HHsearch alignment of GI: 254780607 and MMDB domain: 3gi7_A_

>3gi7_A (A:) Secreted protein of unknown function DUF1311; NP_742474.1, structural genomics, joint center for structural genomics, JCSG; 1.85A {Pseudomonas putida KT2440}
Probab=99.92  E-value=3.4e-24  Score=162.95  Aligned_cols=113  Identities=18%  Similarity=0.359  Sum_probs=102.9

Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             31012202378899899999999999999999999999999732------935689999999999999999788755124
Q gi|254780607|r   15 AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------EKHQRELFEKSQMAWEIYRGSECAFAASGA   88 (131)
Q Consensus        15 s~~a~a~dC~~a~t~~e~~~C~~~~~~~ad~~Ln~~y~~l~~~l------~~~~~~~L~~sQr~W~~~R~~~C~~~~~~~   88 (131)
                      ++.++++||.++.|+.+|++|+...++.+|++||++|+.+++.+      ++..++.|+.+|++|++||+++|.++...+
T Consensus         2 ~a~~~~~dC~~a~s~~e~~~C~~~~~~~~D~~Ln~~Y~~~~~~~~~~~~~~~~~~~~L~~sQraW~~~R~~~c~~~~~~~   81 (122)
T 3gi7_A            2 ADEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERXRDQFGDEAGLXSRIEAAEKVWSQLRDADCKVETHAE   81 (122)
T ss_dssp             ----------CTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSCTTHHHHHHHHHHHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             76657899899998499999988999999999999999999872202212488999999999999999998888865022


Q ss_pred             CCCCH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             68835-67999999999999999999997137236758899
Q gi|254780607|r   89 EEGTA-QSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF  128 (131)
Q Consensus        89 ~~Gs~-~~~~~~~C~~~~t~~R~~eL~~~l~~~eg~~~~~~  128 (131)
                      .+|++ +++.+.+|+.++|++||.+|+.|+++. |+.+||-
T Consensus        82 ~~gs~~~~~~~~~C~~~~t~~Ri~eL~~~~~~~-~~~~~p~  121 (122)
T 3gi7_A           82 QPGSNAYQIAWNSCIAQRSDERAEYLRSLGSQN-SDEPAPE  121 (122)
T ss_dssp             CTTSHHHHHHHHHHHHHHHHHHHHHHHHHHTCC--------
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCC
T ss_conf             589767889999999999999999999987046-7899999