEAAKHI--PLMVEKIVGAAKKKGIPGADIQVLAPMYKGE  601 (769)
T ss_pred             CCHHHHHHHH--HHHHHHHHHHHHHCCCCCCEEEECCCCCCCC
T ss_conf             1010666789--9999887789871798600001525898984


No 424
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD. This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria.
Probab=91.02  E-value=0.23  Score=28.31  Aligned_cols=24  Identities=33%  Similarity=0.750  Sum_probs=14.2

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             846997078753447999999999
Q gi|254780606|r  413 PHILVAGTTGSGKSVAINTMIMSL  436 (744)
Q Consensus       413 PH~lvaG~TgsGKS~~l~~~i~sl  436 (744)
                      |=.||+|.-|+|||.||+++.++|
T Consensus        29 ~i~li~G~NG~GKTTll~Ai~~~L   52 (650)
T TIGR03185        29 PIILIGGLNGAGKTTLLDAIQLGL   52 (650)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             879997799997899999999995


No 425
>PRK09376 rho transcription termination factor Rho; Provisional
Probab=90.98  E-value=1.2  Score=23.49  Aligned_cols=184  Identities=23%  Similarity=0.297  Sum_probs=99.8

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEE-C----HHHHHHHH
Q ss_conf             120114846997078753447999999999985680110799972342100012577520000444-4----17876899
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVT-N----PKKAVMAL  481 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~-~----~~~~~~~l  481 (744)
                      .-+.|.=-.||..-..+|||++|+.|.-|+...|+--+|-++|||-.--|-+.+...-  .+-|+. .    ++.... .
T Consensus       164 aPIGkGQRgLIVAPPkaGKT~lLq~IA~aI~~N~Pe~~liVLLIDERPEEVTdm~r~v--~~eV~aStfD~~~~~H~~-v  240 (416)
T PRK09376        164 APIGKGQRGLIVAPPKAGKTVLLQNIANSITTNHPEVHLIVLLIDERPEEVTDMQRSV--KGEVVASTFDEPAERHVQ-V  240 (416)
T ss_pred             CCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHC--CEEEEEECCCCCHHHHHH-H
T ss_conf             5413585003756998754799999999998569971999999048934777877504--618999779998789999-9


Q ss_pred             HHHHHHH-HHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             9999866-769999998077867999998864202677666543233867999844568767531035899999999964
Q gi|254780606|r  482 KWAVREM-EERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMA  560 (744)
Q Consensus       482 ~~~~~em-~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~  560 (744)
                          .|| -+|.+.|.+.|                       .      -+||.+|                  .|.++|
T Consensus       241 ----ae~~lerAkRlvE~G-----------------------~------DVvillD------------------SiTRLa  269 (416)
T PRK09376        241 ----AEMVIEKAKRLVEHG-----------------------K------DVVILLD------------------SITRLA  269 (416)
T ss_pred             ----HHHHHHHHHHHHHCC-----------------------C------CEEEEEC------------------CHHHHH
T ss_conf             ----999999999998769-----------------------9------7899973------------------157888


Q ss_pred             HCCEEEEEEEECCCCCCCCHHHHHHCCCC---EE--EEECCCHHHCCHHCCC----CC-------HHHHCCCCCE-EEEC
Q ss_conf             20135899985165444414678850563---05--7203681110032676----31-------6885689846-8646
Q gi|254780606|r  561 RAAGIHLIMATQRPSVDVITGTIKANFPI---RI--SFQVTSKIDSRTILGE----HG-------AEQLLGRGDM-LYMS  623 (744)
Q Consensus       561 ra~GihlilatQrp~~~vi~~~ik~n~~~---ri--~~~v~~~~dsr~il~~----~g-------ae~l~g~gd~-l~~~  623 (744)
                      ||+-.     ++.++-.+++|.+-+|.=.   |.  |-|-.....|=|||..    .|       -|-+.|-|.| |++.
T Consensus       270 RAyN~-----~~~~sGr~lsGG~D~~Al~~PKrfFGAARnie~GGSLTIiaTaLveTgSrMDdvIfeEfkgTgNmEl~Ld  344 (416)
T PRK09376        270 RAYNT-----VVPSSGKVLSGGVDANALHRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMELHLD  344 (416)
T ss_pred             HHHHC-----CCCCCCCCCCCCCCHHHHCCCHHHHHHHCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHCCCCCEEEEEC
T ss_conf             88623-----4699877544765777760556764100267767517787777752686253899998515784599987


Q ss_pred             CC-C-C-E----------EEEEECCCCHHHHHHHHHHHH
Q ss_conf             89-8-4-3----------899934389889999999998
Q gi|254780606|r  624 GG-G-R-I----------QRVHGPLVSDIEIEKVVQHLK  649 (744)
Q Consensus       624 ~~-~-~-~----------~r~~~~~~~~~~~~~~~~~~~  649 (744)
                      -. + + +          .|----+++++|.++|-..-+
T Consensus       345 r~la~~RifPAIdi~~SgTRkEelLl~~~e~~~~~~lRr  383 (416)
T PRK09376        345 RKLAEKRIFPAIDINRSGTRKEELLLSPEELQKVWILRK  383 (416)
T ss_pred             HHHHHCCCCCCCCCCCCCCCHHHHCCCHHHHHHHHHHHH
T ss_conf             667757886401333577725765379999999999999


No 426
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]
Probab=90.91  E-value=0.14  Score=29.82  Aligned_cols=23  Identities=30%  Similarity=0.408  Sum_probs=18.5

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             14846997078753447999999
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMI  433 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i  433 (744)
                      +.--+-|.|..|||||+||++|=
T Consensus        31 ~GdVisIIGsSGSGKSTfLRCiN   53 (256)
T COG4598          31 AGDVISIIGSSGSGKSTFLRCIN   53 (256)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHH
T ss_conf             89889996589986268999998


No 427
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=90.90  E-value=0.69  Score=25.05  Aligned_cols=32  Identities=19%  Similarity=0.373  Sum_probs=23.1

