BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780607|ref|YP_003065020.1| hypothetical protein
CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62]
         (131 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040284|gb|ACT57080.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 131

 Score =  271 bits (693), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK
Sbjct: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP
Sbjct: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120

Query: 121 EGDLLCPFINN 131
           EGDLLCPFINN
Sbjct: 121 EGDLLCPFINN 131


>gi|238789061|ref|ZP_04632850.1| hypothetical protein yfred0001_41930 [Yersinia frederiksenii ATCC
           33641]
 gi|238722825|gb|EEQ14476.1| hypothetical protein yfred0001_41930 [Yersinia frederiksenii ATCC
           33641]
          Length = 128

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 71/128 (55%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI+    +I    Q++A++C   + Q DMNQC    +     +L  TYK+VL K   
Sbjct: 1   MLKKIMLVSLLIFPVSQALAVDCKNAMTQLDMNQCANADYKKADAELNRTYKEVLAKTPM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q+ W  +R ++C F AS  E G+   MI + CL     ER  +L+SYL CP
Sbjct: 61  VQRALLKSAQLTWIKFRDADCTFQASATEGGSVHPMIISACLTRKTEERIAQLKSYLNCP 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|123442042|ref|YP_001006025.1| hypothetical protein YE1744 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089003|emb|CAL11817.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 129

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (55%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    Q
Sbjct: 4   KKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVAQ 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C EG
Sbjct: 64  RPLLKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSEG 123

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 124 DLSCPL 129


>gi|332162045|ref|YP_004298622.1| hypothetical protein YE105_C2423 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666275|gb|ADZ42919.1| hypothetical protein YE105_C2423 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 129

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (55%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    Q
Sbjct: 4   KKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVAQ 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C EG
Sbjct: 64  RPLLKSAQLIWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSEG 123

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 124 DLSCPL 129


>gi|238798075|ref|ZP_04641563.1| hypothetical protein ymoll0001_17410 [Yersinia mollaretii ATCC
           43969]
 gi|238718055|gb|EEQ09883.1| hypothetical protein ymoll0001_17410 [Yersinia mollaretii ATCC
           43969]
          Length = 128

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 71/128 (55%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI+    ++    Q +AL+C+  + Q +MNQC  + +     +L   YK+VL K   
Sbjct: 1   MLKKIMLISLLVLPISQVLALDCHNAVTQMEMNQCANSDYKSADTELNRIYKQVLVKTSV 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L CP
Sbjct: 61  AQRPLLKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTQKTEERTTQLKSFLNCP 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|318606086|emb|CBY27584.1| putative periplasmic protein [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|330861150|emb|CBX71411.1| hypothetical protein YEW_BD05780 [Yersinia enterocolitica W22703]
          Length = 140

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (55%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    Q
Sbjct: 15  KKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVAQ 74

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C EG
Sbjct: 75  RPLLKSAQLIWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSEG 134

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 135 DLSCPL 140


>gi|261339324|ref|ZP_05967182.1| hypothetical protein ENTCAN_05568 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319187|gb|EFC58125.1| putative periplasmic protein [Enterobacter cancerogenus ATCC 35316]
          Length = 131

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 69/126 (54%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           + ++ A   +  +  ++A  C     QADMN CT   +    +KL  TY+ V+++ +  Q
Sbjct: 2   KPLLIAGAALLFSTSALADVCASANTQADMNSCTAQQYQAADKKLNQTYQTVMKRADAAQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + L +K+Q AW + R ++CAFAASG+  G+ Q MI   CL     ER   L S + C EG
Sbjct: 62  QPLLKKAQQAWIVLRDADCAFAASGSAGGSVQPMIANQCLAEKTTEREAYLASLMQCEEG 121

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 122 DLSCPL 127


>gi|238762255|ref|ZP_04623227.1| hypothetical protein ykris0001_1720 [Yersinia kristensenii ATCC
           33638]
 gi|238699602|gb|EEP92347.1| hypothetical protein ykris0001_1720 [Yersinia kristensenii ATCC
           33638]
          Length = 129

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 58/107 (54%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           NC   + Q DMNQC  + +     +L  TYK+VL K    QR L + +Q  W  YR ++C
Sbjct: 23  NCQNAVTQQDMNQCATSDYKKADTELNRTYKEVLAKTSVGQRALLKSAQQTWIKYRDADC 82

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
            F +S  E G+   MI + CL     ER   L+S+L CPEGDL CP 
Sbjct: 83  TFQSSATEGGSVHPMIISACLTHKTEERTTHLKSFLNCPEGDLSCPL 129


>gi|204930708|ref|ZP_03221581.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320167|gb|EDZ05371.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 131

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 69/127 (54%), Gaps = 3/127 (2%)

Query: 4   KIIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           K IF LT  A+ F S AL   C     Q +MN+C    +    +KL  TY+  L++ +  
Sbjct: 2   KRIF-LTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ QSMI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQSMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 121 GDLSCPL 127


>gi|283833727|ref|ZP_06353468.1| putative periplasmic protein [Citrobacter youngae ATCC 29220]
 gi|291070385|gb|EFE08494.1| putative periplasmic protein [Citrobacter youngae ATCC 29220]
          Length = 131

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 68/126 (53%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++I+     + ++ Q++A +C     QA+MN C    F     KL  TY+  L++    Q
Sbjct: 2   KRIVLTCAALLLSGQALADDCASANTQAEMNTCAAEQFKAADAKLNETYQNALKRAAPPQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R+L +K+Q +W   R ++CA  +SG E G+ Q+MI + CL     ER   L S L C EG
Sbjct: 62  RDLLKKAQTSWISLRDADCALISSGTEGGSVQAMISSQCLTDKTNEREAFLASLLQCEEG 121

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 122 DLSCPL 127


>gi|16764480|ref|NP_460095.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167993697|ref|ZP_02574791.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168264107|ref|ZP_02686080.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197264332|ref|ZP_03164406.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244474|ref|YP_002215053.1| hypothetical protein SeD_A1197 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|16419638|gb|AAL20054.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197242587|gb|EDY25207.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197938990|gb|ACH76323.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205328287|gb|EDZ15051.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205347389|gb|EDZ34020.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|261246336|emb|CBG24145.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992883|gb|ACY87768.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157665|emb|CBW17157.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912110|dbj|BAJ36084.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321223738|gb|EFX48801.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323129392|gb|ADX16822.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326622806|gb|EGE29151.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332988015|gb|AEF06998.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 131

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 67/126 (53%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++I      + I+ Q++A  C     Q +MN+C    +    +KL  TY+  L++ +  Q
Sbjct: 2   KRIFLTCAALLISSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPPQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           REL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C EG
Sbjct: 62  RELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEG 121

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 122 DLSCPL 127


>gi|168237187|ref|ZP_02662245.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168243922|ref|ZP_02668854.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194451889|ref|YP_002045122.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194736498|ref|YP_002114121.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197250924|ref|YP_002145992.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|194410193|gb|ACF70412.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194712000|gb|ACF91221.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197214627|gb|ACH52024.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197289862|gb|EDY29223.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|205337100|gb|EDZ23864.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|322616493|gb|EFY13402.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619745|gb|EFY16620.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622560|gb|EFY19405.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629711|gb|EFY26486.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632569|gb|EFY29315.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636936|gb|EFY33639.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641526|gb|EFY38164.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644827|gb|EFY41361.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649691|gb|EFY46122.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654009|gb|EFY50332.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658542|gb|EFY54804.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663399|gb|EFY59601.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670133|gb|EFY66273.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674802|gb|EFY70893.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676727|gb|EFY72794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682650|gb|EFY78669.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686330|gb|EFY82312.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195712|gb|EFZ80888.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199860|gb|EFZ84949.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202853|gb|EFZ87889.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209123|gb|EFZ94060.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212404|gb|EFZ97222.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217917|gb|EGA02632.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222204|gb|EGA06588.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226726|gb|EGA10920.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229719|gb|EGA13842.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232944|gb|EGA17040.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240679|gb|EGA24721.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242993|gb|EGA27014.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247684|gb|EGA31629.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252685|gb|EGA36523.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255726|gb|EGA39478.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261688|gb|EGA45262.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323268077|gb|EGA51556.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269927|gb|EGA53376.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 131

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 52/127 (40%), Positives = 68/127 (53%), Gaps = 3/127 (2%)

Query: 4   KIIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           K IF LT  A+ F S AL   C     Q +MN+C    +    +KL  TY+  L++ +  
Sbjct: 2   KRIF-LTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 121 GDLSCPL 127


>gi|238791812|ref|ZP_04635449.1| hypothetical protein yinte0001_15280 [Yersinia intermedia ATCC
           29909]
 gi|238728916|gb|EEQ20433.1| hypothetical protein yinte0001_15280 [Yersinia intermedia ATCC
           29909]
          Length = 123

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 70/124 (56%), Gaps = 1/124 (0%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ ++ ++ I+ Q++A++C   + Q D+NQC  + +     +L   YK+VL K    QR 
Sbjct: 1   MLISILVLPIS-QALAIDCQNAVTQLDINQCANSDYKKADTELNRIYKQVLAKTPATQRA 59

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDL 124
           L + +Q+ W  YR ++C F +S  E G+   MI + CL      R+ +L S+L C EGDL
Sbjct: 60  LLKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEARSAELLSFLNCAEGDL 119

Query: 125 LCPF 128
            CP 
Sbjct: 120 SCPL 123


>gi|16760000|ref|NP_455617.1| secreted protein [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29142229|ref|NP_805571.1| hypothetical protein t1798 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413886|ref|YP_150961.1| hypothetical protein SPA1728 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62179643|ref|YP_216060.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161503792|ref|YP_001570904.1| hypothetical protein SARI_01879 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|168233506|ref|ZP_02658564.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194445821|ref|YP_002040377.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194471793|ref|ZP_03077777.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197362809|ref|YP_002142446.1| hypothetical protein SSPA1606 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|213163118|ref|ZP_03348828.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213416807|ref|ZP_03349951.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213609877|ref|ZP_03369703.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648753|ref|ZP_03378806.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852027|ref|ZP_03381559.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224584370|ref|YP_002638168.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238911057|ref|ZP_04654894.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289830140|ref|ZP_06547571.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25363759|pir||AD0633 probable secreted protein STY1158 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502294|emb|CAD08247.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137859|gb|AAO69420.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128143|gb|AAV77649.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62127276|gb|AAX64979.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|160865139|gb|ABX21762.1| hypothetical protein SARI_01879 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|194404484|gb|ACF64706.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194458157|gb|EDX46996.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197094286|emb|CAR59794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205332414|gb|EDZ19178.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|224468897|gb|ACN46727.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322714111|gb|EFZ05682.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 131

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 68/127 (53%), Gaps = 3/127 (2%)

Query: 4   KIIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           K IF LT  A+ F S AL   C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 2   KRIF-LTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 121 GDLSCPL 127


>gi|237730957|ref|ZP_04561438.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906496|gb|EEH92414.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 131

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 68/126 (53%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++I+     + ++ Q++A +C     Q +MN C    +     KL  TY+  L++    Q
Sbjct: 2   KRIVLTCAALLLSGQALADDCANANTQIEMNTCAAEQYKAADAKLNETYQNALKRAAPTQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R+L +K+Q++W   R ++CA  +SG E G+ Q+MI + CL     ER   L S L C EG
Sbjct: 62  RDLLKKAQVSWITLRDADCALISSGTEGGSVQAMISSQCLTDKTNEREAFLASLLQCEEG 121

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 122 DLSCPL 127


>gi|161614673|ref|YP_001588638.1| hypothetical protein SPAB_02424 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167552609|ref|ZP_02346361.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168467574|ref|ZP_02701411.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|200390183|ref|ZP_03216794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205352274|ref|YP_002226075.1| hypothetical protein SG1011 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|161364037|gb|ABX67805.1| hypothetical protein SPAB_02424 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|195630064|gb|EDX48716.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|199602628|gb|EDZ01174.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205272055|emb|CAR36900.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322736|gb|EDZ10575.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|326627319|gb|EGE33662.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 131

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 68/127 (53%), Gaps = 3/127 (2%)

Query: 4   KIIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           K IF LT  A+ F S AL   C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 2   KRIF-LTCAALWFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 121 GDLSCPL 127


>gi|207856464|ref|YP_002243115.1| hypothetical protein SEN0986 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|206708267|emb|CAR32568.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 131

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 68/127 (53%), Gaps = 3/127 (2%)

Query: 4   KIIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           K IF LT  A+ F S AL   C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 2   KQIF-LTCAALWFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 121 GDLSCPL 127


>gi|67458527|ref|YP_246151.1| hypothetical protein RF_0135 [Rickettsia felis URRWXCal2]
 gi|67004060|gb|AAY60986.1| unknown [Rickettsia felis URRWXCal2]
          Length = 138

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 70/131 (53%), Gaps = 2/131 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + IIF    ++    + A++CN  + Q DMN C G  +  V +KL   YK++L+ +  
Sbjct: 1   MKKTIIFCWLFLSSISYAFAVDCNNAMTQGDMNYCAGEEYKKVDKKLNQIYKEILKHISD 60

Query: 61  HQRE--LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            Q +  L +KSQ  W  YR ++C F +SG   G+   MI   CL     ER ++ E+ L 
Sbjct: 61  EQEKVNLLKKSQNLWIKYRDADCEFRSSGVYGGSVYPMILLMCLTEKTEERIKEFEAMLK 120

Query: 119 CPEGDLLCPFI 129
           C EGD  CPFI
Sbjct: 121 CEEGDSSCPFI 131


>gi|157146286|ref|YP_001453605.1| hypothetical protein CKO_02044 [Citrobacter koseri ATCC BAA-895]
 gi|157083491|gb|ABV13169.1| hypothetical protein CKO_02044 [Citrobacter koseri ATCC BAA-895]
          Length = 131

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (55%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++IIF    + ++ Q++A +C     Q +MN C    F    +KL  TY+  L++ E  Q
Sbjct: 2   KRIIFTCAALLLSAQALADDCANASTQMEMNTCAAAQFQTADKKLNETYQNALKRAEPPQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           R+L +K+Q+AW   R ++CA  +SG E G+ Q MI + C+     ER   L S L C EG
Sbjct: 62  RDLLKKAQIAWIALRDADCALVSSGTEGGSIQPMIASQCMTDKTDEREAFLASLLQCEEG 121

Query: 123 DLLCPF 128
           DL CP 
Sbjct: 122 DLSCPL 127


>gi|168821756|ref|ZP_02833756.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205341745|gb|EDZ28509.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085339|emb|CBY95122.1| Uncharacterized protein R02472 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 131

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 67/127 (52%), Gaps = 3/127 (2%)

Query: 4   KIIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           K IF LT  A+ F S AL   C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 2   KRIF-LTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++C    SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCDLIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 121 GDLSCPL 127


>gi|213428504|ref|ZP_03361254.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 131

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 64/121 (52%), Gaps = 2/121 (1%)

Query: 10  TIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           T  A+ F S AL   C     Q +MN+C    +    +KL  TY+  +++ +  QREL +
Sbjct: 7   TCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPPQRELLQ 66

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP
Sbjct: 67  KAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCP 126

Query: 128 F 128
            
Sbjct: 127 L 127


>gi|283784819|ref|YP_003364684.1| hypothetical protein ROD_10671 [Citrobacter rodentium ICC168]
 gi|282948273|emb|CBG87844.1| putative exported protein [Citrobacter rodentium ICC168]
          Length = 131

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 57/106 (53%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C     QADMN C    +    +KL  T++  LE+  + QREL +K+Q AW   R ++CA
Sbjct: 22  CANAATQADMNACAITQYQTADKKLNETFRNALERAAEPQRELLKKAQNAWIAVRDADCA 81

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
             ASG E G+AQ MI   CL     ER   L S L C EGD+ CP 
Sbjct: 82  LIASGTEGGSAQVMIANQCLADKTDEREAFLASLLQCEEGDMSCPL 127


>gi|213579932|ref|ZP_03361758.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
          Length = 116

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 61/112 (54%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  QREL +K+Q+AW   
Sbjct: 1   QALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPPQRELLQKAQVAWIAL 60

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP 
Sbjct: 61  RDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPL 112


>gi|311280067|ref|YP_003942298.1| hypothetical protein Entcl_2766 [Enterobacter cloacae SCF1]
 gi|308749262|gb|ADO49014.1| hypothetical protein Entcl_2766 [Enterobacter cloacae SCF1]
          Length = 131

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 67/126 (53%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++I+ A   + ++  ++A  C+    Q  +N+CT   +    +KL  TY  VL++    Q
Sbjct: 2   KRILIACGALLVSATALADECSSASTQTALNECTAAQYQAADKKLNDTYATVLKRAPDAQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + L + +Q  W   R ++CA  +SG+  G+ Q MI + C+    +ER   LES L C EG
Sbjct: 62  KALLKTAQQKWVALRDADCALMSSGSAGGSIQPMINSQCMADKTVERTAWLESLLHCDEG 121

Query: 123 DLLCPF 128
           D+ CP 
Sbjct: 122 DISCPL 127


>gi|238749614|ref|ZP_04611119.1| hypothetical protein yrohd0001_29320 [Yersinia rohdei ATCC 43380]
 gi|238712269|gb|EEQ04482.1| hypothetical protein yrohd0001_29320 [Yersinia rohdei ATCC 43380]
          Length = 128

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 60/112 (53%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q+ A++C   L Q +MNQC    +     +L   YK++  K     + L + +Q+ W  +
Sbjct: 17  QTFAVDCKNALTQKEMNQCANADYKKADTELNRIYKEIFAKTSADIKPLLKSAQLTWIKF 76

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           R ++C F +S  E G+   MI + CL     ER  +L+SYL CPEG+L CP 
Sbjct: 77  RDADCRFQSSATEGGSVHPMIISACLTHKTEERISQLKSYLNCPEGELSCPL 128


>gi|296102966|ref|YP_003613112.1| putative secreted protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295057425|gb|ADF62163.1| putative secreted protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 130

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 57/106 (53%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+    Q ++N C+   +    +KL  TY+  +++    QR+L +K+Q AW   R ++C 
Sbjct: 23  CDNATTQLELNTCSAQQYQAADKKLNQTYQSAIKRAAAPQRDLLKKAQQAWIALRDADCN 82

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           F  SG E G+ Q MI + CL    +ER   L S + C EGDL CP 
Sbjct: 83  FIGSGTEGGSVQPMIMSQCLTEKTVEREAFLASLMQCEEGDLSCPL 128


>gi|239834266|ref|ZP_04682594.1| Hypothetical protein OINT_2001088 [Ochrobactrum intermedium LMG
           3301]
 gi|239822329|gb|EEQ93898.1| Hypothetical protein OINT_2001088 [Ochrobactrum intermedium LMG
           3301]
          Length = 134

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 9/132 (6%)

Query: 9   LTIIAIAFQSMAL--------NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           L  IAIA  +M           C+    QA MN+C G  F    +KL + Y+++  ++  
Sbjct: 2   LKYIAIALTAMFFSGSASASSECDNAQDQATMNKCAGQGFQKADKKLNSLYQQLERRLAG 61

Query: 61  HQ-RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
           +  ++L   SQ AW  +R +EC F++SG E GT Q M+YA C +    +R+++L  +L C
Sbjct: 62  NDAKKLLTISQRAWIKFRDAECEFSSSGTEGGTVQPMVYAMCRERLTADRSKQLSEHLKC 121

Query: 120 PEGDLLCPFINN 131
            EGDL CP +++
Sbjct: 122 EEGDLSCPQLSS 133


>gi|146311196|ref|YP_001176270.1| hypothetical protein Ent638_1540 [Enterobacter sp. 638]
 gi|145318072|gb|ABP60219.1| protein of unknown function DUF1311 [Enterobacter sp. 638]
          Length = 131

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           +C     Q++MN C    +    +KL  TY+  +++    QR+L +K+Q AW   R ++C
Sbjct: 21  DCANANTQSEMNICAAQQYQAADKKLNQTYQDAMKRAAVPQRDLLKKAQQAWITLRDADC 80

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           AFAASG   G+ Q MI   CL     +R   L S + C EGDL CP 
Sbjct: 81  AFAASGTAGGSVQPMILNQCLAEKTTDREAFLASMMQCEEGDLSCPL 127


>gi|222081429|ref|YP_002540792.1| urease-associated protein [Agrobacterium radiobacter K84]
 gi|221726108|gb|ACM29197.1| urease-associated protein [Agrobacterium radiobacter K84]
          Length = 135

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 68/130 (52%), Gaps = 6/130 (4%)

Query: 3   RKIIFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV- 58
           R   FA+ +I +A  + AL   NC +   Q DMN C G ++A    +L   YK++  ++ 
Sbjct: 2   RITAFAIALI-LATPTFALAEQNCGDLTTQTDMNICAGKAYAKSDAELNVLYKQIEARLK 60

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +   ++L   +Q AW  YR +EC F++S    GT    I ++CL      R E L+ YL
Sbjct: 61  DDADTKKLLVSTQKAWVGYRDAECNFSSSKVTGGTVYPFISSSCLNNMTRSRIEDLKGYL 120

Query: 118 TCPEGDLLCP 127
            C +GDL CP
Sbjct: 121 KCGDGDLDCP 130


>gi|304415354|ref|ZP_07396030.1| hypothetical protein REG_1819 [Candidatus Regiella insecticola
           LSR1]
 gi|304282794|gb|EFL91281.1| hypothetical protein REG_1819 [Candidatus Regiella insecticola
           LSR1]
          Length = 130

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +K+I  L      F + AL C+    Q++MN C   ++    ++L   Y+ + E+     
Sbjct: 2   KKMIMVLLAALPVFNASALECDNAQTQSEMNNCATAAYKKADDELNKLYENIKERTRGKH 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +++ +K+Q  W  YR S+C F    + + +   M+YA C +    ER  + +  L CPEG
Sbjct: 62  KKMLKKTQQKWIEYRDSDCRFQTYLSRKNSIYPMVYAYCRENKTRERVNEFKKMLDCPEG 121

Query: 123 DLLCPF 128
           D+ CP 
Sbjct: 122 DVSCPL 127


>gi|115358523|ref|YP_775661.1| hypothetical protein Bamb_3773 [Burkholderia ambifaria AMMD]
 gi|115283811|gb|ABI89327.1| protein of unknown function DUF1311 [Burkholderia ambifaria AMMD]
          Length = 134

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 5/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ AL + A    + A NC ET  QA M  C   ++     +L  TY+ V  ++ +  + 
Sbjct: 7   LLCALALTANLAHAQA-NCAETTDQAAMTACADRAYKKSDAELNRTYQAVTARL-RDAKP 64

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           L EK   +Q  W  YR +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C E
Sbjct: 65  LAEKLVNAQRTWIAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEE 124

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 125 GDLACPV 131


>gi|206575813|ref|YP_002239339.1| hypothetical protein KPK_3519 [Klebsiella pneumoniae 342]
 gi|206564871|gb|ACI06647.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
          Length = 131

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 72/126 (57%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++ E  Q
Sbjct: 2   KRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAEGKQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +G
Sbjct: 62  QTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLLSQCMTDKSVERESFLASLLQCEDG 121

