BLAST/PSIBLAST alignment of GI: 254780607 and GI: 261339324 at iteration 1
>gi|261339324|ref|ZP_05967182.1| hypothetical protein ENTCAN_05568 [Enterobacter cancerogenus ATCC 35316] Length = 131
>gi|288319187|gb|EFC58125.1| putative periplasmic protein [Enterobacter cancerogenus ATCC 35316] Length = 131
 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 69/126 (54%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           + ++ A   +  +  ++A  C     QADMN CT   +    +KL  TY+ V+++ +  Q
Sbjct: 2   KPLLIAGAALLFSTSALADVCASANTQADMNSCTAQQYQAADKKLNQTYQTVMKRADAAQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + L +K+Q AW + R ++CAFAASG+  G+ Q MI   CL     ER   L S + C EG
Sbjct: 62  QPLLKKAQQAWIVLRDADCAFAASGSAGGSVQPMIANQCLAEKTTEREAYLASLMQCEEG 121

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 122 DLSCPL 127