RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780606|ref|YP_003065019.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] (744 letters) >gnl|CDD|182344 PRK10263, PRK10263, DNA translocase FtsK; Provisional. Length = 1355 Score = 492 bits (1268), Expect = e-139 Identities = 242/467 (51%), Positives = 326/467 (69%), Gaps = 19/467 (4%) Query: 290 LEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSL 349 LE+ A +E L +F IK +++N +PGPV+T +E APG+K++R+ L+ D+ARS+S++ Sbjct: 887 LEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTV 946 Query: 350 SARVA-VIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIAD 408 + RV VIP + +G+ELPN+ R+TVYLR+++++ F + + L + LGK I+GE V+AD Sbjct: 947 AVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVAD 1006 Query: 409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLT 468 LA MPH+LVAGTTGSGKSV +N MI+S+LY+ +P++ R IM+DPKMLELSVY+GIPHLLT Sbjct: 1007 LAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLT 1066 Query: 469 PVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERI--STMYGE-------KPQ 519 VVT+ K A AL+W V EME RY+ MS L VRN+ YNE+I + KP Sbjct: 1067 EVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLAGYNEKIAEADRMMRPIPDPYWKPG 1126 Query: 520 GCGDDMRP----MPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS 575 D P PYIV++VDE ADLMM GK++E I RLAQ ARAAGIHL++ATQRPS Sbjct: 1127 DSMDAQHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPS 1186 Query: 576 VDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQ--RVHG 633 VDVITG IKAN P RI+F V+SKIDSRTIL + GAE LLG GDMLY SG RVHG Sbjct: 1187 VDVITGLIKANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLY-SGPNSTLPVRVHG 1245 Query: 634 PLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVI 693 V D E+ VVQ K +G P+Y++ +T+D++++ FD E E L+ +AV V Sbjct: 1246 AFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGAGGFDGAE--ELDPLFDQAVQFVT 1303 Query: 694 DNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFS 740 + ++ S S +QR+ +IGYNRAA ++E+ME +G+VSE H G R V + Sbjct: 1304 EKRKASISGVQRQFRIGYNRAARIIEQMEAQGIVSEQGHNGNREVLA 1350 >gnl|CDD|150161 pfam09397, Ftsk_gamma, Ftsk gamma domain. This domain directs oriented DNA translocation and forms a winged helix structure. Mutated proteins with substitutions in the FtsK gamma DNA-recognition helix are impaired in DNA binding. Length = 67 Score = 96.8 bits (242), Expect = 2e-20 Identities = 31/55 (56%), Positives = 42/55 (76%) Query: 684 LYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHV 738 LY +AV+ VI+ Q+ STS +QRRL+IGYNRAA L+E+ME+EG+V A+ R V Sbjct: 8 LYDEAVEFVIETQKASTSLLQRRLRIGYNRAARLIEQMEEEGIVGPANGSKPREV 62 >gnl|CDD|129076 smart00843, Ftsk_gamma, This domain directs oriented DNA translocation and forms a winged helix structure. Mutated proteins with substitutions in the FtsK gamma DNA-recognition helix are impaired in DNA binding. Length = 63 Score = 96.3 bits (241), Expect = 3e-20 Identities = 30/56 (53%), Positives = 43/56 (76%) Query: 684 LYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVF 739 LY +AV+LVI+ Q+ STS +QRRL+IGYNRAA L++++E+EG+V A+ R V Sbjct: 6 LYDEAVELVIETQKASTSLLQRRLRIGYNRAARLIDQLEEEGIVGPANGSKPREVL 61 >gnl|CDD|150993 pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export. Length = 386 Score = 43.7 bits (104), Expect = 2e-04 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Query: 399 TISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK 453 TI+G + HIL+ GTTG+GK+ A+ ++ + R R D R I+ DP Sbjct: 3 TIAGVPLPRRSETQ-HILIVGTTGTGKTQALRELLDQI--RARGD--RAIIYDPT 52 >gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment. Length = 148 Score = 42.0 bits (98), Expect = 6e-04 Identities = 30/181 (16%), Positives = 59/181 (32%), Gaps = 45/181 (24%) Query: 414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTN 473 IL+ G GSGK+ T+ +L L P +I +D + + V D + ++ Sbjct: 4 VILIVGPPGSGKT----TLARALARELGPPGGGVIYIDGEDILEEVLDQLLLIIVGGKKA 59 Query: 474 PKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVI 533 + +R RK + V+ Sbjct: 60 SGSGEL----RLRLALALARK---------------------------------LKPDVL 82 Query: 534 IVDEMADLMMVAGKEIEGAIQR---LAQMARAAGIHLIMATQRPSVDVITGTIKANFPIR 590 I+DE+ L+ + + ++ L + + +I+ T D+ ++ F R Sbjct: 83 ILDEITSLLDAEQEALLLLLEELRLLLLLKSEKNLTVILTTNDEK-DLGPALLRRRFDRR 141 Query: 591 I 591 I Sbjct: 142 I 142 >gnl|CDD|163456 TIGR03744, traC_PFL_4706, conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves. Length = 893 Score = 38.9 bits (91), Expect = 0.004 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Query: 414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD 451 H+L+ G TG+GKS + ++M ++ RP R+ +V+ Sbjct: 477 HLLILGPTGAGKSATLTNLLMQVMAVHRP---RLFIVE 511 >gnl|CDD|131806 TIGR02759, TraD_Ftype, type IV conjugative transfer system coupling protein TraD. The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM). Length = 566 Score = 37.8 bits (88), Expect = 0.010 Identities = 20/38 (52%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Query: 414 HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD 451 HIL+ GTTGSGKSVA I LL +R R I+ D Sbjct: 178 HILIHGTTGSGKSVA----IRKLLRWIRQRGDRAIIYD 211 >gnl|CDD|163455 TIGR03743, SXT_TraD, conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains. Length = 634 Score = 34.2 bits (79), Expect = 0.11 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Query: 403 ESVIADLANMP-HILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPK 453 E V L + H LV GTTG GK+ +I + R + +I++DPK Sbjct: 166 EDVYLPLGHRVGHTLVLGTTGVGKTRLAELLITQDIRR---GDV-VIVIDPK 213 Score = 29.6 bits (67), Expect = 2.7 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Query: 522 GDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQ 572 G P I + VDE A+ + + IQ L R AG + ATQ Sbjct: 477 GIGKSKPPRINLHVDEAAEAIN------DPFIQ-LLNKGRGAGFQVTAATQ 520 >gnl|CDD|162997 TIGR02746, TraC-F-type, type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase. Length = 797 Score = 34.2 bits (79), Expect = 0.11 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 415 ILVAGTTGSGKSVAINTMIMSLL 437 I V G +G+GKS + +I+ L Sbjct: 433 IAVVGGSGAGKSFFMQELIVDNL 455 >gnl|CDD|184357 PRK13873, PRK13873, conjugal transfer ATPase TrbE; Provisional. Length = 811 Score = 33.7 bits (78), Expect = 0.17 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 414 HILVAGTTGSGKSVAINTMIM 434 H LV G TG+GKSV + M + Sbjct: 443 HTLVVGPTGAGKSVLLALMAL 463 >gnl|CDD|183479 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional. Length = 400 Score = 32.9 bits (75), Expect = 0.29 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 9/80 (11%) Query: 294 AGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARV 353 LE I++ F G+ V PGP + Y EPA G+ S L ++ ++ + S + Sbjct: 159 PERLEEIIDAFA-AGKGPVVKPGPQIGRYASEPAGGLTS-----LTEEAGKARYNASKAL 212 Query: 354 AV---IPKRNAIGIELPNET 370 A + G E+P Sbjct: 213 AEDIGDTVKRIDGTEVPLLA 232 >gnl|CDD|162351 TIGR01420, pilT_fam, pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation. Length = 343 Score = 32.3 bits (74), Expect = 0.48 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Query: 405 VIADLANMPH--ILVAGTTGSGKSVAINTMI 433 V+ +LA P ILV G TGSGKS + +MI Sbjct: 113 VLRELAERPRGLILVTGPTGSGKSTTLASMI 143 >gnl|CDD|184377 PRK13894, PRK13894, conjugal transfer ATPase TrbB; Provisional. Length = 319 Score = 31.6 bits (72), Expect = 0.75 Identities = 14/31 (45%), Positives = 21/31 (67%) Query: 403 ESVIADLANMPHILVAGTTGSGKSVAINTMI 433 E++IA + +ILV G TGSGK+ +N +I Sbjct: 139 EAIIAAVRAHRNILVIGGTGSGKTTLVNAII 169 >gnl|CDD|183503 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed. Length = 337 Score = 31.1 bits (71), Expect = 1.