Query: 123 DLLCPF 128
           D  CP 
Sbjct: 122 DQSCPL 127


>gi|206563342|ref|YP_002234105.1| hypothetical protein BCAM1492 [Burkholderia cenocepacia J2315]
 gi|198039382|emb|CAR55347.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 134

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 69/127 (54%), Gaps = 5/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ +L ++A    + A NC +   QA M  C   ++     +L  TY+ V  ++ +  R 
Sbjct: 7   LLGSLALVASVAHAQA-NCADATDQATMTACADRAYKKSDGELNRTYQAVTARL-RDARP 64

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           L +K   +Q AW  YR +EC F+++ AE+G+A  M+ + CL      R + L+ YL+C E
Sbjct: 65  LADKLVNAQRAWIAYRDAECRFSSANAEDGSAYPMVVSTCLDDLTKARTDTLKGYLSCEE 124

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 125 GDLACPV 131


>gi|77460115|ref|YP_349622.1| hypothetical protein Pfl01_3894 [Pseudomonas fluorescens Pf0-1]
 gi|77384118|gb|ABA75631.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 134

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 68/130 (52%), Gaps = 3/130 (2%)

Query: 1   MCRKIIFALT-IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M  +++ ALT  +  +    A++C     QA MNQC         ++L   Y+++  +++
Sbjct: 1   MSPRLLLALTPFLFTSVAHAAVDCANASDQATMNQCAAQENKAADKELNTVYQQITARLK 60

Query: 60  KHQ--RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +   ++L   +Q AW  +R +EC F+ASG   G+   +IY NC+      R E L+ YL
Sbjct: 61  DNPDGKKLLVSAQRAWIGFRDTECKFSASGVAGGSVYPLIYNNCITSVTKTRTEALKQYL 120

Query: 118 TCPEGDLLCP 127
            C EGD+ CP
Sbjct: 121 KCEEGDMSCP 130


>gi|27884639|gb|AAN18026.1| unknown [Pseudomonas chlororaphis subsp. aurantiaca]
          Length = 147

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 61/114 (53%), Gaps = 2/114 (1%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMAWEIYR 77
           A +C     QA MNQC         ++L   Y+++ +++E +  +++L   +Q AW  +R
Sbjct: 34  ADDCANATTQAAMNQCAAEQHKAADKELNTLYQRINQRLEDNPDRKKLLLGAQRAWVAFR 93

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFINN 131
            +EC FAASG   G+   ++Y+NC       R E  +SYL C EGDL CP   N
Sbjct: 94  DAECGFAASGVAGGSVYPLLYSNCTTELTKARVEAFKSYLECQEGDLGCPVPGN 147


>gi|171322144|ref|ZP_02911004.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
 gi|171092552|gb|EDT37868.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
          Length = 134

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (54%), Gaps = 4/110 (3%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK---SQMAWEIYRG 78
           NC +   QA M  C   ++     +L  TY+ V  ++ +  + L EK   +Q  W  YR 
Sbjct: 23  NCADATDQAAMTACADRAYKKSDAELNRTYQAVTARL-RDAKPLAEKLVNAQRTWIAYRD 81

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           +EC F+++ AE G+A SM+ A CL      RNE L+ YL+C EGDL CP 
Sbjct: 82  AECNFSSANAEGGSAYSMVVATCLDDLTRIRNETLKGYLSCEEGDLACPV 131


>gi|172063276|ref|YP_001810927.1| hypothetical protein BamMC406_4247 [Burkholderia ambifaria MC40-6]
 gi|171995793|gb|ACB66711.1| protein of unknown function DUF1311 [Burkholderia ambifaria MC40-6]
          Length = 134

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ AL + A    + A NC E   QA M  C   ++     +L  TY+ V  ++ +  + 
Sbjct: 7   LLCALALTANLAHAQA-NCAEATEQAAMTACADRAYKKSDAELNRTYQAVTARL-RDAKP 64

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           L EK   +Q  W  YR +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C E
Sbjct: 65  LAEKLVSAQRTWLAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEE 124

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 125 GDLACPV 131


>gi|295096268|emb|CBK85358.1| Uncharacterized protein conserved in bacteria [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 131

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 55/106 (51%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C++   Q +++ C    +    +KL  TY+  +++    QR+L +K+Q AW   R ++C 
Sbjct: 22  CDKATTQTELSACAAEQYQAADKKLNQTYQAAIKRAAAPQRDLLKKAQQAWIALRDADCK 81

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
              SG E GT Q MI   CL     ER   L S + C EG+L CPF
Sbjct: 82  LMGSGTEGGTIQPMIINQCLTEKTAEREAFLASLMQCEEGNLSCPF 127


>gi|78062503|ref|YP_372411.1| hypothetical protein Bcep18194_B1653 [Burkholderia sp. 383]
 gi|77970388|gb|ABB11767.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 134

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (54%), Gaps = 4/110 (3%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK---SQMAWEIYRG 78
           NC +   QA M  C   ++     +L  TY+ V  ++ +  R L +K   +Q AW  YR 
Sbjct: 23  NCADATDQAAMTACADRAYKKSDGELNRTYQAVTARL-RDARPLADKLVNAQRAWIAYRD 81

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           +EC F+++ AE G+A SM+ + CL      R E L+ YL+C EGDL CP 
Sbjct: 82  AECNFSSANAEGGSAYSMVVSTCLDDLTKARTETLKGYLSCEEGDLACPV 131


>gi|134293579|ref|YP_001117315.1| hypothetical protein Bcep1808_4893 [Burkholderia vietnamiensis G4]
 gi|134136736|gb|ABO57850.1| protein of unknown function DUF1311 [Burkholderia vietnamiensis G4]
          Length = 134

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (54%), Gaps = 4/110 (3%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK---SQMAWEIYRG 78
           NC +   QA M  C   ++     +L  TY+ V  ++ +  R L +K   +Q AW  YR 
Sbjct: 23  NCADAADQAAMTACADRAYKKSDAELNRTYQAVTARL-RDARPLADKLVSAQRAWIAYRD 81

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           +EC+F+++ AE G+  SM+ + CL      R E L+ YL+C EGDL CP 
Sbjct: 82  AECSFSSANAEGGSVYSMVVSTCLDDLTKTRTETLKGYLSCEEGDLACPV 131


>gi|170703718|ref|ZP_02894441.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
 gi|170131373|gb|EDS99977.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
          Length = 134

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (54%), Gaps = 4/110 (3%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK---SQMAWEIYRG 78
           NC +   QA M  C   ++     +L  TY+ +  ++ +  + L EK    Q AW  YR 
Sbjct: 23  NCADVTDQAAMTACADRAYKKSDAELNRTYQAITARL-RDAKPLAEKLVNGQRAWIAYRD 81

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C EGDL CP 
Sbjct: 82  AECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEEGDLACPV 131


>gi|152969596|ref|YP_001334705.1| hypothetical protein KPN_01040 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238894079|ref|YP_002918813.1| hypothetical protein KP1_2029 [Klebsiella pneumoniae NTUH-K2044]
 gi|262043595|ref|ZP_06016706.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150954445|gb|ABR76475.1| hypothetical protein KPN_01040 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238546395|dbj|BAH62746.1| hypothetical protein KP1_2029 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259039067|gb|EEW40227.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 131

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 71/126 (56%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    Q
Sbjct: 2   KRTLFAVMALLASGAALADECSSANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGKQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +G
Sbjct: 62  QTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCEDG 121

Query: 123 DLLCPF 128
           D  CP 
Sbjct: 122 DQSCPL 127


>gi|290510753|ref|ZP_06550123.1| hypothetical protein HMPREF0485_02523 [Klebsiella sp. 1_1_55]
 gi|289777469|gb|EFD85467.1| hypothetical protein HMPREF0485_02523 [Klebsiella sp. 1_1_55]
          Length = 131

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 71/126 (56%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    Q
Sbjct: 2   KRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGKQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +G
Sbjct: 62  QTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCEDG 121

Query: 123 DLLCPF 128
           D  CP 
Sbjct: 122 DQSCPL 127


>gi|288936192|ref|YP_003440251.1| hypothetical protein Kvar_3339 [Klebsiella variicola At-22]
 gi|288890901|gb|ADC59219.1| protein of unknown function DUF1311 [Klebsiella variicola At-22]
          Length = 131

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 71/126 (56%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    Q
Sbjct: 2   KRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGKQ 61

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +G
Sbjct: 62  QTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLISQCMTDKSVERESFLASLLQCEDG 121

Query: 123 DLLCPF 128
           D  CP 
Sbjct: 122 DQSCPL 127


>gi|330810871|ref|YP_004355333.1| hypothetical protein PSEBR_a3936 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378979|gb|AEA70329.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 133

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEKSQMAWEIYRGSECAFAAS 86
           Q +MNQC          +L + YK++  +++ +   +++  K+Q AW  +R +EC F+AS
Sbjct: 29  QGEMNQCAAKENKAADNELNSLYKQITARLKDNPEAKQMLVKAQRAWIGFRDAECNFSAS 88

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           G E G+   +IY+NC+      R E  ++YL C EGDL CP
Sbjct: 89  GVEGGSVYPLIYSNCITTQTKARVEAFKNYLKCKEGDLSCP 129


>gi|254254013|ref|ZP_04947330.1| hypothetical protein BDAG_03300 [Burkholderia dolosa AUO158]
 gi|124898658|gb|EAY70501.1| hypothetical protein BDAG_03300 [Burkholderia dolosa AUO158]
          Length = 138

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 65/125 (52%), Gaps = 5/125 (4%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            ALT+ A    + A NC     QA +  C   ++     +L  TY+ V  ++ +  R L 
Sbjct: 13  LALTLAADIAHAQA-NCTSATDQATLTACADRAYKKADAELNRTYQAVTARL-RDARPLA 70

Query: 67  EK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +K   +Q AW  YR +EC F+++ AE G+   M+ + CL+     R E L+ YL+C EGD
Sbjct: 71  DKLVNAQRAWIAYRDAECHFSSANAEGGSVYPMVMSTCLEDLTKARTETLKGYLSCEEGD 130

Query: 124 LLCPF 128
           L CP 
Sbjct: 131 LACPV 135


>gi|227112977|ref|ZP_03826633.1| hypothetical protein PcarbP_08448 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 128

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 65/125 (52%), Gaps = 6/125 (4%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK--VEKHQR 63
           +FAL  I    Q+ A +C     Q +M+QC  N +  V  +L   Y+ V+++  +E+H +
Sbjct: 8   LFALLPIT---QATAADCGNANTQLEMSQCAANEYKKVDGELNRLYQDVVKRLVIEEH-K 63

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
            L + +Q  W  YR ++C F       G+   M+Y+ CL     ER E+ +S L C EGD
Sbjct: 64  ALLKSAQRKWIAYRDADCEFQTFPTTGGSVHGMVYSQCLTQKTAERVEEFKSMLRCEEGD 123

Query: 124 LLCPF 128
           L CP 
Sbjct: 124 LSCPL 128


>gi|330014289|ref|ZP_08307866.1| hypothetical protein HMPREF9538_05586 [Klebsiella sp. MS 92-3]
 gi|328533269|gb|EGF60026.1| hypothetical protein HMPREF9538_05586 [Klebsiella sp. MS 92-3]
          Length = 120

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (56%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           ++A  C+    Q +MNQC    +    +KL  T+++ L++    Q+ L +++Q AW   R
Sbjct: 6   ALADECSSANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGKQQTLLKQAQQAWIALR 65

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
            ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +GD  CP 
Sbjct: 66  DADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCEDGDQSCPL 116


>gi|221196455|ref|ZP_03569502.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221203126|ref|ZP_03576145.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221177060|gb|EEE09488.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221183009|gb|EEE15409.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 135

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (52%), Gaps = 4/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++    ++A +      NC     QA +  C  +++      L  TY+ V  ++ +  R 
Sbjct: 7   VLLCTLMLAASVAHAQANCANASDQATLTACAEHAYRQSDAVLNRTYQTVTARL-RDARP 65

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           + +K   +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C E
Sbjct: 66  VADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEE 125

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 126 GDLACPV 132


>gi|70731472|ref|YP_261213.1| hypothetical protein PFL_4116 [Pseudomonas fluorescens Pf-5]
 gi|68345771|gb|AAY93377.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 133

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 60/110 (54%), Gaps = 3/110 (2%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYR 77
           A  CN T  Q DM+ C         ++L A Y+++ +++  + H ++L   +Q AW  +R
Sbjct: 21  AYECNNT-TQTDMSLCANFQHKAADKELNALYQQINQRLKDQPHSKKLLVSAQRAWVAFR 79

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
            +EC+F+ SG E G+   + Y+NC+      R E  + YL C EGDL CP
Sbjct: 80  DAECSFSTSGVEGGSLYPVAYSNCITALTKTRVESFKQYLQCKEGDLSCP 129


>gi|91205457|ref|YP_537812.1| hypothetical protein RBE_0642 [Rickettsia bellii RML369-C]
 gi|157827183|ref|YP_001496247.1| hypothetical protein A1I_04335 [Rickettsia bellii OSU 85-389]
 gi|91069001|gb|ABE04723.1| unknown [Rickettsia bellii RML369-C]
 gi|157802487|gb|ABV79210.1| hypothetical protein A1I_04335 [Rickettsia bellii OSU 85-389]
          Length = 134

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 3   RKIIFALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           RKII  L +I   + + A    ++C+    Q DMN C    F    ++L   Y+++L+  
Sbjct: 2   RKIII-LYLIFFNYLTYASDSKIDCDNAYTQFDMNYCANEDFKKADKELNQLYQEILKYT 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +  L +KSQ  W  +R ++C F +    +GT   MI + CL G    R E+L++ L 
Sbjct: 61  SEEETNLLKKSQNLWIKFRDADCEFGSFQVRDGTVFPMILSMCLAGKTKVRIEELKNILE 120

Query: 119 CPEGDLLCPFINN 131
           C EGDL C  + N
Sbjct: 121 CSEGDLSCRVLRN 133


>gi|161520803|ref|YP_001584230.1| hypothetical protein Bmul_4257 [Burkholderia multivorans ATCC
           17616]
 gi|189353015|ref|YP_001948642.1| hypothetical protein BMULJ_04249 [Burkholderia multivorans ATCC
           17616]
 gi|160344853|gb|ABX17938.1| protein of unknown function DUF1311 [Burkholderia multivorans ATCC
           17616]
 gi|189337037|dbj|BAG46106.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 135

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++    ++A +      NC     QA +  C   ++      L  TY+ V  ++ +  R 
Sbjct: 7   VLLCPLMLAASVAHAQANCANASDQATLTACAERAYKQSDAVLNRTYQTVTARL-RDARP 65

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           + +K   +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C E
Sbjct: 66  VADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEE 125

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 126 GDLACPV 132


>gi|167584243|ref|ZP_02376631.1| hypothetical protein BuboB_02839 [Burkholderia ubonensis Bu]
          Length = 130

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 56/103 (54%), Gaps = 4/103 (3%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK---SQMAWEIYRGSECAFAA 85
           QA M+ C   ++     +L   Y+ V  +V +  R L EK   +Q AW  YR +EC F++
Sbjct: 26  QASMSACADRAYRKSDAELNRAYEAVTARV-RANRPLAEKLVSAQRAWVAYRDAECGFSS 84

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           +GAE G+   M+ + CL      R E L+ YL+C EGDL CP 
Sbjct: 85  AGAEGGSVHPMVVSMCLDDLTKARTESLQGYLSCEEGDLACPV 127


>gi|217976558|ref|YP_002360705.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
 gi|217501934|gb|ACK49343.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
          Length = 134

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 64/130 (49%), Gaps = 4/130 (3%)

Query: 3   RKIIFALTIIAI--AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE- 59
           R +I AL++ A      + A +C     QA +N C   +      +L A Y+ ++ +++ 
Sbjct: 2   RPLIVALSLFAALSGMTARAEDCGAAATQAAINDCANTALKNTDAELNAIYRSLIGRLKN 61

Query: 60  -KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
               R+    +Q AW  +R  ECAFAAS  ++G+    I ANC      +R + L  YL 
Sbjct: 62  SDDSRQSLIAAQRAWLQFRDGECAFAASSVKDGSIYPTIVANCRNALTADRVKALGVYLN 121

Query: 119 CPEGDLLCPF 128
           C EGD+ CP 
Sbjct: 122 CAEGDMGCPV 131


>gi|253687870|ref|YP_003017060.1| hypothetical protein PC1_1480 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754448|gb|ACT12524.1| protein of unknown function DUF1311 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 128

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 3/128 (2%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK--VEK 60
           +K   AL  +    Q+ A +C     Q +M+QC  + +  V ++L   Y+ V ++  +E+
Sbjct: 2   KKFAIALFALLPLTQAEAADCGNASTQLEMSQCAADEYKKVDDELNRLYQDVAKRLVIEE 61

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           H + L + +Q  W  YR ++C F       G+   M+Y+ CL     ER E+ +S L C 
Sbjct: 62  H-KPLLKSAQRKWIAYRDADCEFQTFPTTGGSIHGMLYSQCLTQKTAERVEEFKSMLRCK 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|254248430|ref|ZP_04941750.1| hypothetical protein BCPG_03261 [Burkholderia cenocepacia PC184]
 gi|124874931|gb|EAY64921.1| hypothetical protein BCPG_03261 [Burkholderia cenocepacia PC184]
          Length = 162

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ +L ++A    + A NC +   QA M  C   ++     +L  TY+ V  ++ +    
Sbjct: 35  LLGSLALVASVAHAQA-NCADATDQATMTACADRAYKKSDGELNRTYQAVTARL-RGAPP 92

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           L +K   +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C E
Sbjct: 93  LADKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEE 152

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 153 GDLACPV 159


>gi|170738341|ref|YP_001779601.1| hypothetical protein Bcenmc03_5990 [Burkholderia cenocepacia MC0-3]
 gi|169820529|gb|ACA95111.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           MC0-3]
          Length = 134

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ +L ++A    + A NC +   QA M  C   ++     +L  TY+ V  ++ +    
Sbjct: 7   LLGSLALVASVAHAQA-NCADATDQATMTACADRAYKKSDGELNRTYQAVTARL-RGAPP 64

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           L +K   +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C E
Sbjct: 65  LADKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEE 124

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 125 GDLACPV 131


>gi|182678739|ref|YP_001832885.1| hypothetical protein Bind_1768 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634622|gb|ACB95396.1| protein of unknown function DUF1311 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 135

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 4/124 (3%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--R 63
           +  L + A+AF      C + + QA MN+C   +F     +L   YKK+  ++  +   +
Sbjct: 9   LMVLAMPALAFSK--DKCADAMDQATMNECANVAFKKSDSQLNELYKKIETRLSDNTDTK 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +L  ++Q AW  +R +EC F  S +  G+   MI + C+ G    R + L++YL C EGD
Sbjct: 67  KLLAQAQRAWIKFRDAECDFQRSASAGGSVMPMIISMCMDGMTQSRIKDLQNYLNCKEGD 126

Query: 124 LLCP 127
           + CP
Sbjct: 127 MSCP 130


>gi|107026354|ref|YP_623865.1| hypothetical protein Bcen_4003 [Burkholderia cenocepacia AU 1054]
 gi|116692458|ref|YP_837991.1| hypothetical protein Bcen2424_4364 [Burkholderia cenocepacia
           HI2424]
 gi|105895728|gb|ABF78892.1| protein of unknown function DUF1311 [Burkholderia cenocepacia AU
           1054]
 gi|116650458|gb|ABK11098.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           HI2424]
          Length = 134

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ +L ++A    + A NC +   QA M  C   ++     +L  TY+ V  ++ +    
Sbjct: 7   LLGSLALVASVAHAQA-NCADATDQATMTACADRAYKKSDGELNRTYQAVTGRL-RGAPP 64

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           L +K   +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C E
Sbjct: 65  LADKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEE 124

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 125 GDLACPV 131


>gi|221210087|ref|ZP_03583068.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221170775|gb|EEE03241.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 135

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++    ++A +      NC     QA +  C   ++      L  TY+ V  ++ +  R 
Sbjct: 7   VLLCPLMLAASVAHAQANCANASDQATLTACAERAYKQSDAVLNRTYQTVTARL-RDARP 65

Query: 65  LFEK---SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
             +K   +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C E
Sbjct: 66  AADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEE 125

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 126 GDLACPV 132


>gi|110634827|ref|YP_675035.1| hypothetical protein Meso_2486 [Mesorhizobium sp. BNC1]
 gi|110285811|gb|ABG63870.1| protein of unknown function DUF1311 [Chelativorans sp. BNC1]
          Length = 135

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 67/130 (51%), Gaps = 6/130 (4%)

Query: 3   RKIIFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV- 58
           R II A T++ +A  + A    NC+    QA MN+C   +F    +KL   YK++  ++ 
Sbjct: 2   RTIILA-TVMMLAIPASAFAQDNCSAAEDQATMNECADAAFREADKKLNELYKQIEARLS 60

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +   + L  ++Q  W  +R +EC+F  + A  G+   M+ A C++     R E  E YL
Sbjct: 61  DDAETKNLLVQAQRDWVKFRDAECSFQTASAAGGSVMPMLTATCMESLTQVRVEAFEGYL 120

Query: 118 TCPEGDLLCP 127
            C EGDL CP
Sbjct: 121 NCEEGDLSCP 130


>gi|227329538|ref|ZP_03833562.1| hypothetical protein PcarcW_20233 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 128

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 3/128 (2%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EK 60
           +K+  AL  +    Q+ A +C     Q +M+QC  + +  V  +L   Y+ V+++V  E+
Sbjct: 2   KKLAIALFALQPITQAAATDCGNANTQLEMSQCAADEYKKVDGELNRLYQDVVKRVVIEE 61

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           H + L + +Q  W  YR ++C F       G+   M+Y+ CL     ER ++ ++ L C 
Sbjct: 62  H-KALLKSAQRKWIAYRDADCEFQTFPTTGGSVHGMVYSQCLTQKTAERVKEFKTMLRCE 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|325518758|gb|EGC98359.1| hypothetical protein B1M_42033 [Burkholderia sp. TJI49]
          Length = 133

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 58/110 (52%), Gaps = 4/110 (3%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK---SQMAWEIYRG 78
           NC     QA M  C   ++      L  TY+ V  ++ +  R L +K   +Q AW  YR 
Sbjct: 22  NCANASDQASMTACAERAYRQSDAVLNRTYQAVTARL-RDARPLDDKLVAAQRAWIAYRD 80

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           +EC F+++ AE G+   M+ + CL     ER E L++YL+C +GDL CP 
Sbjct: 81  AECQFSSANAEGGSGYQMVVSTCLDDLTKERTETLKAYLSCEDGDLACPV 130


>gi|170748739|ref|YP_001754999.1| hypothetical protein Mrad2831_2321 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655261|gb|ACB24316.1| protein of unknown function DUF1311 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 144

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 1/126 (0%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +CR +  A T+++ A  + A  C  T  QAD+N C G  +      L A Y ++ +K+  
Sbjct: 14  LCRGLALAATLLSPAPAAAADPCEGT-TQADLNACAGADYRAADTALNAVYGQLTKKIGP 72