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCH
Q ss_conf             14846997078753447999999999985680
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRP  442 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p  442 (744)
                      +--.+|+.|..|+|||.+|+.+.-.-+-...|
T Consensus        13 ~~~KililG~~~sGKTsll~~l~~~~~~~~~p   44 (173)
T cd04154          13 REMRILILGLDNAGKTTILKKLLGEDIDTISP   44 (173)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHCCCCCCCCCC
T ss_conf             73189999899978899999983999897267


No 428
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed
Probab=90.79  E-value=0.8  Score=24.63  Aligned_cols=53  Identities=23%  Similarity=0.335  Sum_probs=31.4

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             689842057887321120114846997078753447999999999985680110799
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      |.+..|...-=+-+-+++.+.-.+-|.|-.|||||.+|++| ++++   .|+.=++.
T Consensus         8 Ls~~yG~~~~L~~Vsl~I~~GEi~gLIGPNGAGKSTLLk~I-~Gll---~P~~G~V~   60 (409)
T PRK09536          8 LDVEFGGTTILDGVDLSVREGHLVGVVGPNGAGKTTLLRAM-NGLI---TPTAGTVL   60 (409)
T ss_pred             EEEEECCEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHH-HCCC---CCCCEEEE
T ss_conf             89999999989250889889989999999872799999999-6688---88963999


No 429
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IPR010222   This entry represents HrpA, one of two related but uncharacterised DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterised, is about 800 amino acids long. Related characterised eukaryotic proteins are RNA helicases associated with pre-mRNA processing.; GO: 0005524 ATP binding, 0008026 ATP-dependent helicase activity.
Probab=90.75  E-value=0.13  Score=30.13  Aligned_cols=22  Identities=32%  Similarity=0.678  Sum_probs=16.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHH
Q ss_conf             4699707875344799999999
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMS  435 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~s  435 (744)
                      =++|||-||||||+=|==|++-
T Consensus        86 VviiAGETGSGKTTQLPKICLE  107 (1320)
T TIGR01967        86 VVIIAGETGSGKTTQLPKICLE  107 (1320)
T ss_pred             EEEEECCCCCCCCCCCHHHHHH
T ss_conf             8999724487620232167775


No 430
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=90.73  E-value=0.24  Score=28.24  Aligned_cols=40  Identities=28%  Similarity=0.359  Sum_probs=27.9

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             32112011484699707875344799999999998568011079
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      .+-+++.+.=++-|.|.-|||||++|+. |++++   .|+.=++
T Consensus       330 ~vsl~i~~GeriaIvG~NGsGKSTLlk~-L~G~l---~p~~G~i  369 (638)
T PRK10636        330 SIKLNLVPGSRIGLLGRNGAGKSTLIKL-LAGEL---APVSGEI  369 (638)
T ss_pred             CCCCEECCCCEEEEECCCCCCHHHHHHH-HCCCC---CCCCCEE
T ss_conf             7750563784799974787138899999-72887---8888569


No 431
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.71  E-value=0.17  Score=29.26  Aligned_cols=32  Identities=28%  Similarity=0.414  Sum_probs=23.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHE
Q ss_conf             46997078753447999999999985680110
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDEC  445 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~  445 (744)
                      --.+-|.||+|||.+|.++-+-|=.+...+-+
T Consensus        23 lnVlTGETGAGKSIlidAL~lllG~Ra~~~~I   54 (276)
T cd03241          23 LTVLTGETGAGKSILLDALSLLLGGRASADLI   54 (276)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             75887899888999999999962899884533


No 432
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=90.69  E-value=0.3  Score=27.54  Aligned_cols=49  Identities=24%  Similarity=0.403  Sum_probs=33.5

Q ss_pred             EEECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             42057887321120----114846997078753447999999999985680110799
Q gi|254780606|r  396 LGKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       396 ~g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      |.+..++++++-|+    ...=.+.|-|..|+|||++|+ +|++|+   .|+.=++.
T Consensus        17 ls~~~~~~~vl~~isf~v~~Ge~~~l~GpNGaGKTTLlr-~l~Gl~---~p~~G~I~   69 (214)
T PRK13543         17 LAFSRNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLR-VLAGLL---HVESGQIQ   69 (214)
T ss_pred             EEEEECCEEEEECEEEEECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCCEEEE
T ss_conf             799979999982638898189899999999987999999-997697---78841999


No 433
>pfam04851 ResIII Type III restriction enzyme, res subunit.
Probab=90.65  E-value=0.46  Score=26.29  Aligned_cols=27  Identities=33%  Similarity=0.460  Sum_probs=22.4

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             148469970787534479999999999
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      +..+.+|...||||||.+.-.++..++
T Consensus        17 ~~~~~~i~~pTGsGKT~~~~~~i~~~~   43 (103)
T pfam04851        17 EKKRGLIVMATGSGKTLTAAKLIARLL   43 (103)
T ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             639869995899987999999999998


No 434
>PRK06674 DNA polymerase III subunits gamma and tau; Validated
Probab=90.60  E-value=0.94  Score=24.16  Aligned_cols=93  Identities=17%  Similarity=0.232  Sum_probs=38.8

Q ss_pred             HHHHHHHHHHHCCCCCE-----------EEEECCCCEEEEECCCC-CCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCC
Q ss_conf             85999999871477632-----------77518983454426888-8870765875128121146783689842057887
Q gi|254780606|r  336 IGLADDIARSMSSLSAR-----------VAVIPKRNAIGIELPNE-TRETVYLRQIIESRSFSHSKANLALCLGKTISGE  403 (744)
Q Consensus       336 ~~~~~d~~~~~~~~~~~-----------~~~~pg~~~~~~~~p~~-~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~  403 (744)
                      +.++.-+|.+|--..-.           ....-|...=-+|+... ++..-.+|++.+.-.|..+..+-          +
T Consensus        52 ts~Ari~AkaLnC~~~~~~~pC~~C~~C~~i~~g~~~DviEiDaasn~gVd~IR~i~~~v~~~P~~~~y----------K  121 (563)
T PRK06674         52 TSIAKVFAKAVNCEHAPVAEPCNECPSCLGITNGSISDVLEIDAASNNGVDEIRDIRDKVKFAPSAVEY----------K  121 (563)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCE----------E
T ss_conf             999999999857999999887766878999855899877985255557879999999982648867873----------7


Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             321120114846997078753447999999999985680110799972
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
                      .+|.|-+   |+|-.        ..-|+++-.  +--+|..+.|+|+-
T Consensus       122 V~IIDea---h~Lt~--------~A~NALLKt--LEEPP~~viFILaT  156 (563)
T PRK06674        122 VYIIDEV---HMLSI--------GAFNALLKT--LEEPPGHVIFILAT  156 (563)
T ss_pred             EEEEECH---HHCCH--------HHHHHHHHH--HHCCCCCEEEEEEC
T ss_conf             9998545---63799--------999999998--63887564999965


No 435
>PRK10869 recombination and repair protein; Provisional
Probab=90.60  E-value=0.18  Score=29.08  Aligned_cols=33  Identities=9%  Similarity=0.148  Sum_probs=16.3

Q ss_pred             CEEEECCCCCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             468646898438999343898899999999984
Q gi|254780606|r  618 DMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKK  650 (744)
Q Consensus       618 d~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~  650 (744)
                      +|||.++.|.+.+--.--.|-.|+.||.=-+|.
T Consensus       413 efl~s~N~G~~~~pL~kiASGGElSRimLAlk~  445 (553)
T PRK10869        413 EFRVTTNPGQPLQPIAKVASGGELSRIALAIQV  445 (553)
T ss_pred             EEEEECCCCCCCCCHHHHCCHHHHHHHHHHHHH
T ss_conf             999952899997617776366089999999999


No 436
>COG4928 Predicted P-loop ATPase [General function prediction only]
Probab=90.57  E-value=0.51  Score=26.00  Aligned_cols=32  Identities=38%  Similarity=0.437  Sum_probs=15.1

Q ss_pred             CEEECCHHHCCCEEEE-ECCCCCHHHHHHHHHH
Q ss_conf             7321120114846997-0787534479999999
Q gi|254780606|r  403 ESVIADLANMPHILVA-GTTGSGKSVAINTMIM  434 (744)
Q Consensus       403 ~~~~~dl~~~PH~lva-G~TgsGKS~~l~~~i~  434 (744)
                      .-.+.+++..--+-|+ |.+|+|||.++|.+.-
T Consensus        42 ~ssI~~l~~~~~l~v~sG~wG~gKSt~~n~~~s   74 (646)
T COG4928          42 KSSICKLAPRGILVVASGEWGTGKSTLSNNLSS   74 (646)
T ss_pred             HHHHHHHCCCCCEEEECCCCCCCHHHHHHCCCC
T ss_conf             999886336876377405666650377643441


No 437
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=90.52  E-value=0.26  Score=28.04  Aligned_cols=37  Identities=22%  Similarity=0.323  Sum_probs=26.7

Q ss_pred             CCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             7887321120----1148469970787534479999999999
Q gi|254780606|r  400 ISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       400 ~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      -.|+.++-|+    .+.--+-|-|..|||||+++++| ++++
T Consensus        11 ~~~~~vL~~vsl~i~~Ge~~aliG~nGaGKSTLl~~i-~G~l   51 (273)
T PRK13547         11 RRHRAILRDLSLRIEPGRVTALLGRNGAGKSTLLKVL-AGEL   51 (273)
T ss_pred             ECCEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHH-HCCC
T ss_conf             9999999760889989989999999997699999999-5678


No 438
>PRK00254 ski2-like helicase; Provisional
Probab=90.40  E-value=0.56  Score=25.69  Aligned_cols=23  Identities=22%  Similarity=0.330  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHC----CEEEEEEEECC
Q ss_conf             999999996420----13589998516
Q gi|254780606|r  551 GAIQRLAQMARA----AGIHLIMATQR  573 (744)
Q Consensus       551 ~~~~~la~~~ra----~GihlilatQr  573 (744)
                      +..+-++|-||.    .|--+|+|...
T Consensus       361 e~~QM~GRAGR~G~D~~G~~iii~~~~  387 (717)
T PRK00254        361 EIQQMMGRAGRPKYDEVGEAIIVSTTE  387 (717)
T ss_pred             HHHHHHHHCCCCCCCCCCEEEEEECCC
T ss_conf             688862506999878885089995485


No 439
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=90.35  E-value=1.3  Score=23.12  Aligned_cols=29  Identities=24%  Similarity=0.352  Sum_probs=24.5

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             14846997078753447999999999985
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYR  439 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~  439 (744)
                      +.--+||.|..|+|||+|-+.++.+.|..
T Consensus        23 ~gs~~li~G~~GtGKsi~~~~~~~~~l~~   51 (230)
T PRK08533         23 FGSIILIEGDESTGKSILSQRLAYGFLQN   51 (230)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             98489998689987899999999999878


No 440
>PRK12678 transcription termination factor Rho; Provisional
Probab=90.33  E-value=1.3  Score=23.11  Aligned_cols=53  Identities=11%  Similarity=0.164  Sum_probs=41.8

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCC
Q ss_conf             01148469970787534479999999999856801107999723421000125
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYD  461 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~  461 (744)
                      +.|.-..||..-..+||+++|+.|.-++...|+--+|-++|||-.=-|-+.+.
T Consensus       408 iGkGQRgLIVapPkaGKT~ll~~ia~ai~~N~pe~~l~vlLiDERPEEVTdm~  460 (667)
T PRK12678        408 IGKGQRGLIVSPPKAGKTTILQDIANAITTNNPECHLMVVLVDERPEEVTDMQ  460 (667)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHH
T ss_conf             67884546757997872599999999998569972899997378851566766


No 441
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=90.22  E-value=0.33  Score=27.25  Aligned_cols=44  Identities=30%  Similarity=0.566  Sum_probs=29.9

