BLAST/PSIBLAST alignment of GI: 254780607 and GI: 123442042 at iteration 1
>gi|123442042|ref|YP_001006025.1| hypothetical protein YE1744 [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 129
>gi|122089003|emb|CAL11817.1| putative exported protein [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 129
 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (55%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    Q
Sbjct: 4   KKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVAQ 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C EG
Sbjct: 64  RPLLKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSEG 123

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 124 DLSCPL 129