BLAST/PSIBLAST alignment of GI: 254780607 and GI: 283833727 at iteration 1
>gi|283833727|ref|ZP_06353468.1| putative periplasmic protein [Citrobacter youngae ATCC 29220] Length = 131
>gi|291070385|gb|EFE08494.1| putative periplasmic protein [Citrobacter youngae ATCC 29220] Length = 131
 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 68/126 (53%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++I+     + ++ Q++A +C     QA+MN C    F     KL  TY+  L++    Q
Sbjct: 2   KRIVLTCAALLLSGQALADDCASANTQAEMNTCAAEQFKAADAKLNETYQNALKRAAPPQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R+L +K+Q +W   R ++CA  +SG E G+ Q+MI + CL     ER   L S L C EG
Sbjct: 62  RDLLKKAQTSWISLRDADCALISSGTEGGSVQAMISSQCLTDKTNEREAFLASLLQCEEG 121

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 122 DLSCPL 127