Q ss_pred             CCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             887321120----114846997078753447999999999985680110799
Q gi|254780606|r  401 SGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       401 ~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      .+++++-|+    .+.-++.|.|..|||||++++. |++++   .|+.=+++
T Consensus        10 ~~~~il~~is~~i~~Ge~~~liG~nGsGKTTLl~~-i~G~~---~~~~G~I~   57 (180)
T cd03214          10 GGRTVLDDLSLSIEAGEIVGILGPNGAGKSTLLKT-LAGLL---KPSSGEIL   57 (180)
T ss_pred             CCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEEE
T ss_conf             99998804377886997999998999889999999-95798---99872899


No 442
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=90.17  E-value=0.35  Score=27.09  Aligned_cols=144  Identities=19%  Similarity=0.356  Sum_probs=67.2

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC------------CCCCCEEEEEEE--
Q ss_conf             120114846997078753447999999999985680110799972342100012------------577520000444--
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY------------DGIPHLLTPVVT--  472 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~------------~~~ph~~~~v~~--  472 (744)
                      +.+-+.-..+|.|-.|+|||+||+ ++++|+   +|+.=.++.   +|-..+.|            ..-|-|+..-|.  
T Consensus        24 l~v~~Ge~iaitGPSG~GKStllk-~va~Li---sp~~G~l~f---~Ge~vs~~~pea~Rq~VsY~~Q~paLfg~tVeDN   96 (223)
T COG4619          24 LSVRAGEFIAITGPSGCGKSTLLK-IVASLI---SPTSGTLLF---EGEDVSTLKPEAYRQQVSYCAQTPALFGDTVEDN   96 (223)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHH-HHHHCC---CCCCCEEEE---CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHC
T ss_conf             665388548876788766889999-998136---998852887---4733443485999999999972842146633223


Q ss_pred             ------------CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH-HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH
Q ss_conf             ------------417876899999986676999999807786799-9998864202677666543233867999844568
Q gi|254780606|r  473 ------------NPKKAVMALKWAVREMEERYRKMSHLSVRNIKS-YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA  539 (744)
Q Consensus       473 ------------~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~-~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a  539 (744)
                                  |++.+...|..+.  ...+  .+ ...+.++.+ -.++++-.         ..+..+|-|++ .||.-
T Consensus        97 lifP~~~r~rr~dr~aa~~llar~~--l~~~--~L-~k~it~lSGGE~QriAli---------R~Lq~~P~ILL-LDE~T  161 (223)
T COG4619          97 LIFPWQIRNRRPDRAAALDLLARFA--LPDS--IL-TKNITELSGGEKQRIALI---------RNLQFMPKILL-LDEIT  161 (223)
T ss_pred             CCCCHHHHCCCCCHHHHHHHHHHCC--CCHH--HH-CCHHHHCCCHHHHHHHHH---------HHHHCCCCEEE-ECCCH
T ss_conf             1142577536888679999998707--9646--64-140233166078999999---------98630774687-33714


Q ss_pred             HHHH-HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             7675-31035899999999964201358999851654
Q gi|254780606|r  540 DLMM-VAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       540 ~l~~-~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
                      .-.. ..+..+|.+|-++.+-   --+-.+--|--++
T Consensus       162 sALD~~nkr~ie~mi~~~v~~---q~vAv~WiTHd~d  195 (223)
T COG4619         162 SALDESNKRNIEEMIHRYVRE---QNVAVLWITHDKD  195 (223)
T ss_pred             HHCCHHHHHHHHHHHHHHHHH---HCEEEEEEECCHH
T ss_conf             333825688899999997004---2458999953858


No 443
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=90.17  E-value=1.4  Score=23.02  Aligned_cols=74  Identities=26%  Similarity=0.423  Sum_probs=44.6

Q ss_pred             EEEEHHHHHHHHHHCC-------HHHHHHHHH-HHHH---HHCCEEEEEEEECCCCCCCCHH-HHH-HCCCCEEEEECCC
Q ss_conf             9998445687675310-------358999999-9996---4201358999851654444146-788-5056305720368
Q gi|254780606|r  531 IVIIVDEMADLMMVAG-------KEIEGAIQR-LAQM---ARAAGIHLIMATQRPSVDVITG-TIK-ANFPIRISFQVTS  597 (744)
Q Consensus       531 ivvviDE~a~l~~~~~-------~~~e~~~~~-la~~---~ra~GihlilatQrp~~~vi~~-~ik-~n~~~ri~~~v~~  597 (744)
                      -+|+|||+-.+-..-+       .+-+..+.. |..|   ...-||-+|-||.||+  +|.. ++| .-|.-+|.+-..+
T Consensus       246 ~IIFIDEiDaig~~R~~~~~gg~~e~~~tlNqlL~EmDGf~~~~~ViviaATNrpd--~LD~ALlRPGRFDr~I~V~lPd  323 (644)
T PRK10733        246 CIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPD--VLDPALLRPGRFDRQVVVGLPD  323 (644)
T ss_pred             EEEEEECHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCC--CCCHHHHCCCCCCEEEEECCCC
T ss_conf             79999532203666789888983288878999999954888878769996269975--5477771688865599977989


Q ss_pred             HHHCCHHCC
Q ss_conf             111003267
Q gi|254780606|r  598 KIDSRTILG  606 (744)
Q Consensus       598 ~~dsr~il~  606 (744)
                      ..+=..||.
T Consensus       324 ~~~R~~ILk  332 (644)
T PRK10733        324 VRGREQILK  332 (644)
T ss_pred             HHHHHHHHH
T ss_conf             889999999


No 444
>pfam00350 Dynamin_N Dynamin family.
Probab=90.14  E-value=0.21  Score=28.60  Aligned_cols=21  Identities=33%  Similarity=0.550  Sum_probs=18.0

