HHsearch alignment for GI: 254780606 and conserved domain: pfam01580

>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive sequence similarity to wide variety of proteins from prokaryotes and plasmids, termed the FtsK/SpoIIIE family. This domain contains a putative ATP binding P-loop motif. It is found in the FtsK cell division protein from E. coli and the stage III sporulation protein E SpoIIIE which has roles in regulation of prespore specific gene expression in B. subtilis. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer.
Probab=100.00  E-value=0  Score=351.82  Aligned_cols=197  Identities=48%  Similarity=0.786  Sum_probs=179.2

Q ss_pred             HHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC
Q ss_conf             58751281211467836898420578873211201148469970787534479999999999856801107999723421
Q gi|254780606|r  376 LRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML  455 (744)
Q Consensus       376 ~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~  455 (744)
T Consensus         2 ~~~~~~~~~~~~~~~~l~vp~G~~~~G~pv~~dl~~~pH~Lv~G~tGsGKS~~l~~li~sl~~~~~p~~v~l~liD~K~~   81 (202)
T pfam01580         2 LKELLDGKPFRGSRSRLTIALGKDISGNPVVADLVKMPHLLIAGATGSGKSTFLNTLILSLAARHSPEEVRLYLIDPKGG   81 (202)
T ss_pred             HHHHCCCCCCCCCCCCCEEEEEECCCCCEEEEECCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             67861692001689961487776799998998635688689965899980099999999998737962069999748961


Q ss_pred             EECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEH
Q ss_conf             00012577520000444417876899999986676999999807786799999886420267766654323386799984
Q gi|254780606|r  456 ELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIV  535 (744)
Q Consensus       456 ~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvvi  535 (744)
T Consensus        82 ~~~~~~~~~h~~~~~~~d~e~~~~~l~~l~~em~rR~~ll~~~g~~~i~~~~~~~~~~~~~~----~~~~~~~p~ivvvi  157 (202)
T pfam01580        82 ELAALEDLPHLLSAVATDPEDALSALRALVAEMERRYALLKQLGVRSIEEYNGEIAEDILGG----AGWLEELPPIVVIV  157 (202)
T ss_pred             CHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC----CCCCCCCCCEEEEE
T ss_conf             26767635654433768999999999999999999999999838876899999866432124----55433478189864


Q ss_pred             HHHHHHHHHCCH----HHHHHHHHHHHHHHCCEEEEEEEECCCCC
Q ss_conf             456876753103----58999999999642013589998516544
Q gi|254780606|r  536 DEMADLMMVAGK----EIEGAIQRLAQMARAAGIHLIMATQRPSV  576 (744)
Q Consensus       536 DE~a~l~~~~~~----~~e~~~~~la~~~ra~GihlilatQrp~~  576 (744)
T Consensus       158 DE~~~l~~~~~~~~~~~~~~~l~~iar~GRa~GihlilatQrP~~  202 (202)
T pfam01580       158 DERAELMLAAPKDSEMRVEGALARLARMGRAAGIHLLLATQRPGV  202 (202)
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCC
T ss_conf             459999865550468999999999999887338299998189999