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             ++    +Q AW  YR + C     G + G+A +M Y  CL+G    R + L+ YL C 
Sbjct: 73  KTKDALRGAQKAWLSYRDATCFLETLGLDGGSAYAMAYNGCLKGLTDARIKVLKGYLDCK 132

Query: 121 EGDLLC 126
             D+ C
Sbjct: 133 ADDVSC 138


>gi|83591822|ref|YP_425574.1| hypothetical protein Rru_A0482 [Rhodospirillum rubrum ATCC 11170]
 gi|83574736|gb|ABC21287.1| Protein of unknown function DUF1311 [Rhodospirillum rubrum ATCC
           11170]
          Length = 226

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWE 74
           Q+ A  C     QA+M  C   +      +L   YK +  ++  +   +     +Q AW 
Sbjct: 110 QARAQECAAPQTQAEMTLCADQALRRTDGELNQLYKDLGGRLKNDPDTKARLVGAQKAWL 169

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
            +R  ECAFA SG E G+A  M  A C +G   +R ++L SYL C EGDL CP 
Sbjct: 170 AFRDGECAFATSGVEGGSAYPMALATCREGLTQKRVKELRSYLRCAEGDLTCPV 223


>gi|75910969|ref|YP_325265.1| hypothetical protein Ava_4773 [Anabaena variabilis ATCC 29413]
 gi|75704694|gb|ABA24370.1| Protein of unknown function DUF1311 [Anabaena variabilis ATCC
           29413]
          Length = 135

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 56/97 (57%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
           LNC+    Q ++NQC+  S+    +KL   YK++L K+++ +++    +Q AW  +R S 
Sbjct: 35  LNCDNAQTQLEINQCSKQSYQNADKKLNQAYKQLLPKLQRSRKQKLIAAQQAWIKFRDSS 94

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           C F +S  E G+    +Y NCL+    +R ++L+ YL
Sbjct: 95  CEFESSQYEGGSIAPSVYLNCLEKLTQQRTQELQEYL 131


>gi|17229369|ref|NP_485917.1| hypothetical protein alr1877 [Nostoc sp. PCC 7120]
 gi|17130967|dbj|BAB73576.1| alr1877 [Nostoc sp. PCC 7120]
          Length = 153

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 56/97 (57%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
           +NC+    Q ++NQC+  S+    +KL   YK++L K+++ +++    +Q AW  +R S 
Sbjct: 53  INCDNAQTQLEINQCSTQSYQNADKKLNQAYKQLLPKLQRSRKQKLIAAQQAWIKFRDSS 112

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           C F +S  E G+    +Y NCL+    +R ++L+ YL
Sbjct: 113 CEFESSQYEGGSIAPSVYLNCLEKLTQQRTQELQEYL 149


>gi|229586281|ref|YP_002844782.1| hypothetical protein RAF_ORF0064 [Rickettsia africae ESF-5]
 gi|228021331|gb|ACP53039.1| Unknown [Rickettsia africae ESF-5]
          Length = 122

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 5/108 (4%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRGSECAFA 84
           ++Q DMN C    +  V +KL   Y+++L+ +  ++ Q  L +KS   W  YR ++C F 
Sbjct: 1   MIQGDMNYCVAAEYKKVDKKLNQIYQEILKHISDKREQVNLLKKSPNLWIKYRDADCEFR 60

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERN---EKLESYLTCPEGDLLCPFI 129
           + G   G+   MI   CL  +   R    ++ E+ L C EG+L CPFI
Sbjct: 61  SFGVYGGSVYPMILLMCLTSYRKNRRAYKKEFEAMLKCEEGNLSCPFI 108


>gi|319781594|ref|YP_004141070.1| hypothetical protein Mesci_1866 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167482|gb|ADV11020.1| hypothetical protein Mesci_1866 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 119

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 52/92 (56%), Gaps = 2/92 (2%)

Query: 38  NSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           + F    + L  T+K++ +++  +   +  F K+Q AW  +R +EC F +SG + G+A  
Sbjct: 24  SDFKRADQALNQTFKQIQKRLTDDSDGKARFVKAQRAWIAFRNAECTFQSSGDDGGSAAP 83

Query: 96  MIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           M+ A C       R ++L++YL C EGDL CP
Sbjct: 84  MVAAACQADLTKARTKQLKAYLNCQEGDLSCP 115


>gi|293607356|ref|ZP_06689695.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292814200|gb|EFF73342.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 137

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (49%), Gaps = 2/115 (1%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMA 72
              +  L C+    Q DMN C    +    + L   Y+ V+E+++    +    + +Q A
Sbjct: 18  GVHAQPLKCDNATTQTDMNLCADQDYRKSDKDLNDAYRSVVERLKDDSIKTTKLQAAQKA 77

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           W  +R +ECAF++ G   G+A  M+ + CL      R ++L +YL C EGD  CP
Sbjct: 78  WLFFRDAECAFSSGGTSGGSAYPMVLSLCLDKLTQARTKELRAYLQCEEGDTSCP 132


>gi|166368170|ref|YP_001660443.1| hypothetical protein MAE_54290 [Microcystis aeruginosa NIES-843]
 gi|166090543|dbj|BAG05251.1| hypothetical protein MAE_54290 [Microcystis aeruginosa NIES-843]
          Length = 141

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (48%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           NCN    Q+ MN C   ++     KL   Y+++L K+   +++    +Q AW  +R S C
Sbjct: 41  NCNNPQTQSQMNICASIAYQNADRKLNQVYRQLLPKLSAARKQKLITAQQAWIKFRDSSC 100

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            F  S  E G+   MIY NCL     +R + L  YL
Sbjct: 101 EFERSAYEGGSIAPMIYGNCLAAVTEQRTKDLRRYL 136


>gi|153007841|ref|YP_001369056.1| hypothetical protein Oant_0496 [Ochrobactrum anthropi ATCC 49188]
 gi|151559729|gb|ABS13227.1| protein of unknown function DUF1311 [Ochrobactrum anthropi ATCC
           49188]
          Length = 136

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 60/131 (45%), Gaps = 10/131 (7%)

Query: 6   IFALTIIAIAFQSMAL-------NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           +  + +I +AF + A+       +C     Q+ +N+C G ++     +L   +K +  + 
Sbjct: 3   VLKIGVIGVAFSAFAIIATAQADDCQNASSQSALNECYGKAYKKSDAELNKIFKTLQRRA 62

Query: 59  EKHQ-RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +    ++   +SQ  W  +R +EC     G   G+   M Y+ CL     ER   L+ YL
Sbjct: 63  DDADLKKKLVQSQRTWIAFRDAECDMQTVGG--GSISGMAYSICLSDLTAERVSDLKKYL 120

Query: 118 TCPEGDLLCPF 128
            C EGD  CPF
Sbjct: 121 KCEEGDSNCPF 131


>gi|260459744|ref|ZP_05807998.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034546|gb|EEW35803.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
          Length = 119

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 38  NSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           + F    + L  T+K++ +++  +   +    K+Q  W  +R +EC F + G + G+A  
Sbjct: 24  SDFKRADQGLNQTFKQIQKRLADDSGGKARLVKAQRTWIAFRNAECTFQSGGDDGGSAAP 83

Query: 96  MIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           M+ A C      +RN++L++YL C EGDL CP
Sbjct: 84  MVAAACQAELTKDRNKQLKAYLNCQEGDLACP 115


>gi|298291881|ref|YP_003693820.1| hypothetical protein Snov_1898 [Starkeya novella DSM 506]
 gi|296928392|gb|ADH89201.1| protein of unknown function DUF1311 [Starkeya novella DSM 506]
          Length = 139

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQM 71
           I+  ++A +C +   Q  ++QC G +F     +L   Y ++  ++  +   +     +Q 
Sbjct: 20  ISGPALAQDCADP-TQMGLDQCAGAAFKKSDARLNQVYGQIAARLSGDAATKAKLVAAQR 78

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           AW  +R +ECAF A+G E G+  SM    C +     R  +LE  L C EGD  CP
Sbjct: 79  AWIAFRDAECAFRAAGVEGGSIHSMTVTLCRKDVTDRRVTELEPLLNCEEGDTSCP 134


>gi|282897347|ref|ZP_06305349.1| Protein of unknown function DUF1311 [Raphidiopsis brookii D9]
 gi|281197999|gb|EFA72893.1| Protein of unknown function DUF1311 [Raphidiopsis brookii D9]
          Length = 136

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQMAWEIYRGSE 80
           +C + + QA +NQC   +     +KL   YKK L   + K Q +L   ++ AW  YR + 
Sbjct: 35  DCQKAVTQAQLNQCAAINAKTADQKLNDAYKKALAIYKGKPQAKLLVAAEEAWIKYRDAS 94

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           CAF+ S  E G+   M+Y NCL+    ER ++L  Y
Sbjct: 95  CAFSRSRVEGGSIMPMVYLNCLERLTKERTQELARY 130


>gi|227355531|ref|ZP_03839926.1| secreted protein [Proteus mirabilis ATCC 29906]
 gi|227164327|gb|EEI49216.1| secreted protein [Proteus mirabilis ATCC 29906]
          Length = 129

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 1   MCRKIIFALTI------IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M +K+IF   I       +I  Q+   +C     Q ++NQC    F    E+L   Y++ 
Sbjct: 4   MMKKVIFVSAISGGILFWSIHLQADNFDCRNAETQTEINQCAYQDFQQKDEELSQIYQQY 63

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K+E  +++  + +Q  W  +R   C + A   + G+   M+Y++CL+   IER   L+
Sbjct: 64  YAKLETKRQQQLQHAQSVWMTFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTIERINDLK 123

Query: 115 SYL 117
           +Y+
Sbjct: 124 NYI 126


>gi|197285104|ref|YP_002150976.1| hypothetical protein PMI1245 [Proteus mirabilis HI4320]
 gi|194682591|emb|CAR42652.1| putative exported protein [Proteus mirabilis HI4320]
          Length = 129

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 1   MCRKIIFALTI------IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M +K+IF   I       +I  Q+   +C     Q ++NQC    F    E+L   Y++ 
Sbjct: 4   MMKKVIFVSAISGGILFWSIHLQADNFDCRNAETQTEINQCAYQDFQQKDEELSQIYQQY 63

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K+E  +++  + +Q  W  +R   C + A   + G+   M+Y++CL+   IER   L+
Sbjct: 64  YVKLETKRQQQLQHAQSVWMTFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTIERINDLK 123

Query: 115 SYL 117
           +Y+
Sbjct: 124 NYI 126


>gi|13473270|ref|NP_104837.1| hypothetical protein mll3812 [Mesorhizobium loti MAFF303099]
 gi|14024018|dbj|BAB50623.1| mll3812 [Mesorhizobium loti MAFF303099]
          Length = 143

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 3/131 (2%)

Query: 3   RKIIFALTIIAIAFQSM--ALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           R+I+ +  ++ +A  S+  A  C+ +   Q  MN C G  +     KL A YK ++   +
Sbjct: 6   RRILLSACLVVLAGTSIVRAQECDRSDDSQQMMNICAGEDYQAADAKLNAAYKDLISSDD 65

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
              + L + +Q AW  +R +ECA + + +  G+  +M  + CL     +R ++L +   C
Sbjct: 66  ADGKRLLQVAQRAWITFRDAECAHSTAASAGGSIHAMEVSQCLTRLTNDRIKQLAASANC 125

Query: 120 PEGDLLCPFIN 130
            EGD  C   N
Sbjct: 126 QEGDASCASPN 136


>gi|186683924|ref|YP_001867120.1| hypothetical protein Npun_F3792 [Nostoc punctiforme PCC 73102]
 gi|186466376|gb|ACC82177.1| protein of unknown function DUF1311 [Nostoc punctiforme PCC 73102]
          Length = 140

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 51/97 (52%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            NCN    QA +N+C  +S+    ++L   Y+++L  +EK +++    +Q AW  +R + 
Sbjct: 40  FNCNNPQTQAAINECANSSYQNADKRLNRAYQQLLPTLEKSRKQKLIAAQQAWLKFRDTN 99

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           C F  S  E G+    IY  CL+     R ++L+ YL
Sbjct: 100 CEFERSKYEGGSIAPSIYVGCLENLTKLRTQQLQEYL 136


>gi|260461481|ref|ZP_05809728.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
 gi|259032551|gb|EEW33815.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
          Length = 139

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 3/127 (2%)

Query: 3   RKIIFALTIIAIAFQSM--ALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           R+I  +  ++ +A  S+  A  C+ +   Q  MN C G  +     +L A Y+ ++   +
Sbjct: 2   RRIFLSACLVLLAGTSIVRAQECDRSDDSQQMMNICAGEDYQAADARLNAAYQDLISSDD 61

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
              + L + +Q AW  +R +ECA + + +  G+  +M  + CL     +R  +L +   C
Sbjct: 62  ADGKRLLQAAQRAWIAFRDAECAHSTAASAGGSIHAMAVSQCLTRLTDDRTRQLAAAANC 121

Query: 120 PEGDLLC 126
            EGD+ C
Sbjct: 122 EEGDVSC 128


>gi|311108538|ref|YP_003981391.1| hypothetical protein AXYL_05376 [Achromobacter xylosoxidans A8]
 gi|310763227|gb|ADP18676.1| hypothetical protein AXYL_05376 [Achromobacter xylosoxidans A8]
          Length = 136

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (51%), Gaps = 4/110 (3%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL---FEKSQMAWEIYR 77
           L+C     Q DM+ C   ++      L A YK+V  ++ K+ R+       +Q AW  +R
Sbjct: 23  LDCGNAATQTDMSLCADQAYRKSDAALNAAYKEVGARL-KNDRDATTQLHAAQKAWLFFR 81

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
            +ECAFA+S    G+A  M  + CL      R ++L +YL C EGDL CP
Sbjct: 82  DAECAFASSSTSGGSAYPMTLSLCLDKLTQARTKELRAYLKCEEGDLSCP 131


>gi|159028823|emb|CAO89994.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 141

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           NCN    Q++MN C   ++     KL   Y+++L ++   +++    +Q AW  +R S C
Sbjct: 41  NCNNPQTQSEMNICASIAYQNADRKLNQVYRQLLPRLSAARKQKLISAQQAWIKFRDSSC 100

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            F  S  E G+   MIY  CL     +R + L  YL
Sbjct: 101 EFERSAYEGGSLAPMIYGFCLANVTEQRTKDLRRYL 136


>gi|60256941|gb|AAX14947.1| ORF191 [Xanthomonas campestris pv. pelargonii]
          Length = 190

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 56/103 (54%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A Q  A + +E + QADMN+    SF   +E+L A  + + E++   +R+ FEKS  AW 
Sbjct: 82  AVQIYASDQSEHMTQADMNRHAAASFHRAEERLVALVEDLREELSAGRRDAFEKSHQAWL 141

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            YR +   F +S    G+ Q +I+A+ L+   I R  +LE  L
Sbjct: 142 QYREASAEFQSSQYHGGSIQPLIHASALESVTISRIVELEPLL 184


>gi|170736832|ref|YP_001778092.1| hypothetical protein Bcenmc03_4459 [Burkholderia cenocepacia MC0-3]
 gi|254249463|ref|ZP_04942783.1| hypothetical protein BCPG_04327 [Burkholderia cenocepacia PC184]
 gi|124875964|gb|EAY65954.1| hypothetical protein BCPG_04327 [Burkholderia cenocepacia PC184]
 gi|169819020|gb|ACA93602.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           MC0-3]
          Length = 138

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ---RELFEKSQMAWEIY 76
           A +C     Q  MN+C   ++A    +L   Y+ +  +++  +   R+L E +Q AW  +
Sbjct: 25  APDCANPQDQRTMNECASRAYARADAELNRRYRALQSRLKDDRDGARKLTE-AQRAWIAF 83

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           R +EC F       G+A+ +  A CL+     R+  L+ YL C EGD  CP 
Sbjct: 84  RDTECVFQTIRVAGGSAEPLARAACLEETTRSRSAALQRYLECGEGDTNCPV 135


>gi|209527286|ref|ZP_03275796.1| protein of unknown function DUF1311 [Arthrospira maxima CS-328]
 gi|209492274|gb|EDZ92619.1| protein of unknown function DUF1311 [Arthrospira maxima CS-328]
          Length = 219

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 52/100 (52%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +  + CN     A+M +C  + + +   KL   Y+++  KV+  +R+    +Q AW  +R
Sbjct: 30  AQGIQCNPKGSMAEMKKCADDDYRVADRKLNEVYQQLTPKVQGEERQRLIAAQRAWIQFR 89

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            + C F ++ A  GT + +++ NCL      R  +L++Y+
Sbjct: 90  DTNCRFESAEALGGTLEGLLFTNCLTKMTTNRTAELQAYI 129


>gi|60256948|gb|AAX14949.1| ORF191 [Xanthomonas campestris pv. pelargonii]
          Length = 183

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A Q  A + +E + QADMN+    SF   +E+L A  + + E++   +R+ FEKS  AW 
Sbjct: 82  AVQIYASDQSEHMTQADMNRHAAASFHRAEERLVALVEDLREELSAGRRDAFEKSHQAWL 141

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            YR +   F +S    G+ Q +I+A+ L+   I R  +LE
Sbjct: 142 QYREASAEFQSSQYHGGSIQPLIHASALESVTISRIVELE 181


>gi|226330097|ref|ZP_03805615.1| hypothetical protein PROPEN_04010 [Proteus penneri ATCC 35198]
 gi|225200892|gb|EEG83246.1| hypothetical protein PROPEN_04010 [Proteus penneri ATCC 35198]
          Length = 129

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 1   MCRKIIFALTIIAIAFQSMAL-----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M + I+F      I F S+ L     +C     Q ++NQC    F    E+L   Y++  
Sbjct: 5   MKKLILFGTISGGILFWSIHLQADNFDCRNAATQTEINQCVYQDFQQKDEELNHIYQQYY 64

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            K+E  +++  +++Q+ W  +R   C + A   + G+   M+Y++CL+    ER   L++
Sbjct: 65  AKLEGVRKDQLKQAQLVWINFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTTERISDLKN 124

Query: 116 YL 117
           Y+
Sbjct: 125 YI 126


>gi|330820437|ref|YP_004349299.1| hypothetical protein bgla_2g13410 [Burkholderia gladioli BSR3]
 gi|327372432|gb|AEA63787.1| hypothetical protein bgla_2g13410 [Burkholderia gladioli BSR3]
          Length = 131

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 47/80 (58%)

Query: 47  LEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
           L +TY+ ++ K+ +  +   +++Q  W  +R ++CAF ASG + G+A  M+ + CL    
Sbjct: 50  LNSTYRALVAKLGEPGKTRLKEAQRRWLAWRDAQCAFEASGVDGGSATPMVTSQCLDQLT 109

Query: 107 IERNEKLESYLTCPEGDLLC 126
             +   L+S+L C EGD+ C
Sbjct: 110 QAQTRLLDSHLHCQEGDISC 129


>gi|291569164|dbj|BAI91436.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 219

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +  + CN     A+M +C  + +     KL   Y+++  KV+  +R+    +Q AW  +R
Sbjct: 30  AQGIQCNRNGSMAEMKKCADDDYRAADRKLNEVYQQLTPKVQGEERQRLIAAQRAWIQFR 89

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            + C F ++ A  GT + +++ NCL      R  +L+ Y+
Sbjct: 90  DTNCRFESAEALGGTLEGLLFTNCLTKMTTNRTAELQGYI 129


>gi|119385807|ref|YP_916862.1| hypothetical protein Pden_3085 [Paracoccus denitrificans PD1222]
 gi|119376402|gb|ABL71166.1| protein of unknown function DUF1311 [Paracoccus denitrificans
           PD1222]
          Length = 135

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRGSEC 81
           ++ + QA MN+C   ++      L   + ++ +++  +   R L   SQ AW  +R +EC
Sbjct: 25  DKAVDQASMNRCAAQAYEKSDADLNKYFHEIRQRLADDVDARHLLRDSQRAWITFRDAEC 84

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           AFAAS    G+A  M +  CL     +R  +L  YL C EGD+ CP
Sbjct: 85  AFAASATAGGSAYPMAHDLCLADLTQKRAYELRQYLECEEGDMTCP 130


>gi|282900925|ref|ZP_06308859.1| protein of unknown function DUF1311 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194194|gb|EFA69157.1| protein of unknown function DUF1311 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 139

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH-QRELFEKSQMAWEIYRGSE 80
           NC   + Q DMN C      +   KL   YK+V  +   + + +L   +Q AW  YR + 
Sbjct: 35  NCVNRITQYDMNLCASLDAKVADGKLNQIYKQVRVRYNANPEAKLLIDAQKAWIKYRDAS 94

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           CAF+    + G+   M+Y  CL+    ER ++LESYL
Sbjct: 95  CAFSRGRFQGGSIVPMVYHGCLERLTKERTKELESYL 131


>gi|300864982|ref|ZP_07109813.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300337017|emb|CBN54963.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 227

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 51/100 (51%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + A+ CN      +M +C  +S+A+  +KL   Y++ + K+    +    ++Q AW  +R
Sbjct: 33  AQAVKCNPNGNTLEMRKCASDSYAVADKKLNQVYQQNISKLSGEYKNRLIQAQRAWITFR 92

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            + C F A+ A  GT + ++Y  CL+    ER   L+ Y 
Sbjct: 93  DATCNFEAAEALGGTLEPLLYTGCLERVTSERTAYLQRYF 132


>gi|319781087|ref|YP_004140563.1| hypothetical protein Mesci_1353 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166975|gb|ADV10513.1| hypothetical protein Mesci_1353 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 140

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           MN C G  +     +L   Y+ ++   + + + L + +Q AW  +R +ECA + + +E G
Sbjct: 34  MNICAGEDYQAADARLNTAYQNLISSDDANGKRLLQVAQRAWITFRDAECAHSTAASEGG 93

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           +  SM  + CL     +R ++L +   C EGD  C 
Sbjct: 94  SIHSMEVSQCLTRLTNDRVKQLAAAANCEEGDGSCA 129


>gi|284051526|ref|ZP_06381736.1| hypothetical protein AplaP_08626 [Arthrospira platensis str.
           Paraca]
          Length = 219

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +  + CN      +M +C  + +     KL   Y+++  KV+  +R+    +Q AW  +R
Sbjct: 30  AQGIQCNRNGSMMEMKKCADDDYRAADRKLNEVYQQLTPKVQGEERQRLIAAQRAWIQFR 89

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            + C F ++ A  GT + +++ NCL      R  +L+ Y+
Sbjct: 90  DTNCRFESAEALGGTLEGLLFTNCLTKMTTNRTAELQGYI 129


>gi|77163935|ref|YP_342460.1| hypothetical protein Noc_0404 [Nitrosococcus oceani ATCC 19707]
 gi|254436262|ref|ZP_05049769.1| hypothetical protein NOC27_3325 [Nitrosococcus oceani AFC27]
 gi|76882249|gb|ABA56930.1| hypothetical protein Noc_0404 [Nitrosococcus oceani ATCC 19707]
 gi|207089373|gb|EDZ66645.1| hypothetical protein NOC27_3325 [Nitrosococcus oceani AFC27]
          Length = 205