Q ss_pred             EEEEECCCCCHHHHHHHHHHH
Q ss_conf             699707875344799999999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMS  435 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~s  435 (744)
                      +.|.|.++||||.+||+|+-.
T Consensus         1 ivvvG~~ssGKSSliNALlG~   21 (168)
T pfam00350         1 IAVVGDQSAGKSSVLNALLGR   21 (168)
T ss_pred             CEEECCCCCCHHHHHHHHHCC
T ss_conf             989917889899999999788


No 445
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=90.13  E-value=0.26  Score=27.95  Aligned_cols=32  Identities=19%  Similarity=0.352  Sum_probs=26.2

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             73211201148469970787534479999999
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIM  434 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~  434 (744)
                      +-|-+++.+.-|+-|-|..|||||++|++|--
T Consensus        21 ~~Vnl~I~~GE~VaiIG~SGaGKSTLLR~lng   52 (258)
T COG3638          21 KDVNLEINQGEMVAIIGPSGAGKSTLLRSLNG   52 (258)
T ss_pred             EEEEEEECCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             35767757986899987888868999999866


No 446
>COG1855 ATPase (PilT family) [General function prediction only]
Probab=90.12  E-value=0.22  Score=28.49  Aligned_cols=27  Identities=30%  Similarity=0.401  Sum_probs=20.9

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             148469970787534479999999999
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      +.--.||||+.|+|||+|.+++---++
T Consensus       262 raeGILIAG~PGaGKsTFaqAlAefy~  288 (604)
T COG1855         262 RAEGILIAGAPGAGKSTFAQALAEFYA  288 (604)
T ss_pred             HHCCEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             416469956999974689999999998


No 447
>PRK13764 ATPase; Provisional
Probab=90.11  E-value=0.36  Score=26.99  Aligned_cols=27  Identities=30%  Similarity=0.401  Sum_probs=22.5

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             148469970787534479999999999
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      +.--+||+|+.|+|||+|-+++-.-+.
T Consensus       258 ~a~GilIaG~PGaGKsTfaqalA~~~~  284 (605)
T PRK13764        258 RAEGILIAGAPGAGKSTFAQALAEFYA  284 (605)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             366499977999977899999999998


No 448
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=90.06  E-value=0.29  Score=27.69  Aligned_cols=42  Identities=24%  Similarity=0.498  Sum_probs=29.3

Q ss_pred             CCCEEE----CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEE
Q ss_conf             887321----1201148469970787534479999999999856801107
Q gi|254780606|r  401 SGESVI----ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECR  446 (744)
Q Consensus       401 ~g~~~~----~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~  446 (744)
                      .|+.++    +++.+.-++.|.|.-|||||++|+. |++++   .|+.=+
T Consensus       330 ~~~~~l~~vsl~i~~Ge~ialvG~NGsGKSTLlk~-l~G~l---~p~~G~  375 (632)
T PRK11147        330 DGKQLVKDFSAQVQRGDKIALIGPNGCGKTTLLKL-MLGQL---QADSGR  375 (632)
T ss_pred             CCEEEEEEECCCCCCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCE
T ss_conf             99767765333357887799988988427799998-60666---899877


No 449
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=90.02  E-value=0.33  Score=27.31  Aligned_cols=57  Identities=23%  Similarity=0.379  Sum_probs=33.3

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCC
Q ss_conf             68984205788732112011484699707875344799999999998568011079997234
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK  453 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k  453 (744)
                      |....|...-=+-+-+++.+.-.+.+.|..|+|||++++. |++++   .|+.=.+ ..+.+
T Consensus        10 ls~~yg~~~vL~~vs~~i~~Gei~~LiGpNGaGKSTLlk~-I~Gl~---~p~~G~I-~~~~~   66 (251)
T PRK09544         10 VSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRV-VLGLV---APDEGVI-KRNGK   66 (251)
T ss_pred             EEEEECCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCCEE-EECCC
T ss_conf             8999999999963078987997999998999889999999-96688---8986089-99994


No 450
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=90.01  E-value=0.32  Score=27.36  Aligned_cols=49  Identities=24%  Similarity=0.434  Sum_probs=31.1

Q ss_pred             EEEEEEECCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEE
Q ss_conf             689842057887321120----114846997078753447999999999985680110799
Q gi|254780606|r  392 LALCLGKTISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMI  448 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~  448 (744)
                      |.+..|    ++.++-|+    .+.=.+-+.|-.|+|||++|++ |++++   .|+.=++.
T Consensus         8 ls~~yg----~~~~L~~isl~i~~Gei~~liGpNGaGKSTLlk~-i~Gl~---~p~sG~I~   60 (255)
T PRK11231          8 LTVGYG----TKRILNDLSLSLPTGKITALIGPNGCGKSTLLKC-FARLL---TPQSGTVF   60 (255)
T ss_pred             EEEEEC----CEEEEECCEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCCEEE
T ss_conf             999999----9999823088998997999999999819999999-97598---88864899


No 451
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=89.98  E-value=0.6  Score=25.48  Aligned_cols=30  Identities=27%  Similarity=0.491  Sum_probs=21.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             4699707875344799999999998568011079
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
                      .+-+.|..|||||++++. |++++   .|+.=++
T Consensus        28 i~gLiGpNGaGKSTLlk~-i~Gll---~P~~G~i   57 (255)
T cd03236          28 VLGLVGPNGIGKSTALKI-LAGKL---KPNLGKF   57 (255)
T ss_pred             EEEEECCCCCCHHHHHHH-HHCCC---CCCCCEE
T ss_conf             999989999709999999-96798---6887547


No 452
>TIGR01184 ntrCD nitrate ABC transporter, ATP-binding proteins C and D; InterPro: IPR005890   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase. ; GO: 0015112 nitrate transmembrane transporter activity, 0015706 nitrate transport, 0016020 membrane.
Probab=89.97  E-value=1.4  Score=23.02  Aligned_cols=145  Identities=21%  Similarity=0.370  Sum_probs=77.2

