BLAST/PSIBLAST alignment of GI: 254780607 and GI: 318606086 at iteration 1
>gi|318606086|emb|CBY27584.1| putative periplasmic protein [Yersinia enterocolitica subsp. palearctica Y11] Length = 140
>gi|330861150|emb|CBX71411.1| hypothetical protein YEW_BD05780 [Yersinia enterocolitica W22703] Length = 140
 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (55%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    Q
Sbjct: 15  KKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVAQ 74

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C EG
Sbjct: 75  RPLLKSAQLIWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSEG 134

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 135 DLSCPL 140