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 61/112 (54%), Gaps = 5/112 (4%)

Query: 11  IIAIAFQSMALNCNETLM-----QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +++I+++  A    E  M     QA+MN   GN++   + KL+A  +++ E +   +  L
Sbjct: 78  VLSISYEEEAKQVREIEMSTAMTQAEMNIVAGNAYQSAERKLDAILEQIKEFLSPEESAL 137

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +++  AW  Y+ S   F+AS  E G+ Q +IYA+ ++   + R  +LE+ L
Sbjct: 138 LDEANQAWRTYQKSHADFSASQYEGGSIQPLIYASTMETVTVARIVELEAEL 189


>gi|239946946|ref|ZP_04698699.1| putative lipoprotein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921222|gb|EER21246.1| putative lipoprotein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 118

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 4/116 (3%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + IIF    ++    + A++CN  L Q DM+ C    +  V ++L   Y+++L+ +  
Sbjct: 1   MKKAIIFCWLFLSSISCTFAVDCNNALTQGDMHYCADEEYKKVDKELNQIYQEILKHISD 60

Query: 61  HQRE--LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL--QGHAIERNEK 112
            Q +  L +KSQ  W  YR +EC F +     G+   MI   C   +  ++ +N K
Sbjct: 61  KQEQVNLLKKSQNLWIKYREAECEFQSFRVYGGSVYPMILLMCFTKKTKSVSKNLK 116


>gi|300311203|ref|YP_003775295.1| hypothetical protein Hsero_1878 [Herbaspirillum seropedicae SmR1]
 gi|300073988|gb|ADJ63387.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 132

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 54/109 (49%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + A +C +   QA+MN C   +       L ATY    +K+++ ++    + Q+AW  YR
Sbjct: 22  AQAADCTKAATQAEMNACASQTLTQSDADLNATYMAYRDKLDRARQNELREVQLAWLKYR 81

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLC 126
              C F ++ +  G+  + +   CL     +R ++L++   C EGD+ C
Sbjct: 82  DLSCRFESAASAGGSVAATVRQTCLAEKTRQRTDELKALAGCQEGDVAC 130


>gi|213028739|ref|ZP_03343186.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 63

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 32/59 (54%)

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP 
Sbjct: 1   QVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPL 59


>gi|296283721|ref|ZP_06861719.1| hypothetical protein CbatJ_08869 [Citromicrobium bathyomarinum
           JL354]
          Length = 128

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 10/109 (9%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK---VEK------HQRELFEKSQM 71
           ++C+  + Q +MN C G  +     +L A +KK  ++   V+K        REL   +Q 
Sbjct: 20  VDCDNAMTQMEMNVCAGREYQAADRELNAVWKKASQRAKSVDKDVGDGTQHRELL-AAQR 78

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           AW  +R ++C+F A+    G+   +I + CL      R ++L  YL  P
Sbjct: 79  AWLTFRDAQCSFEANQYRGGSIMPLIRSTCLTALTEARTKQLREYLEFP 127


>gi|330986197|gb|EGH84300.1| putative lipoprotein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 128

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           I+ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++   ++
Sbjct: 7   ILAAFIALGIGCSAQAQDCDAN--QASMNQCAANELSALDADLNKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE 123


>gi|330961297|gb|EGH61557.1| lipoprotein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 128

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++     + +   + A +CN    QA MN+C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLATFIALGVGCSAQAEDCNTN--QASMNKCAANELATLDADLNKQYKAQMAWLQTPEKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +  + +Q  W   R ++C + A   E+ G+   ++++ CL G    R ++L++Y+ C E
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVHSQCLAGQTRVRVKQLKAYVACRE 123


>gi|330889878|gb|EGH22539.1| putative lipoprotein [Pseudomonas syringae pv. mori str. 301020]
          Length = 128

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 60/119 (50%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L+  YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAQDCDAN--QASMNQCAANELSALDADLKKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE 123


>gi|71734025|ref|YP_274036.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257484481|ref|ZP_05638522.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|71554578|gb|AAZ33789.1| lipoprotein, putative [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|331013253|gb|EGH93309.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 128

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAQDCDAN--QASMNQCAANELSALDADLNKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE 123


>gi|289626416|ref|ZP_06459370.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649570|ref|ZP_06480913.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298486368|ref|ZP_07004430.1| lipoprotein, putative [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298159096|gb|EFI00155.1| lipoprotein, putative [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|330866340|gb|EGH01049.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 128

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH-QR 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAQDCDAN--QASMNQCAANELSALDADLNKQYKAQMTWLKTSAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE 123


>gi|148653992|ref|YP_001281085.1| hypothetical protein PsycPRwf_2195 [Psychrobacter sp. PRwf-1]
 gi|148573076|gb|ABQ95135.1| protein of unknown function DUF1311 [Psychrobacter sp. PRwf-1]
          Length = 142

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           CN    QA MNQC    +     KL + YK +   +   +++  ++ Q+AW  YR   C 
Sbjct: 40  CNGKYDQASMNQCAQADYKDEDAKLNSAYKTLRSLLNTEEKDQLKQVQLAWISYRDKVCD 99

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           F     + G+   ++ ++CL+ H   R +++E
Sbjct: 100 FENRNEKGGSIYPLLTSSCLKKHTEVRRKQIE 131


>gi|262374117|ref|ZP_06067394.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311128|gb|EEY92215.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 123

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%)

Query: 4  KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
          KII  L +   +  +MA NC++     D   CT   +A     L   Y+++ +K+++ Q+
Sbjct: 3  KIILGLILGVASTFAMANNCDKARNTYDDIYCTNKIYASADADLNKNYQQLRQKLDETQQ 62

Query: 64 ELFEKSQMAWEIYRGSECA 82
          ++ +KSQ+AW  YR +EC 
Sbjct: 63 KILKKSQLAWIRYRDAECT 81


>gi|50083715|ref|YP_045225.1| hypothetical protein ACIAD0471 [Acinetobacter sp. ADP1]
 gi|49529691|emb|CAG67403.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 125

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%)

Query: 4  KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
          K++ A+  + ++  S A NC++T    D   CT   FA   E L   Y+K+  ++ ++Q+
Sbjct: 7  KLLSAVIFLVVSGTSYADNCDKTRNTYDDIYCTNKIFASADEDLNRNYQKLRTQLNQNQK 66

Query: 64 ELFEKSQMAWEIYRGSECA 82
          ++ +KSQ+AW   R  +C 
Sbjct: 67 QILKKSQLAWIRERDEQCV 85


>gi|28869237|ref|NP_791856.1| lipoprotein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28852478|gb|AAO55551.1| lipoprotein, putative [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 128

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAENCDAN--QASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C   
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVAC--R 122

Query: 123 DLLCP 127
           D  CP
Sbjct: 123 DEGCP 127


>gi|331016932|gb|EGH96988.1| lipoprotein, putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 124

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   ++
Sbjct: 3   LLAAFIALGIGCSAQAENCDAN--QASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKK 60

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C   
Sbjct: 61  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVAC--R 118

Query: 123 DLLCP 127
           D  CP
Sbjct: 119 DEGCP 123


>gi|330876103|gb|EGH10252.1| lipoprotein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 128

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A+  + I   + A +C+    QA MN+C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLAAVIALGIGCSAQAEDCDAN--QASMNKCAANKLAALDADLNKQYKAQMAWLQTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C   
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGTPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVAC--R 122

Query: 123 DLLCP 127
           D  CP
Sbjct: 123 DEGCP 127


>gi|302131207|ref|ZP_07257197.1| lipoprotein, putative [Pseudomonas syringae pv. tomato NCPPB 1108]
          Length = 143

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 55/117 (47%), Gaps = 4/117 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   ++
Sbjct: 3   LLAAFIALGIGCSAQAENCDAN--QASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKK 60

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTC 119
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C
Sbjct: 61  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVAC 117


>gi|289810629|ref|ZP_06541258.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
          Length = 57

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 28/52 (53%)

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP 
Sbjct: 2   RDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPL 53


>gi|213967489|ref|ZP_03395637.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
 gi|301386451|ref|ZP_07234869.1| lipoprotein, putative [Pseudomonas syringae pv. tomato Max13]
 gi|213927790|gb|EEB61337.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
          Length = 147

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 55/117 (47%), Gaps = 4/117 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAENCDAN--QASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTC 119
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVAC 121


>gi|330964620|gb|EGH64880.1| lipoprotein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 128

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAEDCDAN--QASMNKCAANKLAALDANLNKQYKAQMAWLQTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C   
Sbjct: 65  QALKDAQQKWIALRDADCLYQAGTPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVAC--R 122

Query: 123 DLLCP 127
           D  CP
Sbjct: 123 DEGCP 127


>gi|241205999|ref|YP_002977095.1| hypothetical protein Rleg_3309 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859889|gb|ACS57556.1| protein of unknown function DUF1311 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 135

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 10/117 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV----------LEK 57
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK           L+ 
Sbjct: 11  AMLLTAGAASAEDVDCNSPKTQSDMTACEAARHEAADKALNAQYKKTRAVLTAIDKDLDG 70

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K   +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+
Sbjct: 71  DRKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELK 127


>gi|116253474|ref|YP_769312.1| hypothetical protein RL3733 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258122|emb|CAK09223.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 135

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 10/117 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV----------LEK 57
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK           L+ 
Sbjct: 11  AMLLTAGAASAQDIDCNNPKTQSDMTGCEAARHETADKALNAQYKKTRAALAAIDKDLDG 70

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K   +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+
Sbjct: 71  DMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELK 127


>gi|150397585|ref|YP_001328052.1| hypothetical protein Smed_2385 [Sinorhizobium medicae WSM419]
 gi|150029100|gb|ABR61217.1| protein of unknown function DUF1311 [Sinorhizobium medicae WSM419]
          Length = 140

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 13/125 (10%)

Query: 10  TIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE-- 67
           T  A A Q    +C + + Q D+N C      +   +L  TY+  +  ++   +EL E  
Sbjct: 15  TAFASAQQQPEPDCRKAVTQTDLNICADKDHRMADAELNTTYRLAVAAMQATDKELGEID 74

Query: 68  -----------KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                      K+Q AW  YR  +C  A   A  G+ + M+ + CL     +R ++L   
Sbjct: 75  AAYVGALEALKKAQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRTDELRKI 134

Query: 117 LTCPE 121
           +   E
Sbjct: 135 VESAE 139


>gi|119486568|ref|ZP_01620618.1| hypothetical protein L8106_12495 [Lyngbya sp. PCC 8106]
 gi|119456185|gb|EAW37317.1| hypothetical protein L8106_12495 [Lyngbya sp. PCC 8106]
          Length = 141

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 58/113 (51%), Gaps = 4/113 (3%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-EL 65
           FA  +  I   S  + C E     +M +C  + ++ +  +L  TY+ ++ K++ +QR + 
Sbjct: 27  FAAPVTQI---SQTIECREDGSMIEMKKCAQDKYSKIDRQLNQTYQTLMAKLDDNQRKQR 83

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
              +Q +W  +R   C++ AS A  G+ + ++  NCL     +R  +L+ Y++
Sbjct: 84  LISAQRSWIQFRDKSCSYEASEALGGSLEGLLLTNCLTRVTDQRTSELKEYVS 136


>gi|19070375|gb|AAL83828.1|AF347070_5 urease-associated hypothetical protein [Rhizobium leguminosarum bv.
           viciae]
          Length = 135

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 10/117 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV----------LEK 57
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK           L+ 
Sbjct: 11  AMLLTAGAASAQDIDCNNPKTQSDMTGCEAARHEAADKVLNAQYKKTRAAMVAIDKDLDG 70

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K   +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+
Sbjct: 71  DMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELK 127


>gi|152981983|ref|YP_001355294.1| hypothetical protein mma_3604 [Janthinobacterium sp. Marseille]
 gi|151282060|gb|ABR90470.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 3/88 (3%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA 88
           Q  MN C  + +    + L   YKK++ + E   ++    +Q AW  +R  +C  A +G 
Sbjct: 35  QLTMNMCASHRYTTADKALNQQYKKLMVQQEAVGKQRLRDAQRAWISFRDKDC-LANTGL 93

Query: 89  EE--GTAQSMIYANCLQGHAIERNEKLE 114
            E  G+   +++ +CL+ H ++R E L+
Sbjct: 94  REESGSIWPLLHYSCLERHTVQRTEDLK 121


>gi|330818529|ref|YP_004362234.1| hypothetical protein bgla_1g36750 [Burkholderia gladioli BSR3]
 gi|327370922|gb|AEA62278.1| hypothetical protein bgla_1g36750 [Burkholderia gladioli BSR3]
          Length = 118

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 58/118 (49%), Gaps = 6/118 (5%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +KII +L ++ I   + A  C       D   CT  + A  K+ L A Y+K+    + +Q
Sbjct: 2   KKIICSLLLL-IPLSAFAETCTGNGTVYDDLTCTNRTLAEAKKNLNAIYQKIYASTQ-YQ 59

Query: 63  RELFEKSQMAWEIYRGSEC---AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            E FE+SQ AW  YR  +C     AA+   +G   ++I  +CL     +R + L++ L
Sbjct: 60  AE-FEQSQKAWLNYRDQQCNGYLAAAASQSQGEGPALIVRDCLAELTRQRVDYLKTLL 116


>gi|291569332|dbj|BAI91604.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 215

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA 88
           QAD++ C    +     +L +TY+++   +   +R+   ++Q+AW  +R ++C+F +S  
Sbjct: 40  QADLSACAIEKYRNADAQLNSTYQRLTSMISADRRQKLVQAQLAWIQFRDNQCSFVSSAT 99

Query: 89  EEGTAQSM---IYANCL----QGHAIERNEKLESYLTCP 120
             G   SM   I  +CL    Q    + N  ++S L  P
Sbjct: 100 RGGRGGSMSPVIVYSCLTLLTQNRTNDFNHYIQSQLPKP 138


>gi|159185199|ref|NP_355355.2| hypothetical protein Atu2403 [Agrobacterium tumefaciens str. C58]
 gi|159140464|gb|AAK88140.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 139

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR----------ELFEKSQM 71
           +C     QADM  C G       ++L A Y+K+ +++ +  +          +    +Q 
Sbjct: 31  DCKAPQTQADMTICAGKDHEKADKELNAAYQKLRKQLAERDKTADASGKGANDALVMAQR 90

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           AW  +R + CA A   A  G+ + M+ A+CL   + +R ++L 
Sbjct: 91  AWVAFRDANCALAGFQARGGSMEPMLIASCLADMSSKRADELR 133


>gi|300698080|ref|YP_003748741.1| hypothetical protein RCFBP_mp30284 [Ralstonia solanacearum
           CFBP2957]
 gi|299074804|emb|CBJ54369.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
          Length = 239

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQMAWEIYRGSECAFAASG 87
           +A +N C+        + L A Y  +L K+          K+QMAW  +R  +C + AS 
Sbjct: 140 EATINVCSEYHLVEADQLLNAAYTNLLTKMRGTTSYTPLVKAQMAWTRFRDLDCEYYASS 199

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
              G        NC +   + R  ++ESYL C
Sbjct: 200 LVGGAMHGQWVMNCQRERTVARTRQIESYLRC 231


>gi|207738961|ref|YP_002257354.1| hypothetical protyein transmembrane protein [Ralstonia solanacearum
           IPO1609]
 gi|206592332|emb|CAQ59238.1| hypothetical protyein transmembrane protein [Ralstonia solanacearum
           IPO1609]
          Length = 155

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 3/100 (3%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQMAWEIYRGSECAFAASG 87
           ++ +N C+        + L A Y  +L K+          K+QMAW  +R  +C + AS 
Sbjct: 56  ESTINVCSEYHLVEADQLLNAAYANLLTKMRGTTSYAPLVKAQMAWTRFRDLDCEYYASS 115

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
              GT       NC +   + R  ++ESYL C      CP
Sbjct: 116 LVGGTMHGQWVMNCQRERTVARTRQIESYLRCEASG--CP 153


>gi|213027655|ref|ZP_03342102.1| putative secreted protein [Salmonella enterica subsp. enterica
          serovar Typhi str. 404ty]
          Length = 75

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 4  KIIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
          K IF LT  A+ F S AL   C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 2  KRIF-LTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62 QRELFEKSQMAWE 74
          QREL +K+Q+A +
Sbjct: 61 QRELLQKAQVAVD 73


>gi|325293753|ref|YP_004279617.1| hypothetical protein AGROH133_08201 [Agrobacterium sp. H13-3]
 gi|325061606|gb|ADY65297.1| hypothetical protein AGROH133_08201 [Agrobacterium sp. H13-3]
          Length = 136

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 10/103 (9%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK----------SQM 71
           +C     QADM  C G  +    ++L A Y+KV +++ +  +   E           +Q 
Sbjct: 28  DCTSPQTQADMTICAGKDYEKADKQLNAAYQKVRKQLAERDKTADESGKGAVDALVAAQR 87

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           AW  +R + C      A  GT + M+ ++CL   + +R ++L 
Sbjct: 88  AWVAFRDANCDAFGFQARGGTMEPMLVSSCLADMSNKRADELR 130


>gi|330897677|gb|EGH29096.1| hypothetical protein PSYJA_08965 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 128

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 57/119 (47%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCDAN--QASMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           + F+ +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 65  QAFKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE 123


>gi|227823040|ref|YP_002827012.1| putative urease-associated protein [Sinorhizobium fredii NGR234]
 gi|227342041|gb|ACP26259.1| putative urease-associated protein [Sinorhizobium fredii NGR234]
          Length = 139

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 5   IIFALTIIAIAF-QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           I   L +   AF Q   ++C +   Q D+N C    +      L  TY K +  + +  +
Sbjct: 8   IGLLLVLATSAFAQEPEVDCQKAETQMDLNICADREYQAADADLNKTYGKAIAAMRETDK 67

Query: 64  EL-------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           EL              +K+Q AW  YR  +C  A   A  G+ + M+ + CL     +R 
Sbjct: 68  ELGDIDAAYVGAVEALKKAQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRT 127

Query: 111 EKLESYL 117
            +L+  L
Sbjct: 128 AELKELL 134


>gi|15966225|ref|NP_386578.1| hypothetical protein SMc02046 [Sinorhizobium meliloti 1021]
 gi|307308576|ref|ZP_07588278.1| protein of unknown function DUF1311 [Sinorhizobium meliloti BL225C]
 gi|307317354|ref|ZP_07596794.1| protein of unknown function DUF1311 [Sinorhizobium meliloti AK83]
 gi|1176943|sp|P42879|Y2472_RHIME RecName: Full=Uncharacterized protein R02472
 gi|545800|gb|AAB30137.1| orf5 3' of ureB [Sinorhizobium meliloti]
 gi|15075495|emb|CAC47051.1| Hypothetical protein SMc02046 [Sinorhizobium meliloti 1021]
 gi|306896943|gb|EFN27689.1| protein of unknown function DUF1311 [Sinorhizobium meliloti AK83]
 gi|306900976|gb|EFN31585.1| protein of unknown function DUF1311 [Sinorhizobium meliloti BL225C]
          Length = 139

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 13/113 (11%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-------------FEK 68
           +C + + Q D+N C    +     +L  TY+ V+  ++   +EL              +K
Sbjct: 26  DCRKAVSQMDLNICADQDYRAADAELNKTYRLVVAAMQATDKELGDIDAAYAGALEALKK 85

Query: 69  SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +Q AW  YR  +C  A   A  G+ + M+ + CL     +R  +L+  +   E
Sbjct: 86  AQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRTAELKELMESAE 138


>gi|218660911|ref|ZP_03516841.1| probable urease-associated protein [Rhizobium etli IE4771]
          Length = 135

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 43/104 (41%), Gaps = 10/104 (9%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKV----------LEKVEKHQRELFEKSQ 70
           ++C     Q+DM  C         + L A YKK           L+   K   E   K+Q
Sbjct: 24  IDCQNPKTQSDMTSCEAARHETADKALNAQYKKTRAALAAIDKDLDGDMKGAEEALVKAQ 83

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            AW  YR +EC      A  GT + M+ A CL     +R ++L+
Sbjct: 84  RAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELK 127


>gi|302058656|ref|ZP_07250197.1| lipoprotein, putative [Pseudomonas syringae pv. tomato K40]
          Length = 131

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 4/104 (3%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQMAWEIY 76
           + A NC+    QA MN C  N  A +   L   YK  +  ++   +++  + +Q  W   
Sbjct: 4   AQAENCDAN--QASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKKQALKDAQQKWIAL 61

Query: 77  RGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTC 119
           R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C
Sbjct: 62  RDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVAC 105


>gi|260551396|ref|ZP_05825596.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260405559|gb|EEW99051.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 132

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/119 (19%), Positives = 55/119 (46%), Gaps = 1/119 (0%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +I +    ++ F  +   C+    Q+ +N C+ N      +K+ + Y   ++++   ++ 
Sbjct: 10  LIMSTITCSVTFAGID-KCSNLPNQSALNTCSSNVLNSANQKINSVYANYMKELNPTEKL 68

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
             +++Q AW  Y+  +C F +S   +G+    ++  CL      R ++L+    C  G+
Sbjct: 69  QLKEAQRAWIQYKEKDCQFQSSPVLKGSLYPFVHNACLVEKTENRIKELQDMQECRSGN 127


>gi|325520864|gb|EGC99854.1| hypothetical protein B1M_34534 [Burkholderia sp. TJI49]
          Length = 147

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 6/118 (5%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +KI F L  + +   S A  C +T    D   C        K+ L + Y+K+    + ++
Sbjct: 30  KKIAF-LVFLMLPATSFAGTCADTANGHDDFSCVSRELENSKKDLNSIYQKIYSSTQ-YK 87

Query: 63  RELFEKSQMAWEIYRGSEC---AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           RE FE+SQ AW  YR  +C     A +   +GT   +I  +CL     +R + L++ L
Sbjct: 88  RE-FEQSQKAWLSYREKQCNGYIAAEASQSQGTGPGLITKDCLLTITRQRADYLKTLL 144


>gi|222111005|ref|YP_002553269.1| hypothetical protein Dtpsy_1812 [Acidovorax ebreus TPSY]
 gi|221730449|gb|ACM33269.1| protein of unknown function DUF1311 [Acidovorax ebreus TPSY]
          Length = 142

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 39/100 (39%), Gaps = 2/100 (2%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           + N C    +       +  Y  V+  +  H+R    + Q AW+  R ++C  A   AE 
Sbjct: 43  ETNACAVQRYQEADTATQILYGDVMRALSAHERPTLRQDQAAWQRTRAAQCKQAQRAAES 102

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN 130
                 +Y +CL  H   R + L  +L    G+   P  N
Sbjct: 103 RPEWPRLYHDCLTVHTQARRDALMHWLH--HGEAPQPTTN 140


>gi|295690840|ref|YP_003594533.1| hypothetical protein Cseg_3485 [Caulobacter segnis ATCC 21756]
 gi|295432743|gb|ADG11915.1| protein of unknown function DUF1311 [Caulobacter segnis ATCC 21756]
          Length = 133

