HHsearch alignment for GI: 254780606 and conserved domain: pfam08423

>pfam08423 Rad51 Rad51. Rad51 is a DNA repair and recombination protein and is a homologue of the bacterial ATPase RecA protein.
Probab=93.78  E-value=0.53  Score=25.86  Aligned_cols=46  Identities=17%  Similarity=0.335  Sum_probs=29.8

Q ss_pred             CEEEEEHHHHHHHHHHCC----------HHHHHHHHHHHHHHHCCEEEEEEEECCC
Q ss_conf             679998445687675310----------3589999999996420135899985165
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAG----------KEIEGAIQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~----------~~~e~~~~~la~~~ra~GihlilatQrp  574 (744)
T Consensus       138 ~v~LvVvDSiaalfR~e~~g~~~l~~R~~~L~~~l~~L~~lA~~~~~aVvvTNQV~  193 (261)
T pfam08423       138 RFALLIVDSATALYRTDFSGRGELAERQQHLAKFLRSLQRLADEFGVAVVITNQVV  193 (261)
T ss_pred             CCEEEEEECCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             83499983240023330036752899999999999999999998095899960479