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Query: 406 IADLANMPHILVAGTTGSGKSVAI 429 D N+PH+LV G GSGK+ A+ Sbjct: 30 AVDSPNLPHLLVQGPPGSGKTAAV 53 >gnl|CDD|162543 TIGR01813, flavo_cyto_c, flavocytochrome c. This model describes a family of redox proteins related to the succinate dehydrogenases and fumarate reductases of E. coli, mitochondria, and other well-characterized systems. A member of this family from Shewanella frigidimarina NCIMB400 is characterized as a water-soluble periplasmic protein with four heme groups, a non-covalently bound FAD, and essentially unidirectional fumarate reductase activity. At least seven distinct members of this family are found in Shewanella oneidensis, a species able to use a wide variety of pathways for respiraton. Length = 439 Score = 30.8 bits (70), Expect = 1.2 Identities = 30/102 (29%), Positives = 40/102 (39%), Gaps = 11/102 (10%) Query: 603 TILGEHGAE--QLLGRG-----DMLYMSGGGRIQRVH---GPLVSDIEI-EKVVQHLKKQ 651 IL E A+ L G D L GG + R H G S EI +K+ + KK+ Sbjct: 84 RILAEESADAVDWLQDGVGARLDDLIQLGGHSVPRAHRPTGGAGSGAEIVQKLYKKAKKE 143 Query: 652 GCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVI 693 G LN+ D D G K + +Y KA V+ Sbjct: 144 GIDTRLNSKVEDLIQDDQGTVVGVVVKGKGKGIYIKAAKAVV 185 >gnl|CDD|180064 PRK05416, PRK05416, glmZ(sRNA)-inactivating NTPase; Provisional. Length = 288 Score = 30.8 bits (71), Expect = 1.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 410 ANMPHILVAGTTGSGKSVAINTM 432 A M ++V G +G+GKSVA+ + Sbjct: 4 APMRLVIVTGLSGAGKSVALRAL 26 >gnl|CDD|180621 PRK06556, PRK06556, vitamin B12-dependent ribonucleotide reductase; Validated. Length = 953 Score = 30.7 bits (70), Expect = 1.4 Identities = 19/64 (29%), Positives = 24/64 (37%), Gaps = 21/64 (32%) Query: 668 KDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQ-------------RRLQIGY-NR 713 +D FD E + AV+LVI S F R+L +GY N Sbjct: 381 RDDGTFDVE-------SFRHAVELVITAMEISICFADFPTEKIARNTRAFRQLGLGYANL 433 Query: 714 AALL 717 ALL Sbjct: 434 GALL 437 >gnl|CDD|149599 pfam08601, PAP1, Transcription factor PAP1. The transcription factor Pap1 regulates antioxidant-gene transcription in response to H2O2. This region is cysteine rich. Alkylation of cysteine residues following treatment with a cysteine alkylating agent can mask the accessibility of the nuclear exporter Crm1, triggering nuclear accumulation and Pap1 dependent transcriptional expression. Length = 344 Score = 30.7 bits (69), Expect = 1.4 Identities = 31/189 (16%), Positives = 54/189 (28%), Gaps = 19/189 (10%) Query: 82 STSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKNGSHPDP------NMQKETIEPS 135 S + L ++ N NS +D +S L+ G+ P+P + P+ Sbjct: 108 SPNGLQSSATQYNSNDNSSSDSPSSGSDGFTNQLLSSLGTSPEPSTESPPQLASVNNFPA 167 Query: 136 LDVIEEVNTDTASNVSDQINQNPDTLSWLSDFAFFEGLSTPHSFLSF------NDHHQYT 189 + E N++ S S P+ AF G P F + N + Sbjct: 168 IRNNAESNSNVPSAAS----STPNIPGIDFLLAFPGGQFDPELFGDYREPQDANLSDDFD 223 Query: 190 PIP-IQSAEDLSDHTDLAPHMSTEYLHNKKIRTDSTPTTAGDQQKKSSIDHKPSSSNTMT 248 P + D L+P + + + P KK D + Sbjct: 224 PNGLFNDEFSMPDP--LSPFHFNDKDYLSPSPDEGPPDAQVAGPKKDLADQIDNQDEDEE 281 Query: 249 EHMFQDTSQ 257 + Sbjct: 282 VVVPSKEDT 290 >gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily. Length = 201 Score = 30.5 bits (69), Expect = 1.6 Identities = 28/169 (16%), Positives = 64/169 (37%), Gaps = 43/169 (25%) Query: 409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLT 468 L+ + +++A