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEK-HQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           M QC      +   +L   Y+  ++++++  QR   +K+Q AW  YR ++CA +    + 
Sbjct: 45  MIQCAAAELKVQDARLNRAYQDAMKRLDQPRQRAALKKAQRAWIAYRDADCA-SVYDPDW 103

Query: 91  GTAQSMIYANCLQGHAIERNEKLESY 116
           GT   +    CL  H   R + LE Y
Sbjct: 104 GTLARIEANACLLDHTARRADALEMY 129


>gi|121594364|ref|YP_986260.1| hypothetical protein Ajs_2008 [Acidovorax sp. JS42]
 gi|120606444|gb|ABM42184.1| protein of unknown function DUF1311 [Acidovorax sp. JS42]
          Length = 142

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 39/100 (39%), Gaps = 2/100 (2%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           + N C    +       +  Y  V+  +  H+R    + Q AW+  R ++C  A   AE 
Sbjct: 43  ETNACAVQRYQEADTATQILYGDVMRALSAHERPALRQDQAAWQRTRAAQCKQAQRAAES 102

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN 130
                 +Y +CL  H   R + L  +L    G+   P  N
Sbjct: 103 RPEWPRLYHDCLTVHTQARRDALMHWLH--HGEAPQPTTN 140


>gi|190893132|ref|YP_001979674.1| urease-associated protein [Rhizobium etli CIAT 652]
 gi|190698411|gb|ACE92496.1| probable urease-associated protein [Rhizobium etli CIAT 652]
          Length = 135

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 42/104 (40%), Gaps = 10/104 (9%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKV----------LEKVEKHQRELFEKSQ 70
           ++C     Q+DM  C         + L A YKK           L+   K   +   K+Q
Sbjct: 24  IDCQNPKTQSDMTSCEAARHETADKALNAQYKKTRAALAAIDKDLDGDMKGAEQALVKAQ 83

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            AW  YR +EC      A  GT + M+ A CL      R ++L+
Sbjct: 84  RAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDRRTKELK 127


>gi|34580972|ref|ZP_00142452.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262357|gb|EAA25861.1| unknown [Rickettsia sibirica 246]
          Length = 108

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 31/105 (29%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRGSECAFA 84
           ++Q DMN C    +  V  KL   Y+++L+ +  ++ Q  L +KS   W  YR +     
Sbjct: 1   MIQGDMNYCVAAEYKKVDTKLNQIYQEILKHISDKREQVNLLKKSPNLWIKYRDA----- 55

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
                                     ++ E+ L C EGDL CPFI
Sbjct: 56  ------------------------YKKEFEAMLKCEEGDLSCPFI 76


>gi|241766505|ref|ZP_04764371.1| protein of unknown function DUF1311 [Acidovorax delafieldii 2AN]
 gi|241363275|gb|EER58825.1| protein of unknown function DUF1311 [Acidovorax delafieldii 2AN]
          Length = 138

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 35/88 (39%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           + N C   +F     ++   Y  V+  +  H+R    + Q AW+  R + C  A   AE 
Sbjct: 43  ETNACAVQAFQAADTQMAILYGDVMRALSAHERPQLRQEQTAWQRERTTRCKQATRNAES 102

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
                 +Y  CL      R + L  +LT
Sbjct: 103 APHGPRLYHECLAAETQARRKDLMRWLT 130


>gi|115359025|ref|YP_776163.1| hypothetical protein Bamb_4276 [Burkholderia ambifaria AMMD]
 gi|115284313|gb|ABI89829.1| protein of unknown function DUF1311 [Burkholderia ambifaria AMMD]
          Length = 129

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
          FAL  +A+ F + A  C +     D   C+ N F+ +  +L   Y +V + +   Q+   
Sbjct: 10 FALLGLAVPFAAQAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKHLSGDQQAKL 69

Query: 67 EKSQMAWEIYRGSECA 82
          + SQ+AW   R   C+
Sbjct: 70 KTSQLAWMKQRDDRCS 85


>gi|332290774|ref|YP_004429383.1| hypothetical protein Krodi_0127 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332168860|gb|AEE18115.1| hypothetical protein Krodi_0127 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 370

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE--KVEKHQRELFEK 68
           I+AI   ++  NC  +  QA+MN+     +    ++L   Y+K+L   +++    +  +K
Sbjct: 93  ILAILILTLTFNCF-SQTQAEMNKNANKEYRKADKELNIVYQKILSEYQLDSFFIDRLKK 151

Query: 69  SQMAWEIYRGSEC--AFAASG--AEEGTAQSMIYANCLQGHAIERNEKLESYLT-CPEGD 123
           +Q  W  YR +E    F A    AE G+   M  +  L+   +ER EKL  +L    EG+
Sbjct: 152 TQRIWNSYRDAELEMKFPADNKQAEYGSVYPMCVSLFLKELTVERTEKLRVWLNGIEEGN 211

Query: 124 L 124
           +
Sbjct: 212 M 212


>gi|319793061|ref|YP_004154701.1| hypothetical protein Varpa_2388 [Variovorax paradoxus EPS]
 gi|315595524|gb|ADU36590.1| hypothetical protein Varpa_2388 [Variovorax paradoxus EPS]
          Length = 130

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 45/111 (40%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + AL   +    + A +CN    Q  MN C    F     +L   Y  V++ +    R  
Sbjct: 15  VLALLAGSAQAAADADDCNPNGNQQQMNACAARDFRAADAELNIRYGDVMKTLSPQMRVA 74

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               Q AW   R   C  A+   E G+   ++++ CL+    +R  +L+ +
Sbjct: 75  LRNDQRAWLKGRDPACKRASKANEGGSIWPLVFSTCLEKSTRKRTAELDRW 125


>gi|209550629|ref|YP_002282546.1| hypothetical protein Rleg2_3053 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536385|gb|ACI56320.1| protein of unknown function DUF1311 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 135

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 49/120 (40%), Gaps = 10/120 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV---------- 54
           I  A+ + A +  +  ++C     Q+DM  C         + L   YKK           
Sbjct: 8   IGAAMLLSAGSASAQDVDCQNPKTQSDMTSCEAARHDTADKALNVQYKKTRAALAAVDKD 67

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           L+   K   +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+
Sbjct: 68  LDGDMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELK 127


>gi|289679641|ref|ZP_06500531.1| hypothetical protein PsyrpsF_40462 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 128

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 55/119 (46%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  +    ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCDAN--QASMNRCAANEQAALDADLNKQYNAQMAWLRTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE 123


>gi|325271594|ref|ZP_08138101.1| hypothetical protein G1E_02228 [Pseudomonas sp. TJI-51]
 gi|324103274|gb|EGC00614.1| hypothetical protein G1E_02228 [Pseudomonas sp. TJI-51]
          Length = 128

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M++C G    +  ++L   YK+++ K++  Q++     Q  W +YR   C F    A  G
Sbjct: 40  MSECIGAETQVQDQRLNRVYKQLMGKLDAGQQKSLRDVQRKWLVYRDGNCQFHVQ-ASGG 98

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           T   +    C+     +R  +LE  L+
Sbjct: 99  TMAQLEGGTCMMSMTRDRAAELERVLS 125


>gi|239816230|ref|YP_002945140.1| hypothetical protein Vapar_3256 [Variovorax paradoxus S110]
 gi|239802807|gb|ACS19874.1| protein of unknown function DUF1311 [Variovorax paradoxus S110]
          Length = 130

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 38/97 (39%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
            L+C     Q  MN C    F      L   Y +V++ +    R      Q  W   R  
Sbjct: 29  PLDCRPDGNQQQMNACAVRDFRAADAALNIRYGEVMKTLSPQMRVALRTEQRTWLKGRDP 88

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            C  A+   E G+   +++ +CL+    +R  +L+ +
Sbjct: 89  SCKRASKANEGGSIWPLVFNSCLEKSTRQRTAELDRW 125


>gi|89054239|ref|YP_509690.1| hypothetical protein Jann_1748 [Jannaschia sp. CCS1]
 gi|88863788|gb|ABD54665.1| protein of unknown function DUF1311 [Jannaschia sp. CCS1]
          Length = 119

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 40/95 (42%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+    Q D+++C     A   E L   Y++V++ ++        ++Q AW  YR   C 
Sbjct: 23  CDPNQPQIDLSECHAREAARWDELLNIIYRRVIQTLDADGEVRLREAQRAWITYRDLTCE 82

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                   G+   MI + C+     +R   LE Y+
Sbjct: 83  MERMRYAGGSIAPMIQSQCVARLTEQRTRDLELYM 117


>gi|302185085|ref|ZP_07261758.1| hypothetical protein Psyrps6_02039 [Pseudomonas syringae pv.
           syringae 642]
          Length = 128

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 56/119 (47%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCDAN--QASMNRCAANEQAALDADLNKQYNVQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE 123


>gi|330981962|gb|EGH80065.1| hypothetical protein PSYAP_25959 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 128

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
           ++  A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   +
Sbjct: 6   RLYRAFIALGIGCSAQAEDCDAN--QASMNRCAANEQAALDADLNKQYNAQMAWLKTPAK 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 64  KQALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE 123


>gi|313497188|gb|ADR58554.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 128

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           MN C G    +  ++L   YK+++ K++  Q++     Q  W  YR   C F    A  G
Sbjct: 40  MNACIGAETQVQDQRLNRVYKQLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFHVQ-ASGG 98

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           T   +   +C+     +R  +LE  L+
Sbjct: 99  TLAQLEGGSCIMDMTRDRAAELERVLS 125


>gi|114562839|ref|YP_750352.1| hypothetical protein Sfri_1663 [Shewanella frigidimarina NCIMB 400]
 gi|114334132|gb|ABI71514.1| protein of unknown function DUF1311 [Shewanella frigidimarina NCIMB
           400]
          Length = 137

 Score = 41.2 bits (95), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%)

Query: 47  LEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
           L+  Y+ +LE ++K  ++    +Q  W  Y  ++C F +  ++EG         C   H 
Sbjct: 57  LDKKYQTLLEYLKKPDKDRLVDAQNKWIKYVTADCLFYSPTSKEGDYSYTYNVGCRLTHK 116

Query: 107 IERNEKLESY 116
           ++R EKLE Y
Sbjct: 117 LQRLEKLEDY 126


>gi|223934928|ref|ZP_03626847.1| protein of unknown function DUF1311 [bacterium Ellin514]
 gi|223896381|gb|EEF62823.1| protein of unknown function DUF1311 [bacterium Ellin514]
          Length = 138

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 8/107 (7%)

Query: 9   LTIIAIA-------FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           LT+ A+A        Q +  N ++   Q + N  +         KL  T +K+  ++ + 
Sbjct: 12  LTVAALAGEPSDSNLQQLKNNLDQAKTQTETNLTSKAIADFWDAKLLRTERKIESRLNRQ 71

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
           + + F +++  W+ YR SE +F A  +E G+ Q +I AN    H  E
Sbjct: 72  EHKKFLQTKKLWQKYRSSEVSFRAGFSEGGSIQPLI-ANSTYSHITE 117


>gi|330955391|gb|EGH55651.1| hypothetical protein PSYCIT7_29416 [Pseudomonas syringae Cit 7]
          Length = 128

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 57/119 (47%), Gaps = 4/119 (3%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    +A MN+C  N  A +  +L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCDAN--RASMNRCAANQQAALDAELNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE 123


>gi|169797328|ref|YP_001715121.1| hypothetical protein ABAYE3355 [Acinetobacter baumannii AYE]
 gi|184156750|ref|YP_001845089.1| hypothetical protein ACICU_00430 [Acinetobacter baumannii ACICU]
 gi|213155858|ref|YP_002317903.1| hypothetical protein AB57_0499 [Acinetobacter baumannii AB0057]
 gi|215484765|ref|YP_002327000.1| hypothetical protein ABBFA_003114 [Acinetobacter baumannii
          AB307-0294]
 gi|239500848|ref|ZP_04660158.1| hypothetical protein AbauAB_00905 [Acinetobacter baumannii AB900]
 gi|301346431|ref|ZP_07227172.1| hypothetical protein AbauAB0_09302 [Acinetobacter baumannii
          AB056]
 gi|301511757|ref|ZP_07236994.1| hypothetical protein AbauAB05_09265 [Acinetobacter baumannii
          AB058]
 gi|301594284|ref|ZP_07239292.1| hypothetical protein AbauAB059_00695 [Acinetobacter baumannii
          AB059]
 gi|332852973|ref|ZP_08434483.1| hypothetical protein HMPREF0021_02065 [Acinetobacter baumannii
          6013150]
 gi|332866407|ref|ZP_08436991.1| hypothetical protein HMPREF0020_00597 [Acinetobacter baumannii
          6013113]
 gi|332873162|ref|ZP_08441119.1| hypothetical protein HMPREF0022_00724 [Acinetobacter baumannii
          6014059]
 gi|169150255|emb|CAM88151.1| conserved hypothetical protein; putative exported protein
          [Acinetobacter baumannii AYE]
 gi|183208344|gb|ACC55742.1| uncharacterized protein conserved in bacteria [Acinetobacter
          baumannii ACICU]
 gi|213055018|gb|ACJ39920.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213988005|gb|ACJ58304.1| conserved hypothetical protein [Acinetobacter baumannii
          AB307-0294]
 gi|322506642|gb|ADX02096.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323516517|gb|ADX90898.1| hypothetical protein ABTW07_0461 [Acinetobacter baumannii
          TCDC-AB0715]
 gi|332728909|gb|EGJ60264.1| hypothetical protein HMPREF0021_02065 [Acinetobacter baumannii
          6013150]
 gi|332734633|gb|EGJ65739.1| hypothetical protein HMPREF0020_00597 [Acinetobacter baumannii
          6013113]
 gi|332738674|gb|EGJ69544.1| hypothetical protein HMPREF0022_00724 [Acinetobacter baumannii
          6014059]
          Length = 122

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 1/80 (1%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          +KI+FA     I     A NC+      D   CT   +A     L   Y+ +  K+   Q
Sbjct: 2  KKIVFAFLCFGIT-TVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRAKLNTAQ 60

Query: 63 RELFEKSQMAWEIYRGSECA 82
          R   +KSQ+AW   R +EC 
Sbjct: 61 RNTLKKSQLAWIRQRDAECT 80


>gi|152992409|ref|YP_001358130.1| hypothetical protein SUN_0815 [Sulfurovum sp. NBC37-1]
 gi|151424270|dbj|BAF71773.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 120

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 37/87 (42%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           D  QC  + +    ++L A Y+ V   + K +     K+Q AW  +R  EC F A     
Sbjct: 33  DWMQCAYHEYDYRDKQLNAVYRHVKNHLPKEEIPNLIKAQRAWITFRDRECCFEAYEMRG 92

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYL 117
           G+A+      C      ER + L + L
Sbjct: 93  GSAEKQFTIGCKIALTRERVQSLRTLL 119


>gi|104780210|ref|YP_606708.1| hypothetical protein PSEEN0989 [Pseudomonas entomophila L48]
 gi|95109197|emb|CAK13894.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 128

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C      L  ++L   YK+++ K+E  Q++   + Q +W  YR   CAF  +    G
Sbjct: 40  MGACIQAETKLQDDRLNRVYKQLMSKLEPQQQKDLREVQRSWVKYRDGNCAFHGT-LSNG 98

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           +   +  A CL   + +R  +LE  L+
Sbjct: 99  SLYRIEGAMCLMDMSKDRAAELERVLS 125


>gi|50121103|ref|YP_050270.1| hypothetical protein ECA2175 [Pectobacterium atrosepticum SCRI1043]
 gi|49611629|emb|CAG75077.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 132

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 16/127 (12%)

Query: 3   RKIIFALTIIA---IAFQSMALNCNETLMQADMNQCT-----------GNSFALVKEKLE 48
           +KI+ A  ++A   ++    A +C      A+++ C              +++  K ++ 
Sbjct: 2   KKILIAAAMLAGMSVSTSLWAADCANPSASAEVDSCAKQGKEATEQALNKAWSEAKGRIT 61

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG-TAQSMIYANCLQGHAI 107
            TYK   +K++K  ++    SQ  W  YR S+C   A  AEEG TA   +  NC+     
Sbjct: 62  TTYK-ADDKLQKEYQQNLVDSQRGWLKYRDSQCKMQAFLAEEGTTAHDTLTNNCISDIDK 120

Query: 108 ERNEKLE 114
           +R E+L+
Sbjct: 121 QRIEQLK 127


>gi|260549157|ref|ZP_05823378.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260407885|gb|EEX01357.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 123

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          +KI+ AL          A NC+ T    D   CT   +A     L   Y+ +  K+   Q
Sbjct: 2  KKILLALLCSFGVTAVYADNCDTTRNTYDDIYCTNKIYASADADLNKNYQALRAKLNTAQ 61

Query: 63 RELFEKSQMAWEIYRGSECA 82
          R   +KSQ+AW   R +EC 
Sbjct: 62 RNTLKKSQLAWIRQRDAECT 81


>gi|118591404|ref|ZP_01548802.1| probable urease-associated protein [Stappia aggregata IAM 12614]
 gi|118436076|gb|EAV42719.1| probable urease-associated protein [Stappia aggregata IAM 12614]
          Length = 140

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 44/109 (40%), Gaps = 14/109 (12%)

Query: 6   IFALTII---AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--- 59
           +F L ++    +A Q    NC   + Q++M QC    +     +L A Y+  +EK+    
Sbjct: 12  LFGLGLVLAGPVAAQETP-NCENAMTQSEMTQCANLDWLRADAELNAVYRSAMEKMTETD 70

Query: 60  -------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANC 101
                  K   E   ++Q AW  YR   C      A  GT + M+   C
Sbjct: 71  AYLPEGLKGAVETLREAQRAWIPYRDKACDAYGFLARGGTMEPMLVYGC 119


>gi|86358906|ref|YP_470798.1| urease-associated protein [Rhizobium etli CFN 42]
 gi|86283008|gb|ABC92071.1| probable urease-associated protein [Rhizobium etli CFN 42]
          Length = 134

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 46/117 (39%), Gaps = 10/117 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV----------LEK 57
           A+  +     +  ++C     Q+DM  C         + L   YKK           L+ 
Sbjct: 10  AMLFVVDGASAQDVDCKNPQTQSDMTSCEEARHEAADKALNEQYKKTRAAMAAIDKDLDG 69

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K   +   K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+
Sbjct: 70  DMKGAEKALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLAEETDKRTKELK 126


>gi|260556216|ref|ZP_05828435.1| conserved hypothetical protein [Acinetobacter baumannii ATCC
          19606]
 gi|260410271|gb|EEX03570.1| conserved hypothetical protein [Acinetobacter baumannii ATCC
          19606]
          Length = 122

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 1/80 (1%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          +KI+FA     I     A NC+      D   CT   +A     L   Y+ +  K+   Q
Sbjct: 2  KKIVFAFLCFGIT-AVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRAKLNTVQ 60

Query: 63 RELFEKSQMAWEIYRGSECA 82
          R   ++SQ+AW   R +EC 
Sbjct: 61 RNTLKRSQLAWIRQRDAECT 80


>gi|288947728|ref|YP_003445111.1| protein of unknown function DUF1311 [Allochromatium vinosum DSM
           180]
 gi|288898244|gb|ADC64079.1| protein of unknown function DUF1311 [Allochromatium vinosum DSM
           180]
          Length = 131

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           +M  C G        +L   Y+K+  ++   +R+  + +Q  W  YR + C F     E 
Sbjct: 41  EMLDCIGEELNTQDARLNGAYQKLRAQLSAERRKALQSAQRLWIQYRDANCDFYLD-PEG 99

Query: 91  GTAQSMIYANCLQGHAIERNEKLES 115
           GT   ++ A+C+     ER ++LE 
Sbjct: 100 GTLHRVMAADCVLRETAERAKELEG 124


>gi|26987557|ref|NP_742982.1| hypothetical protein PP_0821 [Pseudomonas putida KT2440]
 gi|24982231|gb|AAN66446.1|AE016274_3 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 136

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M+ C G    +  ++L   YK+++ K++  Q++     Q  W  YR   C F    A  G
Sbjct: 48  MSACIGAETQVQDQRLNRVYKQLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFHVQ-ASGG 106

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           T   +   +C+     +R  +LE  L+
Sbjct: 107 TLAQLEGGSCIMDMTRDRAAELERVLS 133


>gi|320353026|ref|YP_004194365.1| hypothetical protein Despr_0900 [Desulfobulbus propionicus DSM
           2032]
 gi|320121528|gb|ADW17074.1| hypothetical protein Despr_0900 [Desulfobulbus propionicus DSM
           2032]
          Length = 130

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           +M +C G       E+L   YK+V+ ++ + +++  + +Q AW  +R + C F A   + 
Sbjct: 44  EMIECIGAETKRQDERLNKAYKEVMAQLSETRQKQLQDAQRAWIKFRDAHCHFHAD-PDG 102

Query: 91  GTAQSMIYANCLQGHAIERNEKLESY 116
           GT  ++   +C       R ++LE +
Sbjct: 103 GTMATVRTNDCFLSATASRAQELEGF 128


>gi|312114324|ref|YP_004011920.1| hypothetical protein Rvan_1569 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219453|gb|ADP70821.1| hypothetical protein Rvan_1569 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 128

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQ-----RELFEKSQMAWEIYRGSECAFAASGA 88
            C G  F     +L   YK +LEK          R    +SQ AW  +R + C +  S  
Sbjct: 41  DCIGRDFERNDAELNRIYKTLLEKNSSEDDAQEIRGRLIESQRAWLKFRDTNCNWRGSVM 100

Query: 89  EEGTAQSMIYANCLQGHAIERNEKLES 115
             GT + +I + C+    I+R ++L++
Sbjct: 101 LGGTGEKVIVSGCVNQMTIDRVKELKA 127


>gi|254501058|ref|ZP_05113209.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222437129|gb|EEE43808.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 137

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 49/129 (37%), Gaps = 16/129 (12%)

Query: 3   RKIIFALTIIAI------AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           R ++ +L ++A       A Q+  +NC E   Q DM  C    +     +L A YK  + 
Sbjct: 2   RFLVVSLAVVAFGAALPPAVQAQDVNCKEPQTQLDMTICAKKDWEAADAELNAAYKTAMA 61

Query: 57  KVE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
            ++          K   E    +Q AW  +R   C      A  G+ + M+   C     
Sbjct: 62  AMKQTDSYLSDDLKGAAETLTTAQRAWIPFRDKACESYGFLARGGSMEPMLVLQCRADLT 121

Query: 107 IERNEKLES 115
            +R  +L+ 
Sbjct: 122 RQRTSQLKD 130


>gi|328541728|ref|YP_004301837.1| urease-associated protein [polymorphum gilvum SL003B-26A1]
 gi|326411480|gb|ADZ68543.1| Probable urease-associated protein [Polymorphum gilvum SL003B-26A1]
          Length = 139

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 55/134 (41%), Gaps = 15/134 (11%)