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-------CC-CCEECCCCCCCCEEEEEEECHHHHHHHH
Q ss_conf             114846997078753447999999999985680110799972-------34-2100012577520000444417876899
Q gi|254780606|r  410 ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-------PK-MLELSVYDGIPHLLTPVVTNPKKAVMAL  481 (744)
Q Consensus       410 ~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-------~k-~~~~~~~~~~ph~~~~v~~~~~~~~~~l  481 (744)
                      .+.--+-+-|-.|-|||++|| ||.+|-   .|..=.++|-.       |. |+-|-.|.-+|-  ..+-.|..-|+...
T Consensus         9 ~~GEFisliGHSGCGKSTLLN-li~Gl~---~P~~G~v~L~G~~i~~PGPdRMVVFQNYsLlPW--~tvr~NiaLAV~~v   82 (230)
T TIGR01184         9 RQGEFISLIGHSGCGKSTLLN-LISGLA---QPTSGGVILEGKQITEPGPDRMVVFQNYSLLPW--LTVRENIALAVDRV   82 (230)
T ss_pred             ECCCEEEEECCCCCCHHHHHH-HHHHCC---CCCCCCEEECCEECCCCCCCEEEEEECCCCCCH--HHHHHHHHHHHHHH
T ss_conf             267369985127861789999-985005---777761676262417876960478506200322--56888999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHH------------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHH-HHHHHHHCCHH
Q ss_conf             999986676999999807786799------------99988642026776665432338679998445-68767531035
Q gi|254780606|r  482 KWAVREMEERYRKMSHLSVRNIKS------------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDE-MADLMMVAGKE  548 (744)
Q Consensus       482 ~~~~~em~~r~~~~~~~~~~~i~~------------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE-~a~l~~~~~~~  548 (744)
                      ..-..+-|+|.-.-.+...-++..            -.+|++..+.         +.--|.+ ++.|| |-.|-.....+
T Consensus        83 ~~~~~~~E~~~iv~~~~~lVgL~~Aa~K~p~~lSGGMKQRVAIARa---------Ls~RP~~-LlLDEPFGALDAlTr~~  152 (230)
T TIGR01184        83 LRDLSKSERRAIVEEHIDLVGLREAADKRPGQLSGGMKQRVAIARA---------LSIRPKV-LLLDEPFGALDALTRGN  152 (230)
T ss_pred             HHHCCHHHHHHHHHHHHHHHCCHHHHCCCCHHCCCCHHHHHHHHHH---------HHHCCEE-EEEECCCCHHHHHHHHH
T ss_conf             8621354799999988864021234117800305842689999866---------5317601-23108740566752688


Q ss_pred             HHHHHHHHHHHHHCCEEEEEEEECC
Q ss_conf             8999999999642013589998516
Q gi|254780606|r  549 IEGAIQRLAQMARAAGIHLIMATQR  573 (744)
Q Consensus       549 ~e~~~~~la~~~ra~GihlilatQr  573 (744)
                      ..+.+.+|.+-.+   +-.|+-|--
T Consensus       153 LQe~L~~I~~e~~---~T~~MvTHD  174 (230)
T TIGR01184       153 LQEELLQIVEEAR---VTVVMVTHD  174 (230)
T ss_pred             HHHHHHHHHHHCC---CEEEEEECC
T ss_conf             9999999873169---748998524


No 453
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=89.97  E-value=1.4  Score=22.91  Aligned_cols=40  Identities=20%  Similarity=0.454  Sum_probs=26.5

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             11201148469970787534479999999999856801107999
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
                      -+++.+.--+-+.|--|+|||++++. |++++   .|+.=++.+
T Consensus        20 s~~v~~Gei~~llGpNGAGKSTll~~-i~Gl~---~p~~G~I~~   59 (232)
T cd03218          20 SLSVKQGEIVGLLGPNGAGKTTTFYM-IVGLV---KPDSGKILL   59 (232)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHH-HHCCC---CCCCEEEEE
T ss_conf             67989995999999999619999999-97799---998629999


No 454
>PRK13897 type IV secretion system component VirD4; Provisional
Probab=89.91  E-value=0.6  Score=25.47  Aligned_cols=84  Identities=30%  Similarity=0.400  Sum_probs=48.0

Q ss_pred             EEEECCCCCCCEEEHHHHHCCHHH-CCC--CCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             544268888870765875128121-146--78368984205788732112011484699707875344799999999998
Q gi|254780606|r  362 IGIELPNETRETVYLRQIIESRSF-SHS--KANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLY  438 (744)
Q Consensus       362 ~~~~~p~~~~~~v~~~~~~~~~~~-~~~--~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~  438 (744)
                      ++=--|+.+.+.++=.-=|.+..- +++  ..+--|.||++ .|..+..|  -.=|+|++|-|||||+|.+  +|-.||.
T Consensus       107 ~~~~~~~~~~e~l~G~ArwA~~~ei~kagL~~~~GiilG~~-~~~yL~~~--G~eHvLliAPTrSGKGvG~--VIPNLL~  181 (628)
T PRK13897        107 IKSWRPFKKKEKVHGDARWASEKDIRKAGLRSKKGMLLGKD-KGGYFVAD--GFQHALLFAPTGSGKGVGF--VIPNLLF  181 (628)
T ss_pred             HHCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCEEEEEC-CCCEEEEC--CCCEEEEECCCCCCCCCEE--ECCCCCC
T ss_conf             51157765344566530368877799737878881699852-89858726--8636999788999887279--8312157


Q ss_pred             HCCHHHEEEEEECCCC
Q ss_conf             5680110799972342
Q gi|254780606|r  439 RLRPDECRMIMVDPKM  454 (744)
Q Consensus       439 ~~~p~~~~~~liD~k~  454 (744)
                      .  ++  .++..|+|+
T Consensus       182 w--~~--S~VV~DpKG  193 (628)
T PRK13897        182 W--ED--SVVVHDIKL  193 (628)
T ss_pred             C--CC--CEEEEECCH
T ss_conf             9--99--889997767


No 455
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670   This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane.
Probab=89.90  E-value=0.2  Score=28.82  Aligned_cols=43  Identities=21%  Similarity=0.338  Sum_probs=25.9

