HHsearch alignment for GI: 254780606 and conserved domain: pfam00437

>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=96.51  E-value=0.002  Score=42.54  Aligned_cols=40  Identities=33%  Similarity=0.623  Sum_probs=27.8

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEE-CCCCC
Q ss_conf             484699707875344799999999998568011079997-23421
Q gi|254780606|r  412 MPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-DPKML  455 (744)
Q Consensus       412 ~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~li-D~k~~  455 (744)
T Consensus       139 ~~~ilIsG~TGSGKTT~l~all~~i----~~~~~riitiED~~El  179 (283)
T pfam00437       139 RGNILVSGGTGSGKTTLLYALLNEI----NTDDERIVTIEDPVEI  179 (283)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHC----CCCCCCEEEECCCCEE
T ss_conf             9759998899998899999999840----8777627873378523