Query: 4   KIIFALTIIAIAFQSMA---LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +++ A+ ++  A  + A   ++C   L Q ++  C   ++      L A Y++ + ++ +
Sbjct: 5   RLVLAIALLLPAGAARAQETIDCGYPLSQMELTYCAEKAWEAADADLNAAYREAMARMRE 64

Query: 61  HQREL------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
               L             +++Q AW  YR   CA     A  GT +  +   CL    + 
Sbjct: 65  MDANLADMPDLQGAAEALKEAQRAWIPYRDKACAAYGFLARGGTMEPQLIYGCLATLTVR 124

Query: 109 RNEKLESYLTCPEG 122
           R E+L+      EG
Sbjct: 125 RAEELKDLAAGIEG 138


>gi|293610217|ref|ZP_06692518.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827449|gb|EFF85813.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124395|gb|ADY83918.1| hypothetical protein BDGL_003332 [Acinetobacter calcoaceticus
          PHEA-2]
          Length = 124

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M +KI FA           A NC+      D   CT   +A     L   Y+ +  K+  
Sbjct: 1  MMKKIFFAFLCSFGVTSVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRVKLNT 60

Query: 61 HQRELFEKSQMAWEIYRGSECA 82
           Q+ + +KSQ+AW   R +EC 
Sbjct: 61 AQKNILKKSQLAWIRQRDAECT 82


>gi|148546092|ref|YP_001266194.1| hypothetical protein Pput_0848 [Pseudomonas putida F1]
 gi|148510150|gb|ABQ77010.1| protein of unknown function DUF1311 [Pseudomonas putida F1]
          Length = 128

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 1/87 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M+ C G    +  ++L   YK+++ K++  Q++     Q  W  YR   C F    A  G
Sbjct: 40  MSACIGAETQVQDQRLNRVYKQLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFHVQ-ASGG 98

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           T   +    C+     +R  +LE  L+
Sbjct: 99  TLAQLEGGTCILDMTRDRAAELERVLS 125


>gi|254503390|ref|ZP_05115541.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222439461|gb|EEE46140.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 137

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 48/117 (41%), Gaps = 10/117 (8%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
           L + A A     ++C   L  ++   C   +     E L A Y++ LEK+ +    L E 
Sbjct: 14  LGLCAPALADEKIDCGYPLNNSERTYCAEKALDQANEDLTAAYERALEKMTEVDTSLPEH 73

Query: 69  ----------SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                     +Q AW  +R  +C   +     GT  + +Y NC+    ++R + L +
Sbjct: 74  LKGSPNALKAAQEAWTDFRDKDCTAYSFPFRGGTRGNELYRNCMIVMTMQRIDDLNA 130


>gi|157869878|ref|XP_001683490.1| DHHC zinc finger domain-like protein [Leishmania major]
 gi|68126555|emb|CAJ04948.1| DHHC zinc finger domain-like protein [Leishmania major strain
           Friedlin]
          Length = 450

 Score = 38.1 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 25  ETLMQADMNQCTGNSFA-----LVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           E+L++A+ + C+G+  A     L  E+ E   ++  EK+E+HQR L  K    W  Y
Sbjct: 375 ESLIEAEKDPCSGSCCACKRPRLTPEQKEEEARQRREKIERHQRTLMGKESPCWRRY 431


>gi|254254380|ref|ZP_04947697.1| hypothetical protein BDAG_03677 [Burkholderia dolosa AUO158]
 gi|124899025|gb|EAY70868.1| hypothetical protein BDAG_03677 [Burkholderia dolosa AUO158]
          Length = 129

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 36/78 (46%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +  AL  +A+ F + A  C +     D   C+ N F+ +  +L   Y ++ +++   Q+ 
Sbjct: 8  VCCALAALAVPFAAHAAGCAKPRSAFDQVYCSSNEFSQLDRELNDQYGRLRKQLSGDQQA 67

Query: 65 LFEKSQMAWEIYRGSECA 82
            +  Q+AW   R   C+
Sbjct: 68 KLKSGQLAWMKQRDDRCS 85


>gi|54308436|ref|YP_129456.1| hypothetical protein PBPRA1243 [Photobacterium profundum SS9]
 gi|46912865|emb|CAG19654.1| hypothetical protein PBPRA1243 [Photobacterium profundum SS9]
          Length = 512

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 1  MCRKIIFALTIIAI------AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
          M  K+   +T+++I      A  S + +C++   Q +   CT ++ A++  K+E  Y++ 
Sbjct: 1  MQLKLTMLVTVLSIFSPFLWATTSPSFDCDKASSQIEERICTDDALAVLDMKMEKVYEQA 60

Query: 55 LEKVEKHQRELFEKSQMAWEIYRGSEC 81
          L+ +   +R + +  Q  W I   +EC
Sbjct: 61 LQNIPDSERSIMKSMQRGW-IKGRNEC 86


>gi|229592565|ref|YP_002874684.1| hypothetical protein PFLU5181 [Pseudomonas fluorescens SBW25]
 gi|229364431|emb|CAY52239.1| putative putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 126

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 1/88 (1%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           ADM  C      +   +L   YK  L   E  +++  +  Q  W  YR + C FA S A 
Sbjct: 38  ADMVSCNAKETKVQDARLNRAYKTALAAQEGARKQQLQDVQRLWIKYRDANCGFAGS-AT 96

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYL 117
            GT   +  + C+      R ++LE  +
Sbjct: 97  GGTLDQVNGSGCVLDMTQTRAQELEDLV 124


>gi|134294050|ref|YP_001117786.1| hypothetical protein Bcep1808_5374 [Burkholderia vietnamiensis
          G4]
 gi|134137207|gb|ABO58321.1| protein of unknown function DUF1311 [Burkholderia vietnamiensis
          G4]
          Length = 129

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 35/75 (46%)

Query: 8  ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
          AL  +A+ F + A  C +     D   C+ N F+ +  +L   Y ++ +++   Q+   +
Sbjct: 11 ALFALAVPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDEYGRLRKQLSGDQQAKLK 70

Query: 68 KSQMAWEIYRGSECA 82
            Q+AW   R   C+
Sbjct: 71 SGQLAWMKQRDDRCS 85


>gi|291617915|ref|YP_003520657.1| Hypothetical Protein PANA_2362 [Pantoea ananatis LMG 20103]
 gi|291152945|gb|ADD77529.1| Hypothetical Protein PANA_2362 [Pantoea ananatis LMG 20103]
          Length = 133

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           +   K +++  YK   E + K+   L E +Q AW  YR ++C  A+  A++G+  S+ Y 
Sbjct: 54  YKAAKSRVQDIYKGNDEDLNKYINILTE-AQRAWLKYRENDCELASFAADKGSDASVSYK 112

Query: 100 N-CLQGHAIERNEKLE 114
           N C+  H  +R ++L+
Sbjct: 113 NMCISEHNEQRIKRLK 128


>gi|326317407|ref|YP_004235079.1| hypothetical protein Acav_2600 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374243|gb|ADX46512.1| protein of unknown function DUF1311 [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 140

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 35/96 (36%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+     A+ N C   ++      +   Y  V+  +  H+R    + Q AW+  R + C 
Sbjct: 37  CDPKGTVAETNACAVQAWQQADTAIAILYGDVMRALSAHERPQLRQEQAAWQRERVTRCK 96

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            A    E       +Y  CL      R   L  +LT
Sbjct: 97  QATRATEALPEGPRLYHECLAAETEARRRGLMRWLT 132


>gi|120611271|ref|YP_970949.1| hypothetical protein Aave_2603 [Acidovorax citrulli AAC00-1]
 gi|120589735|gb|ABM33175.1| hypothetical protein Aave_2603 [Acidovorax citrulli AAC00-1]
          Length = 140

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 35/96 (36%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+     A+ N C   ++      +   Y  V+  +  H+R    + Q AW+  R + C 
Sbjct: 37  CDPKGTVAETNACAVQAWQQADTAIAILYGDVMRALSAHERPQLRQEQAAWQRERVTRCK 96

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            A    E       +Y  CL      R   L  +LT
Sbjct: 97  QATRATEALPEGPRLYHECLTAETEARRRGLMRWLT 132


>gi|153833727|ref|ZP_01986394.1| putative conserved hypothetical protein [Vibrio harveyi HY01]
 gi|148870006|gb|EDL68966.1| putative conserved hypothetical protein [Vibrio harveyi HY01]
          Length = 138

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 6/106 (5%)

Query: 1   MCRKIIFAL-TIIAIAF-QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + +I AL ++ ++AF Q  A++CN  +   ++NQC      + +++L       LE  
Sbjct: 1   MKKYVIVALASLSSMAFAQEEAIDCNNAVSTLEINQCAAIELKVAQKQLNKYLDTSLEH- 59

Query: 59  EKHQRELFEKSQMA---WEIYRGSECAFAASGAEEGTAQSMIYANC 101
             +  EL +  Q+A   W+ Y  S C    +   EGT + ++  +C
Sbjct: 60  NSYDPELIKAIQVAQKDWQAYVTSHCDSVYTQWREGTIRGVMAISC 105


>gi|218508661|ref|ZP_03506539.1| urease-associated protein [Rhizobium etli Brasil 5]
          Length = 118

 Score = 37.0 bits (84), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 10/104 (9%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKV----------LEKVEKHQRELFEKSQ 70
           ++C     Q+DM  C         + L   YKK           L+   K   +   K+Q
Sbjct: 7   IDCQNPKTQSDMTSCEVARHETADKALNEQYKKTRAAMVAIDKDLDGDMKGAEKALVKAQ 66

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            AW  YR ++C      A  GT + M+ A CL     +R ++L+
Sbjct: 67  RAWIDYRDAQCDAFGFQARGGTMEPMLVAGCLAEETDKRTKELK 110


>gi|221214400|ref|ZP_03587371.1| EF hand domain protein [Burkholderia multivorans CGD1]
 gi|221165657|gb|EED98132.1| EF hand domain protein [Burkholderia multivorans CGD1]
          Length = 238

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 48/115 (41%), Gaps = 5/115 (4%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           I  LT +     S A  C+          C   +    K+ L   YKK+    +   +  
Sbjct: 124 IVLLTFLLFPLASFAEACDNGGNAYSDLSCVDRALDEAKKDLNEIYKKIYSSTQ--YKSE 181

Query: 66  FEKSQMAWEIYRGSEC-AFAASGA--EEGTAQSMIYANCLQGHAIERNEKLESYL 117
           FE+SQ AW  YR  +C  + A+ A   +G   ++I  +CL     +R + L + L
Sbjct: 182 FEQSQKAWLNYREKQCRGYVAAEASQSQGVGPALITKDCLYAITKQRVDYLRTLL 236


>gi|262280845|ref|ZP_06058628.1| conserved hypothetical protein [Acinetobacter calcoaceticus
          RUH2202]
 gi|262257745|gb|EEY76480.1| conserved hypothetical protein [Acinetobacter calcoaceticus
          RUH2202]
          Length = 123

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          RKI FA           A NC+      D   CT   +A     L   Y+ +  K+   Q
Sbjct: 2  RKIAFAFLCSLGMTVVYADNCDSARNTYDDIYCTNKIYASADVDLNKNYQALRVKLNTAQ 61

Query: 63 RELFEKSQMAWEIYRGSECA 82
          + + +KSQ+AW   R +EC 
Sbjct: 62 KNILKKSQLAWIRQRDAECT 81


>gi|262393946|ref|YP_003285800.1| hypothetical protein VEA_003175 [Vibrio sp. Ex25]
 gi|262337540|gb|ACY51335.1| hypothetical protein VEA_003175 [Vibrio sp. Ex25]
          Length = 138

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 5/121 (4%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           C  II A        +  +++CN  +   ++NQC        + KLE       E    H
Sbjct: 4   CLIIILASLSFGALAEEESIDCNNAMTTIEINQCAAIELESAQVKLEKYLSTSFEH-NSH 62

Query: 62  QRELFEKSQMA---WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYL 117
             EL    ++A   W+ Y  S C    +   +GT + ++  +C      +R  +L E++L
Sbjct: 63  DPELISAIKLAQRDWQAYMSSHCDSVYTQWRDGTIRGIMAISCKTKLTKQRTHELWENFL 122

Query: 118 T 118
           T
Sbjct: 123 T 123


>gi|319763239|ref|YP_004127176.1| hypothetical protein Alide_2556 [Alicycliphilus denitrificans BC]
 gi|317117800|gb|ADV00289.1| hypothetical protein Alide_2556 [Alicycliphilus denitrificans BC]
          Length = 132

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 34/87 (39%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           + N C    +      L+  Y  V+  +  H+R    +  +AW+  R ++C  A    E+
Sbjct: 36  ETNACAVRDYQEADTALQILYGDVMRALSAHERPALRQDHLAWQRARITQCKQAQRAQEQ 95

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYL 117
                 +Y  CL      R + L  +L
Sbjct: 96  RPEWPRLYHECLVAQTRARRQALMHWL 122


>gi|302037308|ref|YP_003797630.1| hypothetical protein NIDE1981 [Candidatus Nitrospira defluvii]
 gi|300605372|emb|CBK41705.1| conserved exported protein of unknown function, COG3755 [Candidatus
           Nitrospira defluvii]
          Length = 135

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 47/101 (46%), Gaps = 5/101 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE----K 60
           +IF+   +  A Q    +C  +  Q ++N C       ++ K++  Y +++  +E    K
Sbjct: 14  VIFSFISLVSANQDQQ-DCESSQTQLELNACWSQLAGEIEGKVKTAYLEIVRALEQAGEK 72

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANC 101
           +  +L +++Q  WE YR  +C  A    E G+    + A C
Sbjct: 73  NALKLLKRAQRYWEQYRDVQCEGARQLYEGGSVAKTVEATC 113


>gi|299532370|ref|ZP_07045762.1| hypothetical protein CTS44_16283 [Comamonas testosteroni S44]
 gi|298719608|gb|EFI60573.1| hypothetical protein CTS44_16283 [Comamonas testosteroni S44]
          Length = 163

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 34/103 (33%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A      +C      A  N C    F       +  Y  V+  +  H+R    K Q  W 
Sbjct: 55  ALAQAGADCVPGGTTAQTNACAIKDFQQADTDHQILYGDVMRALSAHERPALRKEQGEWS 114

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +R ++C  A    E        Y  CL      RN  L+ +L
Sbjct: 115 RHRITQCKQATKAFEAQPDWPSRYHGCLVQQITTRNAVLKRWL 157


>gi|156974420|ref|YP_001445327.1| hypothetical protein VIBHAR_02135 [Vibrio harveyi ATCC BAA-1116]
 gi|156526014|gb|ABU71100.1| hypothetical protein VIBHAR_02135 [Vibrio harveyi ATCC BAA-1116]
          Length = 138

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 61/124 (49%), Gaps = 7/124 (5%)

Query: 1   MCRKIIFAL-TIIAIAF-QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + +I AL ++ ++AF Q  A++CN  +   ++NQC        +++L    +  LE  
Sbjct: 1   MKKYVIVALASLSSMAFAQEEAIDCNNAVSTLEINQCAAIELEAAQKQLNKYLETSLEHT 60

Query: 59  EKHQRELFEKSQMA---WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-E 114
             +  EL +  Q+A   W+ Y  S C    +   EGT + ++  +C      +R  ++ +
Sbjct: 61  -SYDPELIKAIQVAQKDWQAYMTSHCDSVYTKWREGTIRGVMAISCKTQLTQQRTHEIWQ 119

Query: 115 SYLT 118
           ++LT
Sbjct: 120 NFLT 123


>gi|16127221|ref|NP_421785.1| hypothetical protein CC_2991 [Caulobacter crescentus CB15]
 gi|221236022|ref|YP_002518459.1| hypothetical protein CCNA_03086 [Caulobacter crescentus NA1000]
 gi|13424625|gb|AAK24953.1| hypothetical protein CC_2991 [Caulobacter crescentus CB15]
 gi|220965195|gb|ACL96551.1| hypothetical exported protein [Caulobacter crescentus NA1000]
          Length = 184

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEK-HQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           M  C G    +   +L   Y+  L ++E+  Q+   +K+Q AW  +R ++C  AA   E+
Sbjct: 96  MIACIGQEVGVQDARLNRAYQAALMRLERPRQKAALQKAQRAWIAFRDADC--AAYVDED 153

Query: 91  GTAQSMIYAN-CLQGHAIERNEKLESYLTC 119
             + + + AN C+     +R E+LE + T 
Sbjct: 154 WGSLARVEANQCVLDRTRQRAEELERFRTA 183


>gi|34499742|ref|NP_903957.1| hypothetical protein CV_4287 [Chromobacterium violaceum ATCC 12472]
 gi|34105593|gb|AAQ61947.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 136

 Score = 36.6 bits (83), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 1/92 (1%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           A M  C     A   ++L  TY+K++  +   +++  + +Q  W  YR + C+ A    +
Sbjct: 46  AGMLDCLSAEHARQDKQLNDTYRKLMAALPAKRQQRLQVAQRLWLKYRAANCS-AYVDPD 104

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            G+A+S++ A+C       R  +L      P 
Sbjct: 105 GGSAESLVAADCELASTAARAAELSRLQPSPR 136


>gi|90577411|ref|ZP_01233222.1| hypothetical protein VAS14_10209 [Vibrio angustum S14]
 gi|90440497|gb|EAS65677.1| hypothetical protein VAS14_10209 [Vibrio angustum S14]
          Length = 141

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 12/119 (10%)

Query: 4   KIIFALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           K  + +  + ++F S A    L+C+      ++N C   +    +E+L    K +   VE
Sbjct: 2   KKYWLIIFVCLSFPSFAAKKVLDCDNPRNTLEINDCASLTLTSAQEELS---KYLAASVE 58

Query: 60  KHQRE-----LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            ++++       EK+Q  WE+Y  ++C    +   EGT ++++  +C      ER   +
Sbjct: 59  HNKKDPELVKAIEKAQKDWEVYMKAQCNAVYTQWREGTIRNVMALDCKTQLTKERTHDV 117


>gi|75910212|ref|YP_324508.1| hypothetical protein Ava_4008 [Anabaena variabilis ATCC 29413]
 gi|75703937|gb|ABA23613.1| hypothetical protein Ava_4008 [Anabaena variabilis ATCC 29413]
          Length = 417

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 3/83 (3%)

Query: 21  LNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           LNC +ET  Q  +NQC        +    + Y    E++ K  +  F  +Q  W+ YR +
Sbjct: 255 LNCVDET--QIGLNQCAVYWSKTTQFLQSSIYGDWAERLSKQYQPTFGIAQKYWQDYREA 312

Query: 80  ECAFAASGAEEGTAQSMIYANCL 102
            C       +EG+   M+Y  CL
Sbjct: 313 HCTELVEPFQEGSMAPMLYHRCL 335


>gi|157411385|gb|ABV54344.1| hypothetical protein [Pseudomonas stutzeri]
          Length = 132

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 53/121 (43%), Gaps = 9/121 (7%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           +I   +I A A +   + C +     D+ QC       V+  L   Y+++L+++ +    
Sbjct: 9   LIVFFSISANAGEVSEIECEKVFSTLDVEQCIAVELDKVEASLNEAYQRLLKQLTQADTP 68

Query: 63  -------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                  R+    +Q AW  +R ++C         G+ ++ IY +C +  A +R  +L S
Sbjct: 69  QDNYTEYRKKLLIAQRAWIKFREADCDTQYEMHRSGSIRNSIYLSCKKQRAEQRINELNS 128

Query: 116 Y 116
           Y
Sbjct: 129 Y 129


>gi|289805909|ref|ZP_06536538.1| putative secreted protein [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
          Length = 41

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 26/39 (66%)

Query: 45 EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
          ++L  TY+  +++ +  QREL +K+Q+AW   R ++CA 
Sbjct: 3  KRLNETYQSAIKRAQPPQRELLQKAQVAWIALRDADCAL 41


>gi|209515942|ref|ZP_03264803.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209503600|gb|EEA03595.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 161

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 45/107 (42%), Gaps = 11/107 (10%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-----------FEKSQ 70
           +  E    +D+ QC+   F     +L+ + +    K+E + + L           F KSQ
Sbjct: 53  DTGEHASNSDLAQCSHRKFDHAARELDKSLQSAKSKIESNDKSLKEEGEPLALPYFLKSQ 112

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            AW  YR +EC        E T + + +  C+     +R ++L+  L
Sbjct: 113 DAWTQYRDNECYTETYMMGEATERYIFFWECMANITQDRVKELQEVL 159


>gi|167031877|ref|YP_001667108.1| hypothetical protein PputGB1_0862 [Pseudomonas putida GB-1]
 gi|166858365|gb|ABY96772.1| protein of unknown function DUF1311 [Pseudomonas putida GB-1]
          Length = 128

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 1/87 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M+ C      +  ++L   YK+++ K+E  Q++   + Q  W  YR   C F    A  G
Sbjct: 40  MSACINAETQVQDQRLNRVYKQLMGKLEAGQQKNLREVQRKWMAYRDGNCQFHVQ-ASGG 98

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           T   +    C+     +R  +LE  L+
Sbjct: 99  TLAQLEGGTCVMSMTRDRAAELERVLS 125


>gi|114570288|ref|YP_756968.1| hypothetical protein Mmar10_1738 [Maricaulis maris MCS10]
 gi|114340750|gb|ABI66030.1| protein of unknown function DUF1311 [Maricaulis maris MCS10]
          Length = 170

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           A M  C G+ +      L  +Y+ + E +         ++Q +W  +R  +C F AS   
Sbjct: 77  AGMLACRGDEYEAWDRWLNESYRDLRESLSDESVVALREAQRSWIAHRDQDCLFLASLYA 136

Query: 90  EGTAQSMIYANCLQGHAIER 109
            GT + +  A+CL     ER
Sbjct: 137 GGTLERVEQASCLTRKTAER 156


>gi|152992335|ref|YP_001358056.1| hypothetical protein SUN_0740 [Sulfurovum sp. NBC37-1]
 gi|151424196|dbj|BAF71699.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 120

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
           QC  + +    +KL + Y++V  K+ K +      +Q AW  +R +EC   A     G+A
Sbjct: 36  QCAYSEYDYWDKKLNSLYRQVKNKLPKEEIHNLVTAQRAWIKFRDTECYLEAYEMRGGSA 95

Query: 94  QSMIYANCLQGHAIERNEKLESYL 117
           +  +   C      +R ++L S+L
Sbjct: 96  EKQLNIGCKISMTEKRVKELYSFL 119


>gi|328676813|gb|AEB27683.1| hypothetical protein FNFX1_0735 [Francisella cf. novicida Fx1]
          Length = 91

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 19  MALNCNETLMQADMNQCTGNSF---ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           M L    TL+ AD   C GN++   A +K +++  Y   L  V+ H  + F+K       
Sbjct: 1   MTLTILPTLVVAD-KVCDGNTYEINACLKSQMQI-YDTKLNDVQNHNIKNFKK------- 51

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCL 102
           YR + C   +S  + GT Q++ Y NC+
Sbjct: 52  YRDNLCYDISSTYKSGTYQAIKYGNCV 78