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             6898420578873211201148469970787534479999999
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIM  434 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~  434 (744)
                      |.+..|.-..=+-|-.++.+.==.-+-|=+|+|||+||+||=.
T Consensus         7 l~~~YG~~~AL~~i~~~I~~n~vTAlIGPSGCGKSTlLR~lNR   49 (248)
T TIGR00972         7 LSLFYGEKEALKNINLDIPKNQVTALIGPSGCGKSTLLRSLNR   49 (248)
T ss_pred             EEEEECCEEEEECCCCEECCCEEEEEECCCCCCHHHHHHHHHH
T ss_conf             1266164178621562003770589877889867899999887


No 456
>COG1660 Predicted P-loop-containing kinase [General function prediction only]
Probab=89.83  E-value=0.26  Score=28.00  Aligned_cols=30  Identities=37%  Similarity=0.654  Sum_probs=23.6

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             4846997078753447999999999985680110799972
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
                      |.-++|.|..||||||.|+++          +++-++-+|
T Consensus         1 m~lvIVTGlSGAGKsvAl~~l----------EDlGyycvD   30 (286)
T COG1660           1 MRLVIVTGLSGAGKSVALRVL----------EDLGYYCVD   30 (286)
T ss_pred             CCEEEEECCCCCCHHHHHHHH----------HHCCEEEEC
T ss_conf             946999568887688999999----------745804535


No 457
>PRK05480 uridine kinase; Provisional
Probab=89.79  E-value=0.49  Score=26.08  Aligned_cols=33  Identities=33%  Similarity=0.464  Sum_probs=22.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             6997078753447999999999985680110799972
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
                      +.|||.+|||||.+-+.|.-.|    ....+.++=.|
T Consensus         9 IgIaG~SgSGKTT~a~~L~~~l----~~~~v~vi~~D   41 (209)
T PRK05480          9 IGIAGGSGSGKTTVASTIYEEL----GDESIAVISQD   41 (209)
T ss_pred             EEEECCCCCCHHHHHHHHHHHC----CCCCEEEEECC
T ss_conf             9998999778999999999980----86875999554


No 458
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=89.79  E-value=1.1  Score=23.62  Aligned_cols=44  Identities=16%  Similarity=0.194  Sum_probs=26.7

Q ss_pred             CCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECC
Q ss_conf             1201148469970787534479999999999856801107999723
Q gi|254780606|r  407 ADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDP  452 (744)
Q Consensus       407 ~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~  452 (744)
                      +++.+.-=+-+.|.-|||||++++. |++++ +-+.-.+.+.-.|.
T Consensus        21 ~~v~~Gei~gllG~NGaGKSTLl~~-i~Gl~-~p~~G~i~i~G~~~   64 (208)
T cd03268          21 LHVKKGEIYGFLGPNGAGKTTTMKI-ILGLI-KPDSGEITFDGKSY   64 (208)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHHH-HHCCC-CCCCCEEEECCEEC
T ss_conf             6886981999999999999999999-95783-78989999999999


No 459
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=89.78  E-value=1.5  Score=22.81  Aligned_cols=37  Identities=27%  Similarity=0.496  Sum_probs=24.2

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC
Q ss_conf             469970787534479999999999856801107999723421
Q gi|254780606|r  414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML  455 (744)
Q Consensus       414 H~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~  455 (744)
                      -+-|-|..|||||++|+. |.+++   .|+.=++ .+|-+.+
T Consensus        27 iv~liGpNGaGKSTLlk~-l~Gll---~p~~G~I-~~~g~~i   63 (246)
T cd03237          27 VIGILGPNGIGKTTFIKM-LAGVL---KPDEGDI-EIELDTV   63 (246)
T ss_pred             EEEEECCCCCHHHHHHHH-HHCCC---CCCCCEE-EECCCCC
T ss_conf             999997999769999999-97787---8886079-9898205


No 460
>CHL00095 clpC Clp protease ATP binding subunit
Probab=89.78  E-value=1.1  Score=23.65  Aligned_cols=60  Identities=23%  Similarity=0.308  Sum_probs=28.8

Q ss_pred             EEEEEEECCCCCEEECCHHH--CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHH---EEEEEEC
Q ss_conf             68984205788732112011--484699707875344799999999998568011---0799972
Q gi|254780606|r  392 LALCLGKTISGESVIADLAN--MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDE---CRMIMVD  451 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~--~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~---~~~~liD  451 (744)
                      |--++|+|-+=+-++.=|++  --.-++-|-.|-|||..+..+..-++...-|+.   .+++-+|
T Consensus       178 lDpvIGRd~EI~r~i~IL~RR~KNNpiLvGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~sLD  242 (823)
T CHL00095        178 LDPVIGRDKEIERVIQILGRRTKNNPILIGEPGVGKTAIAEGLAQRIANRDVPDILEDKLVLTLD  242 (823)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCCEEEEE
T ss_conf             99875956999999999977324885023799987999999999976088998687599368842


No 461
>KOG0054 consensus
Probab=89.75  E-value=0.21  Score=28.66  Aligned_cols=47  Identities=26%  Similarity=0.222  Sum_probs=25.8

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCC
Q ss_conf             4846997078753447999999999985680110799972342100012
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVY  460 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~  460 (744)
                      .-.+=|-|.||||||.+++++.. |.. ..-.++.+--+|-....|...
T Consensus      1166 ~eKVGIVGRTGaGKSSL~~aLFR-l~e-~~~G~I~IDgvdI~~igL~dL 1212 (1381)
T KOG0054        1166 GEKVGIVGRTGAGKSSLILALFR-LVE-PAEGEILIDGVDISKIGLHDL 1212 (1381)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHH-CCC-CCCCEEEECCEECCCCCHHHH
T ss_conf             97688868989988999999996-147-658759986865251768899


No 462
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]
Probab=89.71  E-value=1.4  Score=22.87  Aligned_cols=19  Identities=32%  Similarity=0.476  Sum_probs=9.1