TGSGK++A ++ L L+ + + + Sbjct: 21 LSGLRDVILAAPTGSGKTLA---ALLPALEALKRGKGKRV-------------------- 57 Query: 469 PVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYN--ERISTMYGEKPQ------G 520 +V P + + A +WA E+++ + V + E++ + K G Sbjct: 58 -LVLVPTREL-AEQWA-EELKKLGPSLGLKVVGLYGGDSKREQLRKLESGKTDILVTTPG 114 Query: 521 CGDDMRPMP------YIVIIVDEMADLM--MVAGKEIEGAIQRLAQMAR 561 D+ ++I+DE A + G ++E ++ L + + Sbjct: 115 RLLDLLENDLLELSNVDLVILDE-AHRLLDGGFGDQLEKLLKLLPKNVQ 162 >gnl|CDD|178596 PLN03025, PLN03025, replication factor C subunit; Provisional. Length = 319 Score = 30.5 bits (69), Expect = 1.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 399 TISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLL 437 +S VIA NMP+++++G G+GK+ +I + LL Sbjct: 21 AVSRLQVIARDGNMPNLILSGPPGTGKTTSILALAHELL 59 >gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase. Members of this family are the enzyme glucose-1-phosphate cytidylyltransferase, also called CDP-glucose pyrophosphorylase, the product of the rfbF gene. Length = 254 Score = 30.5 bits (69), Expect = 1.7 Identities = 20/92 (21%), Positives = 37/92 (40%), Gaps = 18/92 (19%) Query: 585 ANFPIRISFQVTSKIDSRTILGEHGAE----QLLGRGDMLYMSGGGRIQRV--------- 631 AN+ + +S D+ + E L+ G+ GGR++RV Sbjct: 64 ANYFLHMSDVTFHMADNTMEVHHKRVEPWRVTLVDTGES--TQTGGRLKRVREYLDDEAF 121 Query: 632 ---HGPLVSDIEIEKVVQHLKKQGCPEYLNTV 660 +G V+DI+I+ ++ +K G + V Sbjct: 122 CFTYGDGVADIDIKALIAFHRKHGKKATVTAV 153 >gnl|CDD|163531 TIGR03819, heli_sec_ATPase, helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer. Length = 340 Score = 30.4 bits (69), Expect = 1.8 Identities = 15/37 (40%), Positives = 26/37 (70%), Gaps = 5/37 (13%) Query: 415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD 451 L++G TGSGK+ T++ +LL + PDE R+++V+ Sbjct: 181 FLISGGTGSGKT----TLLSALLALVAPDE-RIVLVE 212 >gnl|CDD|131585 TIGR02533, type_II_gspE, general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis. Length = 486 Score = 30.0 bits (68), Expect = 2.0 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 7/47 (14%) Query: 409 LANMPH--ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMV-DP 452 L PH ILV G TGSGK+ T + + L RL E ++ V DP Sbjct: 237 LIRRPHGIILVTGPTGSGKT----TTLYAALSRLNTPERNILTVEDP 279 >gnl|CDD|162115 TIGR00929, VirB4_CagE, type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation). Length = 785 Score = 30.0 bits (68), Expect = 2.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 414 HILVAGTTGSGKSVAINTMIMSLL 437 H L+ G TGSGK+ +N ++ + Sbjct: 436 HTLIFGPTGSGKTTLLNFLLAQMQ 459 >gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional. Length = 263 Score = 29.1 bits (65), Expect = 4.5 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 13/52 (25%) Query: 294 AGSLETILEEFGIKGEIIN-VNPGPVVTLYEFEPAPGIKSSRVIGLADDIAR 344 AG + T+ +E G KG +N + PG I++ RVI LA D A+ Sbjct: 165 AGLVRTLAKELGPKGITVNGIMPGI------------IRTDRVIQLAQDRAK 204 >gnl|CDD|114590 pfam05872, DUF853, Bacterial protein of unknown function (DUF853). This family consists of several bacterial proteins of unknown function. One member from Brucella melitensis is thought to be an ATPase. Length = 504 Score = 28.9 bits (65), Expect = 4.7 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 407 ADLANMPHILVAGTTGSGKSVAINTMIMSL 436 +AN H L+AG TG+GK+V + + S Sbjct: 17 LGMANR-HGLIAGATGTGKTVTLQVLAESF 45 >gnl|CDD|182878 PRK10976, PRK10976, putative hydrolase; Provisional. Length = 266 Score = 28.9 bits (65), Expect = 4.9 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Query: 562 AAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTS 597 A GIH + AT R VDV G I+ N I+ S+ +TS Sbjct: 33 ARGIHFVFATGRHHVDV--GQIRDNLEIK-SYMITS 65 >gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional. Length = 257 Score = 28.8 bits (65), Expect = 5.9 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Query: 290 LEKNAGSLETILEEFGIKGEIINVNPGPVVTLY 322 LE A ++ L+ FGI+ + VNPGP +T + Sbjct: 152 LEAIAEAMHAELKPFGIQ--VATVNPGPYLTGF 182 >gnl|CDD|180573 PRK06460, PRK06460, hypothetical protein; Provisional. Length = 376 Score = 28.6 bits (64), Expect = 6.1 Identities = 33/128 (25%), Positives = 54/128 (42%), Gaps = 18/128 (14%) Query: 344 RSMSSLSARVAVIPKRNAIGI-ELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISG 402 R + +L R+ VI RNA I E + V ++ SH +A + K G Sbjct: 235 RGIKTLKIRMDVI-NRNAEQIAEFLEGHPKVV---KVYYPGLKSHVDYEIARRVLKGFGG 290 Query: 403 ----------ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYR-LRPDECRMIMVD 451 ES + + ++ I+ A T G SV + MS +R L +E +++ + Sbjct: 291 VLSFEVNGGQESALKVMKSLKLIIPAQTLGGVNSVISHPATMS--HRTLSLEERKIVGIT 348 Query: 452 PKMLELSV 459 +L LSV Sbjct: 349 DSLLRLSV 356 >gnl|CDD|182509 PRK10513, PRK10513, sugar phosphate phosphatase; Provisional. Length = 270 Score = 28.5 bits (64), Expect = 6.5 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query: 528 MPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDV 578 M +I +D M +++ I A+++ ARA G+++++ T RP V Sbjct: 1 MAIKLIAID-MDGTLLLPDHTISPAVKQAIAAARAKGVNVVLTTGRPYAGV 50 >gnl|CDD|182459 PRK10436, PRK10436, hypothetical protein; Provisional. Length = 462 Score = 28.0 bits (63), Expect = 8.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Query: 415 ILVAGTTGSGKSVAINTMIMSLLYRLRPD 443 ILV G TGSGK+V T+ +L Sbjct: 221 ILVTGPTGSGKTV---TLYSALQTLNTAQ 246 >gnl|CDD|179026 PRK00440, rfc, replication factor C small subunit; Reviewed. Length = 319 Score = 27.9 bits (63), Expect = 8.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Query: 411 NMPHILVAGTTGSGKSVA 428 NMPH+L AG G+GK+ A Sbjct: 37 NMPHLLFAGPPGTGKTTA 54 >gnl|CDD|181240 PRK08126, PRK08126, hypothetical protein; Provisional. Length = 432 Score = 28.1 bits (63), Expect = 9.3 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Query: 616 RGDMLYMSGGGRIQRVHGPLVSDI--EIEKV 644 RGD +++ G + GPL++ I EI +V Sbjct: 322 RGDAMFVPGQATVNPAMGPLIAKIAREIARV 352 >gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional. Length = 1294 Score = 27.7 bits (62), Expect = 9.7 Identities = 22/99 (22%), Positives = 38/99 (38%), Gaps = 31/99 (31%) Query: 338 LADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLG 397 +A +IA++ + R A P+ I P E+ S K ++ Sbjct: 46 IAKEIAQAAQRVLLREAARPE-----ITYP-------------ENLPVSQKKQDIL---- 83 Query: 398 KTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSL 436 + I V+ +VAG TGSGK+ + + + L Sbjct: 84 EAIRDHQVV---------IVAGETGSGKTTQLPKICLEL 113 >gnl|CDD|166874 PRK00257, PRK00257, erythronate-4-phosphate dehydrogenase; Validated. Length = 381 Score = 27.7 bits (62), Expect = 10.0 Identities = 11/58 (18%), Positives = 15/58 (25%) Query: 15 PHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQPKETEHSIGDYLH 72 Q+DL + P L V R + R QQ + Y Sbjct: 294 WLAQIDLDASADPAWALATLCRAVYDPRRDDAAFRRSLTGDVAQQRAAFDALRKHYPL 351 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.131 0.372 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 11,895,050 Number of extensions: 774628 Number of successful extensions: 1773 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1769 Number of HSP's successfully gapped: 47 Length of query: 744 Length of database: 5,994,473 Length adjustment: 101 Effective length of query: 643 Effective length of database: 3,812,065 Effective search space: 2451157795 Effective search space used: 2451157795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 61 (27.3 bits)