>gi|310765201|gb|ADP10151.1| DUF1311 protein [Erwinia sp. Ejp617]
          Length = 132

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 10/80 (12%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATY---KKVLEKVEKHQREL-------FEKSQMA 72
           C E L    + QCT     L +E L   Y   KK + ++ +  + L       F  SQ  
Sbjct: 26  CAEQLSDGSLWQCTERQKKLAEEDLNQAYIAAKKRIVQMYRSDKPLGEQYVATFTDSQRH 85

Query: 73  WEIYRGSECAFAASGAEEGT 92
           W  YR  +C+  A  AEEG+
Sbjct: 86  WLKYRDGQCSLEAFAAEEGS 105


>gi|118497328|ref|YP_898378.1| hypothetical protein FTN_0733 [Francisella tularensis subsp.
           novicida U112]
 gi|195536014|ref|ZP_03079021.1| hypothetical protein FTE_0973 [Francisella tularensis subsp.
           novicida FTE]
 gi|118423234|gb|ABK89624.1| hypothetical protein FTN_0733 [Francisella novicida U112]
 gi|194372491|gb|EDX27202.1| hypothetical protein FTE_0973 [Francisella tularensis subsp.
           novicida FTE]
          Length = 97

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 19  MALNCNETLMQADMNQCTGNSF---ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           M L    TL+ AD   C GN++   A +K +++  Y   L  V+ H  + F+K       
Sbjct: 7   MTLTILPTLIVAD-KVCDGNTYEINACLKSQMQI-YDTKLNDVQNHDIKNFKK------- 57

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCL 102
           YR + C   +S  + GT Q++ Y NC+
Sbjct: 58  YRDNICYDISSTYKGGTYQAIKYGNCV 84


>gi|222149549|ref|YP_002550506.1| hypothetical protein Avi_3481 [Agrobacterium vitis S4]
 gi|221736531|gb|ACM37494.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 136

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 41/106 (38%), Gaps = 10/106 (9%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYK----------KVLEKVEKHQRELFEKS 69
           AL+C +   Q+DM  C    F    + + A +K            L+   K   +   K+
Sbjct: 26  ALDCKDPKTQSDMTACAVQDFDAADKAMNAQWKITRKVFVEQDATLDDDLKGAEKALLKA 85

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           Q AW  YR  +C         GT + M  A C       R ++L+S
Sbjct: 86  QRAWIDYRDGQCEAQGFYVRGGTMEPMEVAACKAEMTKTRTKELKS 131


>gi|262393949|ref|YP_003285803.1| hypothetical protein VEA_003178 [Vibrio sp. Ex25]
 gi|262337543|gb|ACY51338.1| hypothetical protein VEA_003178 [Vibrio sp. Ex25]
          Length = 138

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 13/125 (10%)

Query: 2   CRKIIFALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           C  II A    +++F ++A    ++CN  +   ++NQC        + KL+      +E 
Sbjct: 4   CLIIILA----SLSFGALAEEESIDCNNAMTTIEINQCAAIELESAQVKLDKYLNTSVEH 59

Query: 58  VEKHQRELFEKSQMA---WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL- 113
              H  EL    ++A   W+ Y  S C    +   +GT + ++  +C      +R  +L 
Sbjct: 60  -NSHDPELIAAIKLAQQDWQAYVSSHCDSVYTQWRDGTIRGIMAISCKTKLTKQRTHELW 118

Query: 114 ESYLT 118
           E++LT
Sbjct: 119 ENFLT 123


>gi|187923080|ref|YP_001894722.1| hypothetical protein Bphyt_1079 [Burkholderia phytofirmans PsJN]
 gi|187714274|gb|ACD15498.1| protein of unknown function DUF1311 [Burkholderia phytofirmans
           PsJN]
          Length = 167

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 11/97 (11%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-----------FEKSQMAWEIYRG 78
           AD+  C+   + ++  KL++  K + +  +K   EL           FEK Q AW  +R 
Sbjct: 68  ADIAACSQRDYEIIFAKLKSKIKSLEDGFKKDDAELKAEDNPIASPYFEKGQNAWIEFRD 127

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           ++C        E + + M + +C+     ER + L+S
Sbjct: 128 NQCYAETYSLGEASMRYMTFWDCMARITRERLDDLDS 164


>gi|56707875|ref|YP_169771.1| hypothetical protein FTT_0761c [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89256654|ref|YP_514016.1| hypothetical protein FTL_1353 [Francisella tularensis subsp.
           holarctica LVS]
 gi|110670346|ref|YP_666903.1| hypothetical protein FTF0761c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134301717|ref|YP_001121685.1| hypothetical protein FTW_0672 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156502797|ref|YP_001428862.1| hypothetical protein FTA_1431 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187931535|ref|YP_001891519.1| hypothetical protein FTM_0776 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456954|ref|ZP_03665427.1| hypothetical protein FtultM_04221 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254874690|ref|ZP_05247400.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|290953407|ref|ZP_06558028.1| hypothetical protein FtulhU_03393 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313368|ref|ZP_06803977.1| hypothetical protein FtulhU_03383 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|56604367|emb|CAG45394.1| hypothetical protein [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|89144485|emb|CAJ79792.1| hypothetical protein FTL_1353 [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320679|emb|CAL08777.1| hypothetical protein FTF0761c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134049494|gb|ABO46565.1| hypothetical protein FTW_0672 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156253400|gb|ABU61906.1| hypothetical protein FTA_1431 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187712444|gb|ACD30741.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840689|gb|EET19125.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 97

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 19  MALNCNETLMQADMNQCTGNSF---ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           M L    TL+ AD   C GN++   A +K +++  Y   L  V+ H  + F+K       
Sbjct: 7   MTLTILPTLVAAD-KVCDGNTYEINACLKSQMQI-YDTKLNDVQNHDIKNFKK------- 57

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCL 102
           YR + C   +S  + GT Q++ Y NC+
Sbjct: 58  YRDNICYDISSTYKGGTYQAIKYGNCV 84


>gi|330448040|ref|ZP_08311688.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492231|dbj|GAA06185.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 138

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/111 (18%), Positives = 52/111 (46%), Gaps = 6/111 (5%)

Query: 9   LTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR- 63
           + ++ ++F + A    L+C+      ++N+C        + +L   +   LE  ++  + 
Sbjct: 7   IALVCVSFPTFAAKKVLDCDNPRNTLEINECAAGKLDSAQAELSKYFAASLEHNKEDPKL 66

Query: 64  -ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            +  E++Q  WE+Y  ++C+   +   +GT ++++  +C      ER   +
Sbjct: 67  VKAIEQAQKDWEVYMKAQCSAVYTQWRDGTIRNVMALDCKTQLTKERTHDI 117


>gi|156935157|ref|YP_001439073.1| hypothetical protein ESA_03008 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533411|gb|ABU78237.1| hypothetical protein ESA_03008 [Cronobacter sakazakii ATCC BAA-894]
          Length = 147

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 46/114 (40%), Gaps = 26/114 (22%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFAL-------VKEKLEATYK--- 52
           RKI+F ++ + I+   MA +  +      ++QC    +         + +K EA  K   
Sbjct: 2   RKIVFLVSTLLISHNLMAADQKDINADNAVDQCLDKYYEFSSECLEDLNDKTEAELKQAY 61

Query: 53  ----KVLEKVE------------KHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
               K LE+V+            K   E F KSQ  W  YR S C  A  G +E
Sbjct: 62  ETKLKSLERVDYTKWWMGDEDRKKRMIEAFRKSQRDWLTYRDSYCEVATIGEQE 115


>gi|208779115|ref|ZP_03246461.1| hypothetical protein FTG_1409 [Francisella novicida FTG]
 gi|208744915|gb|EDZ91213.1| hypothetical protein FTG_1409 [Francisella novicida FTG]
          Length = 91

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 19  MALNCNETLMQADMNQCTGNSF---ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           M L    TL+ AD   C GN++   A +K +++  Y   L  V+ H  + F+K       
Sbjct: 1   MTLTILPTLIVAD-KVCDGNTYEINACLKSQMQI-YDTKLNDVQNHDIKNFKK------- 51

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCL 102
           YR + C   +S  + GT Q++ Y NC+
Sbjct: 52  YRDNICYDISSTYKGGTYQAIKYGNCV 78


>gi|237755348|ref|ZP_04583977.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692479|gb|EEP61458.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 160

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
            E    A M  C+  +     ++L   YK++++K+   +REL ++SQ+ W  +R +E  F
Sbjct: 43  RENYTTAGMLSCSSQALDKWDKELNRIYKELIKKLSPEERELLKQSQLQWVKFRDAEFKF 102


>gi|167010538|ref|ZP_02275469.1| hypothetical protein Ftulh_07457 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|282159058|gb|ADA78449.1| hypothetical protein NE061598_04370 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 91

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 19  MALNCNETLMQADMNQCTGNSF---ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           M L    TL+ AD   C GN++   A +K +++  Y   L  V+ H  + F+K       
Sbjct: 1   MTLTILPTLVAAD-KVCDGNTYEINACLKSQMQI-YDTKLNDVQNHDIKNFKK------- 51

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCL 102
           YR + C   +S  + GT Q++ Y NC+
Sbjct: 52  YRDNICYDISSTYKGGTYQAIKYGNCV 78


>gi|172063822|ref|YP_001811473.1| hypothetical protein BamMC406_4803 [Burkholderia ambifaria
          MC40-6]
 gi|171996339|gb|ACB67257.1| protein of unknown function DUF1311 [Burkholderia ambifaria
          MC40-6]
          Length = 129

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 31/69 (44%)

Query: 14 IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
          + F + A  C +     D   C+ N F+ +  +L   Y +V + +   Q+   + SQ+AW
Sbjct: 17 VPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKHLSGDQQAKLKTSQLAW 76

Query: 74 EIYRGSECA 82
             R   C+
Sbjct: 77 MKQRDDRCS 85


>gi|254374151|ref|ZP_04989633.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571871|gb|EDN37525.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 97

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 19  MALNCNETLMQADMNQCTGNSF---ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           M L    TL+ AD   C GN++   A +K +++  Y   L  V+ H  + F+K       
Sbjct: 7   MTLTILPTLVLAD-KVCDGNTYEINACLKSQMQI-YDTKLNDVQNHDIKNFKK------- 57

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCL 102
           YR + C   +S  + GT Q++ Y NC+
Sbjct: 58  YRDNICYDISSTYKGGTYQAIKYGNCV 84


>gi|254464354|ref|ZP_05077765.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685262|gb|EDZ45744.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 134

 Score = 35.4 bits (80), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 48/129 (37%), Gaps = 17/129 (13%)

Query: 1   MCRKIIFALTIIAIAFQS-MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M R++I  L ++A    +  AL C     Q ++ +C        +E++EA     L    
Sbjct: 8   MLRRVIGVLIVLAQPVSADPALECGNAGSQVEIGECVAKD----EERVEAALATALSFAL 63

Query: 60  KHQREL------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAI 107
               +L             E  Q AWE YR   CAF  +    G+   +   +C      
Sbjct: 64  TAAEDLDEATGRSDAVPALEAGQKAWEAYREEHCAFVGATYGGGSGTGIAIRSCRTQLGR 123

Query: 108 ERNEKLESY 116
            R ++L  Y
Sbjct: 124 ARIDELMRY 132


>gi|28872319|ref|NP_794938.1| hypothetical protein PSPTO_5207 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855573|gb|AAO58633.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 131

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 48/122 (39%), Gaps = 11/122 (9%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE-- 64
           F L + ++ F      C  +    ++++C          +L  +YKK++ + +   R   
Sbjct: 7   FVLVLASLYFLPAHAECINSDTSQEVDECAKAEKNTADARLNGSYKKIIARAQGQYRSDA 66

Query: 65  --------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA-NCLQGHAIERNEKLES 115
                     + SQ AW   R + C   A   E G A  +    NC+ G ++ER   L+ 
Sbjct: 67  RLGDEFKAKLKDSQRAWLRLRDTNCPLEAFEIEVGQAAYLTTINNCVAGMSLERAAYLDK 126

Query: 116 YL 117
            L
Sbjct: 127 LL 128


>gi|94969409|ref|YP_591457.1| hypothetical protein Acid345_2382 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551459|gb|ABF41383.1| protein of unknown function DUF1311 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 140

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 15/96 (15%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR---------------ELFE 67
           C +   QA++NQCT   F     +L   Y+  L+ ++K+                 +  +
Sbjct: 28  CRKIQSQAELNQCTEKKFRTANSQLLKVYQGYLQLLQKNLESAQTPAAKAQSTKTLDDLK 87

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
            +Q+AW  YR + C   A     G+ Q  +Y+ C++
Sbjct: 88  AAQLAWINYREAHCQAEADLYAGGSIQPSMYSACME 123


>gi|330825433|ref|YP_004388736.1| hypothetical protein Alide2_2872 [Alicycliphilus denitrificans
           K601]
 gi|329310805|gb|AEB85220.1| protein of unknown function DUF1311 [Alicycliphilus denitrificans
           K601]
          Length = 132

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 33/87 (37%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           + N C    +      L+  Y  V+  +  H+R    +   AW+  R ++C  A    E+
Sbjct: 36  ETNACAVRDYQEADTALQILYGDVMRALSAHERPALRQDHQAWQRARITQCKQAQRAQEQ 95

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYL 117
                 +Y  CL      R + L  +L
Sbjct: 96  RPEWPRLYHECLVAQTRARRQALMHWL 122


>gi|170699068|ref|ZP_02890124.1| protein of unknown function DUF1311 [Burkholderia ambifaria
          IOP40-10]
 gi|171321523|ref|ZP_02910462.1| protein of unknown function DUF1311 [Burkholderia ambifaria
          MEX-5]
 gi|170136026|gb|EDT04298.1| protein of unknown function DUF1311 [Burkholderia ambifaria
          IOP40-10]
 gi|171093195|gb|EDT38404.1| protein of unknown function DUF1311 [Burkholderia ambifaria
          MEX-5]
          Length = 129

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 32/70 (45%)

Query: 13 AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
          A+ F + A  C +     D   C+ N F+ +  +L   Y +V + +   Q+   + SQ+A
Sbjct: 16 AVPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKHLSGDQQAKLKTSQLA 75

Query: 73 WEIYRGSECA 82
          W   R   C+
Sbjct: 76 WMKQRDDRCS 85


>gi|83945480|ref|ZP_00957827.1| hypothetical protein OA2633_01159 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851056|gb|EAP88914.1| hypothetical protein OA2633_01159 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 160

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQ----RELFEKSQMAWEIYRGSECAFAASG 87
           M +C   +  L  ++L A Y  + ++++  +    RE    +Q AW  +R +EC+  +  
Sbjct: 66  MMECAHRATELWDQRLNAAYFALRDRLQAREQLQRRERLLDAQRAWLAFREAECSQQSLA 125

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            E GT   +I  +C       R   LE+ L
Sbjct: 126 YEGGTLMGVIANSCFNDFTARRALDLEAQL 155


>gi|152982086|ref|YP_001353309.1| hypothetical protein mma_1619 [Janthinobacterium sp. Marseille]
 gi|151282163|gb|ABR90573.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 135

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 53/126 (42%), Gaps = 11/126 (8%)

Query: 4   KIIFA-LTIIAIA-FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           KI  A LT++ +A F      C       +MN C   +    +EKL+  YK +L+++   
Sbjct: 3   KITLAFLTLLPVAAFAQQVDPCLSKGTPQEMNACAKEADQKAQEKLDTVYKALLKQIPAQ 62

Query: 62  QRE---------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
            +E             +Q  W  +   +C   +   +    + + Y +C + HA +R   
Sbjct: 63  DQEGIPYVATKKQLRIAQKEWSKFVEQDCKTVSIYNKGSILKDIEYFSCTRLHAEQRTSD 122

Query: 113 LESYLT 118
           LE +L+
Sbjct: 123 LERFLS 128


>gi|28872323|ref|NP_794942.1| hypothetical protein PSPTO_5211 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855578|gb|AAO58637.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 131

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 48/122 (39%), Gaps = 11/122 (9%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE-- 64
           F L + ++ F      C  +    ++++C          +L  +YKK++ + +   R   
Sbjct: 7   FVLVLASLYFLPAHAECINSGTSQEVDECAKAEKNTADARLNGSYKKLIARAQGQYRSDA 66

Query: 65  --------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA-NCLQGHAIERNEKLES 115
                     + SQ AW   R + C   A   E G A  +    NC+ G ++ER   L+ 
Sbjct: 67  RLGDEFKAKLKDSQRAWLRLRDTNCPLEAFEIEVGQAAYLTTINNCVAGMSLERAAYLDK 126

Query: 116 YL 117
            L
Sbjct: 127 LL 128


>gi|320323467|gb|EFW79552.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329490|gb|EFW85482.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 74

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           +++ F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C 
Sbjct: 9   KKQAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACR 68

Query: 121 E 121
           E
Sbjct: 69  E 69


>gi|187930640|ref|YP_001901127.1| hypothetical protein Rpic_3576 [Ralstonia pickettii 12J]
 gi|187727530|gb|ACD28695.1| protein of unknown function DUF1311 [Ralstonia pickettii 12J]
          Length = 152

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++ A
Sbjct: 62  AGMTECTHTAYQAYDRQMNTLYQAVMRKSDPVSREAIRNAQRAWLAYRNAQKA 114


>gi|167590292|ref|ZP_02382680.1| hypothetical protein BuboB_33462 [Burkholderia ubonensis Bu]
          Length = 129

 Score = 34.7 bits (78), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 35/75 (46%)

Query: 8  ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
          AL  +A+ F + A  C +     D   C+   F+ +  +L   Y ++ +++   Q+   +
Sbjct: 11 ALFALAVPFAAHAAGCAKPRGAFDQVYCSSTQFSQLDRELNDQYGRLRKQLSGDQQASLK 70

Query: 68 KSQMAWEIYRGSECA 82
            Q+AW   R  +C+
Sbjct: 71 TGQLAWLKQRDDKCS 85


>gi|238025688|ref|YP_002909919.1| hypothetical protein bglu_1g00100 [Burkholderia glumae BGR1]
 gi|237874882|gb|ACR27215.1| Hypothetical protein bglu_1g00100 [Burkholderia glumae BGR1]
          Length = 118

 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGA--EEG 91
           CT       K++L   Y+K+    + ++ EL ++SQ AW  YR  EC  + A+ A   +G
Sbjct: 33  CTSRDLVASKKELNEIYRKIYASTQ-YKDEL-DRSQKAWLNYREKECNGYVAAEASQSQG 90

Query: 92  TAQSMIYANCLQGHAIERNEKLESYL 117
               +I  +CL     +R + L+ +L
Sbjct: 91  AGPGLIVKDCLVTITRQRVDYLKRFL 116


>gi|227326754|ref|ZP_03830778.1| hypothetical protein PcarcW_05304 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 141

 Score = 34.3 bits (77), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN-CLQGHAIERNEKLESYLTCP 120
           F+K Q +WE Y+   C +  SG E+ +A    + N C       R E LE     P
Sbjct: 86  FKKHQRSWERYKKDRCTYVTSGTEKDSAAYQFHLNLCNATENYRRIETLEDEPGFP 141


>gi|255321854|ref|ZP_05363004.1| conserved hypothetical protein [Campylobacter showae RM3277]
 gi|255300958|gb|EET80225.1| conserved hypothetical protein [Campylobacter showae RM3277]
          Length = 148

 Score = 34.3 bits (77), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 3/94 (3%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           A M QC    FA+  + L   YKK +  +    ++  +  Q  W  Y+ ++C F      
Sbjct: 57  AGMIQCIDAEFAIQDKLLNQNYKKAMSVLNDENKKKLKDIQRKWVAYKEAKCPFVPPM-- 114

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
            GT  ++  A+C      ER  +L +     EG+
Sbjct: 115 -GTLYAVTAADCYLQMTKERARELANLAEDFEGN 147


>gi|170078285|ref|YP_001734923.1| hypothetical protein SYNPCC7002_A1678 [Synechococcus sp. PCC 7002]
 gi|169885954|gb|ACA99667.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 319

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR--ELFEKSQMAWEIYRGSECAFAAS 86
           Q +MN+    SF    + +      +L + E+++   EL ++SQ AW IYR  +    + 
Sbjct: 222 QFEMNKFAEKSFREKDKIMNDIIDNLLSEFEENKDLIELIKESQNAWLIYREKQARIWSE 281

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
             + G+  +MIY N +     +R +++ + +   EG
Sbjct: 282 IVKGGSMYAMIYCNHMARLTDQRIDEMNNLIDREEG 317


>gi|121583505|ref|YP_973931.1| hypothetical protein Pnap_4780 [Polaromonas naphthalenivorans CJ2]
 gi|120596755|gb|ABM40189.1| protein of unknown function DUF1311 [Polaromonas naphthalenivorans
           CJ2]
          Length = 133

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 47  LEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
           L   YK ++ ++   ++   +++Q AW  YR + CAF     + GT   +   +C+    
Sbjct: 63  LNKAYKALMAELPPPRKTQLQEAQRAWIKYRDANCAF-YDDPDGGTLARVNANSCMMAAT 121

Query: 107 IERNEKLESY 116
            +R  +LES+
Sbjct: 122 ADRARELESF 131


>gi|261252704|ref|ZP_05945277.1| hypothetical protein VIA_002728 [Vibrio orientalis CIP 102891]
 gi|260936095|gb|EEX92084.1| hypothetical protein VIA_002728 [Vibrio orientalis CIP 102891]
          Length = 211

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 11/126 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M + +I AL   +++F ++A    ++C+       +NQC        K +LE   K   E
Sbjct: 75  MKKSLIIALA--SLSFGAVADEETIDCDAAFTTIQINQCAAIELDAAKTELEKYLKASFE 132

Query: 57  KVEKHQRELFEKSQMA---WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                  EL E  ++A   W+ Y  S C    +   +GT + ++  +C      +R  +L
Sbjct: 133 H-NSFDSELVEAMKLAQTDWQTYMSSHCDSVYTQWRDGTIRGVMAISCKTKLTKQRTHEL 191

Query: 114 -ESYLT 118
            E++LT
Sbjct: 192 WENFLT 197


>gi|113868482|ref|YP_726971.1| hypothetical protein H16_A2515 [Ralstonia eutropha H16]
 gi|113527258|emb|CAJ93603.1| Hypothetical protein H16_A2515 [Ralstonia eutropha H16]
          Length = 121

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 1/94 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           + +  AD+  C      +    L + Y+ +L ++E  +      +Q AW  +R + CA+ 
Sbjct: 24  KAISTADILGCAAVETRVQDVALNSAYQGLLRRLEAPRTGQLRVAQRAWLEFRQANCAYV 83

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           A+ A  GTA  +  A C+   +  R  +L  + T
Sbjct: 84  ANPA-GGTAARVAGATCMARMSAARVRELRDFAT 116


>gi|320156248|ref|YP_004188627.1| hypothetical protein VVM_02724 [Vibrio vulnificus MO6-24/O]
 gi|319931560|gb|ADV86424.1| hypothetical protein VVMO6_01402 [Vibrio vulnificus MO6-24/O]
          Length = 137