Q ss_pred             CCCEEEEECCCCCHHHHHH
Q ss_conf             4846997078753447999
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAIN  430 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~  430 (744)
                      .-+.-+.|.-|+|||+||+
T Consensus        29 G~riGLvG~NGaGKSTLLk   47 (530)
T COG0488          29 GERIGLVGRNGAGKSTLLK   47 (530)
T ss_pred             CCEEEEECCCCCCHHHHHH
T ss_conf             9889998999898899999


No 463
>PRK11537 putative GTP-binding protein YjiA; Provisional
Probab=89.70  E-value=0.44  Score=26.43  Aligned_cols=225  Identities=12%  Similarity=0.128  Sum_probs=98.8

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEE--CCC----CCCCCEE-EEE-EECHHHHHHH
Q ss_conf             0114846997078753447999999999985680110799972342100--012----5775200-004-4441787689
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLEL--SVY----DGIPHLL-TPV-VTNPKKAVMA  480 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~--~~~----~~~ph~~-~~v-~~~~~~~~~~  480 (744)
                      +.|.|=.+|.|=-|||||+|||.|+..    ..-..+-+++=||..+..  ...    ..+--|- +.+ .+-.......
T Consensus         1 m~~IPVtiltGFLGaGKTTlL~~lL~~----~~~~riaVivNEfGev~iD~~li~~~~~~v~eL~nGCiCCs~~~dl~~~   76 (317)
T PRK11537          1 MNPIAVTLLTGFLGAGKTTLLRHILNE----QHGYKIAVIENEFGEVSVDDQLIGDRATQIKTLTNGCICCSRSNELEDA   76 (317)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHC----CCCCCEEEEEECCCCCCCHHHHHHCCCCCEEEECCCCEEEEECCHHHHH
T ss_conf             997688998308888999999999727----7899789998376145332988735653268844773687305228999


Q ss_pred             HHHHHHHHHH-----HHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             9999986676-----99999980778679999988642026776665432338679998445687675310358999999
Q gi|254780606|r  481 LKWAVREMEE-----RYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQR  555 (744)
Q Consensus       481 l~~~~~em~~-----r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~  555 (744)
                      |..+....++     -|-+..-.|+.+-...-+-+...      ......-.|.-+|.|||-..-.....  ...  + -
T Consensus        77 l~~l~~~~~~~~~~~D~IiIEtsGlAdP~~I~~~~~~~------~~l~~~~~Ld~vVtvVDa~~~~~~l~--~~~--~-~  145 (317)
T PRK11537         77 LLDLLDNLDRGNIQFDRLVIECTGMADPGPIIQTFFSH------EVLCQRYLLDGVIALVDAVHADEQMN--QFT--I-A  145 (317)
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH------HHHHHHEECCCEEEEEEHHHHHHHHH--CCH--H-H
T ss_conf             99999866435777547999625778839999998612------56565320365599986655576653--034--6-6


Q ss_pred             HHHHHHCCEEEEEEEECCCC-CCCCHHHHH-HCCCCEEEEECCCHHHCCHHCCCCCH---HHHCCCCCEEE-ECCC----
Q ss_conf             99964201358999851654-444146788-50563057203681110032676316---88568984686-4689----
Q gi|254780606|r  556 LAQMARAAGIHLIMATQRPS-VDVITGTIK-ANFPIRISFQVTSKIDSRTILGEHGA---EQLLGRGDMLY-MSGG----  625 (744)
Q Consensus       556 la~~~ra~GihlilatQrp~-~~vi~~~ik-~n~~~ri~~~v~~~~dsr~il~~~ga---e~l~g~gd~l~-~~~~----  625 (744)
                      ..|.+-| -+-|+==+..-+ .+.+...|+ -|-.++|.--+...+|...+|+..|.   +.+.....-+. ....    
T Consensus       146 ~~Qi~~A-D~illnK~Dlv~~~~~l~~~l~~lNp~A~i~~~~~~~v~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~i  224 (317)
T PRK11537        146 QSQVGYA-DRILLTKTDVAGEAEKLRERLARINARAPVYTVTHGDIDLGLLFNTNGFMLEENVVSTKPRFHFIADKQNDI  224 (317)
T ss_pred             HHHHHHC-CEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             7666318-689974200236599999999986899848996468789999848787884200167886667777545881


Q ss_pred             -CCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             -8438999343898899999999984
Q gi|254780606|r  626 -GRIQRVHGPLVSDIEIEKVVQHLKK  650 (744)
Q Consensus       626 -~~~~r~~~~~~~~~~~~~~~~~~~~  650 (744)
                       +-.++..++ ++-..+.+..+.+-.
T Consensus       225 ~s~~~~~~~p-~~~~~~~~~l~~ll~  249 (317)
T PRK11537        225 SSIVVELDYP-VDISEVSRVMENLLL  249 (317)
T ss_pred             EEEEEEECCC-CCHHHHHHHHHHHHH
T ss_conf             7999993898-987999999999987


No 464
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=89.69  E-value=0.35  Score=27.14  Aligned_cols=23  Identities=30%  Similarity=0.452  Sum_probs=19.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             69970787534479999999999
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLL  437 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~  437 (744)
                      +-|||.+|||||.+-+.|.-.|-
T Consensus         2 IgIaG~SgSGKTT~a~~L~~~l~   24 (179)
T cd02028           2 VGIAGPSGSGKTTFAKKLSNQLR   24 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHH
T ss_conf             89989897789999999999984


No 465
>KOG0057 consensus
Probab=89.66  E-value=0.37  Score=26.92  Aligned_cols=55  Identities=18%  Similarity=0.230  Sum_probs=38.3

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCC
Q ss_conf             2112011484699707875344799999999998568011079997234210001257
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDG  462 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~  462 (744)
                      +-+++-+.-.+-|.|..|||||.+||.++.=  +. -...+.+--+|-|.+.+.-+++
T Consensus       371 vsf~I~kGekVaIvG~nGsGKSTilr~LlrF