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 55/125 (44%), Gaps = 9/125 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M + +I AL   +++F  +A    ++C+      ++NQC        K +LE   K   +
Sbjct: 1   MKKSLILALA--SLSFGVLAGEEPIDCDTAFTTIEVNQCAAIELDAAKTELEKYLKASFD 58

Query: 57  --KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL- 113
               +    E  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L 
Sbjct: 59  HNSFDPKLVEAMKLAQTDWQTYMSSHCDSVYTQWRDGTIRGVMGISCKTKLTKQRTHELW 118

Query: 114 ESYLT 118
           E++LT
Sbjct: 119 ENFLT 123


>gi|309780362|ref|ZP_07675113.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308921065|gb|EFP66711.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 153

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++ A
Sbjct: 63  AGMTECTHAAYQAYDRQMNTLYQAVMSKTDPVSREAIRNAQRAWLAYRTAQKA 115


>gi|304393298|ref|ZP_07375226.1| urease-associated protein [Ahrensia sp. R2A130]
 gi|303294305|gb|EFL88677.1| urease-associated protein [Ahrensia sp. R2A130]
          Length = 141

 Score = 34.3 bits (77), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 41/117 (35%), Gaps = 11/117 (9%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--------- 61
           I+     +  ++CN      +M  C           L A +K+ +    +          
Sbjct: 20  ILVGGAHAQDVDCNTAGSTVEMKFCAAKELDRADADLNAAWKQAMAGARRDDADWLPQGL 79

Query: 62  --QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             + +L   +Q  W  YR + C   A+ A  GT Q ++   CL     +R   L  Y
Sbjct: 80  PARADLLRDAQRKWITYRDAACDAQATMAYGGTLQPLLGTLCLTKLTEQRTADLREY 136


>gi|241664260|ref|YP_002982620.1| hypothetical protein Rpic12D_2677 [Ralstonia pickettii 12D]
 gi|240866287|gb|ACS63948.1| protein of unknown function DUF1311 [Ralstonia pickettii 12D]
          Length = 251

 Score = 34.3 bits (77), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 46/119 (38%), Gaps = 20/119 (16%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV---LEKVEK------------HQRE 64
           + +C   +  AD+ +C      +  +KL A Y +V   L KV+K            H  E
Sbjct: 121 STDCGNPVTSADVAECADRENLVTGQKLGAVYSQVLMGLRKVDKEYGHSYPNRPPLHAAE 180

Query: 65  LFEKSQMAWEIYRGSEC-----AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            F  +Q AW  +R   C         S    G   ++  A C    +  R  +LES +T
Sbjct: 181 SFAAAQRAWLNFRRQSCHVEELVVRNSNPSRGDQSAIAVAACESRLSSARVAELESLVT 239


>gi|170723526|ref|YP_001751214.1| hypothetical protein PputW619_4365 [Pseudomonas putida W619]
 gi|169761529|gb|ACA74845.1| protein of unknown function DUF1311 [Pseudomonas putida W619]
          Length = 128

 Score = 33.9 bits (76), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 35/87 (40%), Gaps = 1/87 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M+ C      L   +L   YK+++ K+E   ++     Q  W  YR   C F    A  G
Sbjct: 40  MSSCIQAETQLQDARLNRAYKQLMGKLEAEPKKSLRDVQRQWIAYRDGNCKFHVQ-ASGG 98

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           T   +    C+     ER  +LE  L+
Sbjct: 99  TMAQLEGGMCVLDMTRERAAELERVLS 125


>gi|299771697|ref|YP_003733723.1| hypothetical protein AOLE_17325 [Acinetobacter sp. DR1]
 gi|298701785|gb|ADI92350.1| hypothetical protein AOLE_17325 [Acinetobacter sp. DR1]
          Length = 123

 Score = 33.9 bits (76), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          +KI+ A           A NC+      D   CT   +A     L   Y+ +  K+   Q
Sbjct: 2  KKIVLAFLCSFGMTAVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRVKLNMAQ 61

Query: 63 RELFEKSQMAWEIYRGSEC 81
          + + +KSQ+AW   R ++C
Sbjct: 62 KNILKKSQLAWIRQRDADC 80


>gi|241664831|ref|YP_002983191.1| hypothetical protein Rpic12D_3253 [Ralstonia pickettii 12D]
 gi|240866858|gb|ACS64519.1| protein of unknown function DUF1311 [Ralstonia pickettii 12D]
          Length = 153

 Score = 33.9 bits (76), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++ A
Sbjct: 63  AGMTECTHAAYQAYDRQMNTLYQAVMSKSDPVSREAIRNAQRAWLAYRNAQKA 115


>gi|213967704|ref|ZP_03395851.1| hypothetical protein PSPTOT1_1621 [Pseudomonas syringae pv.
          tomato T1]
 gi|301382341|ref|ZP_07230759.1| hypothetical protein PsyrptM_06897 [Pseudomonas syringae pv.
          tomato Max13]
 gi|302062950|ref|ZP_07254491.1| hypothetical protein PsyrptK_23429 [Pseudomonas syringae pv.
          tomato K40]
 gi|302130706|ref|ZP_07256696.1| hypothetical protein PsyrptN_04882 [Pseudomonas syringae pv.
          tomato NCPPB 1108]
 gi|213927480|gb|EEB61028.1| hypothetical protein PSPTOT1_1621 [Pseudomonas syringae pv.
          tomato T1]
          Length = 125

 Score = 33.9 bits (76), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 32/80 (40%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          +KI   L  +     + A  C +     D   C GN F+     L   Y  + + +   Q
Sbjct: 2  KKIAIVLMAVVFPLGAHAAGCAKPRNAFDQVYCAGNLFSQSDRDLNQEYTALRKHLNPTQ 61

Query: 63 RELFEKSQMAWEIYRGSECA 82
          +   +  Q+AW   R ++C+
Sbjct: 62 QSSLKSGQLAWIKQRDAQCS 81


>gi|32473848|ref|NP_866842.1| thiol-disulfide interchange protein [Rhodopirellula baltica SH 1]
 gi|32444384|emb|CAD74383.1| probable thiol-disulfide interchange protein [Rhodopirellula
           baltica SH 1]
          Length = 460

 Score = 33.5 bits (75), Expect = 9.2,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 17/121 (14%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQ--ADMNQCTGNS---------FALVKEKLEATY 51
           +K+  AL  I +A+++        L+Q  AD+ Q TG            AL  ++ E   
Sbjct: 274 QKVDLALREIFMAYRTEHYETTSRLLQEHADLFQGTGYESILKSIWFPTALATQQNEIAL 333

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH-AIERN 110
           K + EK+E +  ++   ++ AWE+Y   E     SG +      M   N L+   A E N
Sbjct: 334 KLIEEKIESNPDDVVAINRWAWEVYEAFE-----SGWDNSDKILMTTTNALESALASEEN 388

Query: 111 E 111
           E
Sbjct: 389 E 389


>gi|313669553|ref|YP_004049978.1| hypothetical protein Sulku_2776 [Sulfuricurvum kujiense DSM 16994]
 gi|313156750|gb|ADR35425.1| hypothetical protein Sulku_2776 [Sulfuricurvum kujiense DSM 16994]
          Length = 319

 Score = 33.5 bits (75), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 48/106 (45%), Gaps = 3/106 (2%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK---HQRELFEKSQMAWEIYRGSE 80
           ++ L Q DMN    +      + +EA   +++ ++      + E ++++  +W+ Y    
Sbjct: 214 DQPLTQMDMNMSACDDLTKTLDSIEAIDSEIVRQISDKWIERLEYYKRAHESWKKYMEDN 273

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLC 126
             F AS    G+  ++I A+     A+ER + L+  L   E +  C
Sbjct: 274 SEFEASSFIGGSMWTLIKASSANRIALEREKDLKLLLNQLEENDFC 319


Searching..................................................done


Results from round 2




>gi|67458527|ref|YP_246151.1| hypothetical protein RF_0135 [Rickettsia felis URRWXCal2]
 gi|67004060|gb|AAY60986.1| unknown [Rickettsia felis URRWXCal2]
          Length = 138

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 48/131 (36%), Positives = 70/131 (53%), Gaps = 2/131 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + IIF    ++    + A++CN  + Q DMN C G  +  V +KL   YK++L+ +  
Sbjct: 1   MKKTIIFCWLFLSSISYAFAVDCNNAMTQGDMNYCAGEEYKKVDKKLNQIYKEILKHISD 60

Query: 61  HQRE--LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            Q +  L +KSQ  W  YR ++C F +SG   G+   MI   CL     ER ++ E+ L 
Sbjct: 61  EQEKVNLLKKSQNLWIKYRDADCEFRSSGVYGGSVYPMILLMCLTEKTEERIKEFEAMLK 120

Query: 119 CPEGDLLCPFI 129
           C EGD  CPFI
Sbjct: 121 CEEGDSSCPFI 131


>gi|318606086|emb|CBY27584.1| putative periplasmic protein [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|330861150|emb|CBX71411.1| hypothetical protein YEW_BD05780 [Yersinia enterocolitica W22703]
          Length = 140

 Score =  192 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 48/127 (37%), Positives = 70/127 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    
Sbjct: 14  KKKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVA 73

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C E
Sbjct: 74  QRPLLKSAQLIWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSE 133

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 134 GDLSCPL 140


>gi|238789061|ref|ZP_04632850.1| hypothetical protein yfred0001_41930 [Yersinia frederiksenii ATCC
           33641]
 gi|238722825|gb|EEQ14476.1| hypothetical protein yfred0001_41930 [Yersinia frederiksenii ATCC
           33641]
          Length = 128

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 71/128 (55%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI+    +I    Q++A++C   + Q DMNQC    +     +L  TYK+VL K   
Sbjct: 1   MLKKIMLVSLLIFPVSQALAVDCKNAMTQLDMNQCANADYKKADAELNRTYKEVLAKTPM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q+ W  +R ++C F AS  E G+   MI + CL     ER  +L+SYL CP
Sbjct: 61  VQRALLKSAQLTWIKFRDADCTFQASATEGGSVHPMIISACLTRKTEERIAQLKSYLNCP 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|238798075|ref|ZP_04641563.1| hypothetical protein ymoll0001_17410 [Yersinia mollaretii ATCC
           43969]
 gi|238718055|gb|EEQ09883.1| hypothetical protein ymoll0001_17410 [Yersinia mollaretii ATCC
           43969]
          Length = 128

 Score =  190 bits (482), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 71/128 (55%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI+    ++    Q +AL+C+  + Q +MNQC  + +     +L   YK+VL K   
Sbjct: 1   MLKKIMLISLLVLPISQVLALDCHNAVTQMEMNQCANSDYKSADTELNRIYKQVLVKTSV 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L CP
Sbjct: 61  AQRPLLKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTQKTEERTTQLKSFLNCP 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|123442042|ref|YP_001006025.1| hypothetical protein YE1744 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089003|emb|CAL11817.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 129

 Score =  187 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 48/127 (37%), Positives = 70/127 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    
Sbjct: 3   KKKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVA 62

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C E
Sbjct: 63  QRPLLKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSE 122

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 123 GDLSCPL 129


>gi|332162045|ref|YP_004298622.1| hypothetical protein YE105_C2423 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666275|gb|ADZ42919.1| hypothetical protein YE105_C2423 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 129

 Score =  187 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 48/127 (37%), Positives = 70/127 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KII A  +I    Q++A++C   + Q DMNQC  + +     +L  TYK +L K    
Sbjct: 3   KKKIILATLLILPLSQALAVDCKNAVTQQDMNQCANSDYKKADAELNRTYKDLLAKTTVA 62

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR L + +Q+ W  YR ++C F +S  E G+   MI + CL     ER  +L+S+L C E
Sbjct: 63  QRPLLKSAQLIWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTQLKSFLNCSE 122

Query: 122 GDLLCPF 128
           GDL CP 
Sbjct: 123 GDLSCPL 129


>gi|77460115|ref|YP_349622.1| hypothetical protein Pfl01_3894 [Pseudomonas fluorescens Pf0-1]
 gi|77384118|gb|ABA75631.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 134

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 3/133 (2%)

Query: 1   MCRKIIFALT-IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M  +++ ALT  +  +    A++C     QA MNQC         ++L   Y+++  +++
Sbjct: 1   MSPRLLLALTPFLFTSVAHAAVDCANASDQATMNQCAAQENKAADKELNTVYQQITARLK 60

Query: 60  --KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                ++L   +Q AW  +R +EC F+ASG   G+   +IY NC+      R E L+ YL
Sbjct: 61  DNPDGKKLLVSAQRAWIGFRDTECKFSASGVAGGSVYPLIYNNCITSVTKTRTEALKQYL 120

Query: 118 TCPEGDLLCPFIN 130
            C EGD+ CP   
Sbjct: 121 KCEEGDMSCPVPG 133


>gi|227112977|ref|ZP_03826633.1| hypothetical protein PcarbP_08448 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 128

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 1/128 (0%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-K 60
            +K   AL  +    Q+ A +C     Q +M+QC  N +  V  +L   Y+ V++++  +
Sbjct: 1   MKKRAIALFALLPITQATAADCGNANTQLEMSQCAANEYKKVDGELNRLYQDVVKRLVIE 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             + L + +Q  W  YR ++C F       G+   M+Y+ CL     ER E+ +S L C 
Sbjct: 61  EHKALLKSAQRKWIAYRDADCEFQTFPTTGGSVHGMVYSQCLTQKTAERVEEFKSMLRCE 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|227329538|ref|ZP_03833562.1| hypothetical protein PcarcW_20233 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 128

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 1/128 (0%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-K 60
            +K+  AL  +    Q+ A +C     Q +M+QC  + +  V  +L   Y+ V+++V  +
Sbjct: 1   MKKLAIALFALQPITQAAATDCGNANTQLEMSQCAADEYKKVDGELNRLYQDVVKRVVIE 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             + L + +Q  W  YR ++C F       G+   M+Y+ CL     ER ++ ++ L C 
Sbjct: 61  EHKALLKSAQRKWIAYRDADCEFQTFPTTGGSVHGMVYSQCLTQKTAERVKEFKTMLRCE 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|238749614|ref|ZP_04611119.1| hypothetical protein yrohd0001_29320 [Yersinia rohdei ATCC 43380]
 gi|238712269|gb|EEQ04482.1| hypothetical protein yrohd0001_29320 [Yersinia rohdei ATCC 43380]
          Length = 128

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 60/112 (53%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q+ A++C   L Q +MNQC    +     +L   YK++  K     + L + +Q+ W  +
Sbjct: 17  QTFAVDCKNALTQKEMNQCANADYKKADTELNRIYKEIFAKTSADIKPLLKSAQLTWIKF 76

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           R ++C F +S  E G+   MI + CL     ER  +L+SYL CPEG+L CP 
Sbjct: 77  RDADCRFQSSATEGGSVHPMIISACLTHKTEERISQLKSYLNCPEGELSCPL 128


>gi|238791812|ref|ZP_04635449.1| hypothetical protein yinte0001_15280 [Yersinia intermedia ATCC
           29909]
 gi|238728916|gb|EEQ20433.1| hypothetical protein yinte0001_15280 [Yersinia intermedia ATCC
           29909]
          Length = 123

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 65/123 (52%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +    ++    Q++A++C   + Q D+NQC  + +     +L   YK+VL K    QR L
Sbjct: 1   MLISILVLPISQALAIDCQNAVTQLDINQCANSDYKKADTELNRIYKQVLAKTPATQRAL 60

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLL 125
            + +Q+ W  YR ++C F +S  E G+   MI + CL      R+ +L S+L C EGDL 
Sbjct: 61  LKSAQLTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEARSAELLSFLNCAEGDLS 120

Query: 126 CPF 128
           CP 
Sbjct: 121 CPL 123


>gi|168821756|ref|ZP_02833756.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205341745|gb|EDZ28509.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085339|emb|CBY95122.1| Uncharacterized protein R02472 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 131

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 43/128 (33%), Positives = 65/128 (50%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++C    SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCDLIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|253687870|ref|YP_003017060.1| hypothetical protein PC1_1480 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754448|gb|ACT12524.1| protein of unknown function DUF1311 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 128

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 1/128 (0%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-K 60
            +K   AL  +    Q+ A +C     Q +M+QC  + +  V ++L   Y+ V +++  +
Sbjct: 1   MKKFAIALFALLPLTQAEAADCGNASTQLEMSQCAADEYKKVDDELNRLYQDVAKRLVIE 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             + L + +Q  W  YR ++C F       G+   M+Y+ CL     ER E+ +S L C 
Sbjct: 61  EHKPLLKSAQRKWIAYRDADCEFQTFPTTGGSIHGMLYSQCLTQKTAERVEEFKSMLRCK 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|16764480|ref|NP_460095.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167993697|ref|ZP_02574791.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168264107|ref|ZP_02686080.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197264332|ref|ZP_03164406.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244474|ref|YP_002215053.1| hypothetical protein SeD_A1197 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|16419638|gb|AAL20054.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197242587|gb|EDY25207.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197938990|gb|ACH76323.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205328287|gb|EDZ15051.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205347389|gb|EDZ34020.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|261246336|emb|CBG24145.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992883|gb|ACY87768.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157665|emb|CBW17157.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912110|dbj|BAJ36084.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321223738|gb|EFX48801.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323129392|gb|ADX16822.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326622806|gb|EGE29151.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332988015|gb|AEF06998.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 131

 Score =  172 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 67/128 (52%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      + I+ Q++A  C     Q +MN+C    +    +KL  TY+  L++ +  
Sbjct: 1   MKRIFLTCAALLISSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040284|gb|ACT57080.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 131

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK
Sbjct: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP
Sbjct: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120

Query: 121 EGDLLCPFINN 131
           EGDLLCPFINN
Sbjct: 121 EGDLLCPFINN 131


>gi|16760000|ref|NP_455617.1| secreted protein [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29142229|ref|NP_805571.1| hypothetical protein t1798 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413886|ref|YP_150961.1| hypothetical protein SPA1728 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62179643|ref|YP_216060.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161503792|ref|YP_001570904.1| hypothetical protein SARI_01879 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|168233506|ref|ZP_02658564.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194445821|ref|YP_002040377.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194471793|ref|ZP_03077777.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197362809|ref|YP_002142446.1| hypothetical protein SSPA1606 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|213163118|ref|ZP_03348828.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213416807|ref|ZP_03349951.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213609877|ref|ZP_03369703.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648753|ref|ZP_03378806.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852027|ref|ZP_03381559.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224584370|ref|YP_002638168.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238911057|ref|ZP_04654894.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289830140|ref|ZP_06547571.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25363759|pir||AD0633 probable secreted protein STY1158 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502294|emb|CAD08247.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137859|gb|AAO69420.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128143|gb|AAV77649.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62127276|gb|AAX64979.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|160865139|gb|ABX21762.1| hypothetical protein SARI_01879 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|194404484|gb|ACF64706.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194458157|gb|EDX46996.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197094286|emb|CAR59794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205332414|gb|EDZ19178.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|224468897|gb|ACN46727.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322714111|gb|EFZ05682.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 131

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|238762255|ref|ZP_04623227.1| hypothetical protein ykris0001_1720 [Yersinia kristensenii ATCC
           33638]
 gi|238699602|gb|EEP92347.1| hypothetical protein ykris0001_1720 [Yersinia kristensenii ATCC
           33638]
          Length = 129

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 49/128 (38%), Positives = 70/128 (54%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           + +KI+    ++    Q++ALNC   + Q DMNQC  + +     +L  TYK+VL K   
Sbjct: 2   LKQKIMLVSLLLLPLGQALALNCQNAVTQQDMNQCATSDYKKADTELNRTYKEVLAKTSV 61

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q  W  YR ++C F +S  E G+   MI + CL     ER   L+S+L CP
Sbjct: 62  GQRALLKSAQQTWIKYRDADCTFQSSATEGGSVHPMIISACLTHKTEERTTHLKSFLNCP 121

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 122 EGDLSCPL 129


>gi|168237187|ref|ZP_02662245.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168243922|ref|ZP_02668854.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194451889|ref|YP_002045122.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194736498|ref|YP_002114121.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197250924|ref|YP_002145992.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|194410193|gb|ACF70412.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194712000|gb|ACF91221.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197214627|gb|ACH52024.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197289862|gb|EDY29223.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|205337100|gb|EDZ23864.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|322616493|gb|EFY13402.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619745|gb|EFY16620.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622560|gb|EFY19405.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629711|gb|EFY26486.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632569|gb|EFY29315.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636936|gb|EFY33639.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641526|gb|EFY38164.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644827|gb|EFY41361.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649691|gb|EFY46122.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654009|gb|EFY50332.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658542|gb|EFY54804.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663399|gb|EFY59601.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670133|gb|EFY66273.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674802|gb|EFY70893.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676727|gb|EFY72794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682650|gb|EFY78669.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686330|gb|EFY82312.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195712|gb|EFZ80888.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199860|gb|EFZ84949.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202853|gb|EFZ87889.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209123|gb|EFZ94060.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212404|gb|EFZ97222.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217917|gb|EGA02632.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222204|gb|EGA06588.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226726|gb|EGA10920.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229719|gb|EGA13842.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232944|gb|EGA17040.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240679|gb|EGA24721.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242993|gb|EGA27014.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247684|gb|EGA31629.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252685|gb|EGA36523.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255726|gb|EGA39478.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261688|gb|EGA45262.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323268077|gb|EGA51556.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269927|gb|EGA53376.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 131

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  L++ +  
Sbjct: 1   MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|161614673|ref|YP_001588638.1| hypothetical protein SPAB_02424 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167552609|ref|ZP_02346361.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168467574|ref|ZP_02701411.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|200390183|ref|ZP_03216794.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205352274|ref|YP_002226075.1| hypothetical protein SG1011 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|161364037|gb|ABX67805.1| hypothetical protein SPAB_02424 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|195630064|gb|EDX48716.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|199602628|gb|EDZ01174.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205272055|emb|CAR36900.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322736|gb|EDZ10575.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|326627319|gb|EGE33662.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 131

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKRIFLTCAALWFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|237730957|ref|ZP_04561438.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906496|gb|EEH92414.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 131

 Score =  170 bits (431), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 43/128 (33%), Positives = 68/128 (53%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I+     + ++ Q++A +C     Q +MN C    +     KL  TY+  L++    
Sbjct: 1   MKRIVLTCAALLLSGQALADDCANANTQIEMNTCAAEQYKAADAKLNETYQNALKRAAPT 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR+L +K+Q++W   R ++CA  +SG E G+ Q+MI + CL     ER   L S L C E
Sbjct: 61  QRDLLKKAQVSWITLRDADCALISSGTEGGSVQAMISSQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|27884639|gb|AAN18026.1| unknown [Pseudomonas chlororaphis subsp. aurantiaca]
          Length = 147

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 2/133 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE- 59
           M  +   AL  + +   + A +C     QA MNQC         ++L   Y+++ +++E 
Sbjct: 15  MNPRTFLALAPLLLTPLAQADDCANATTQAAMNQCAAEQHKAADKELNTLYQRINQRLED 74

Query: 60  -KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
              +++L   +Q AW  +R +EC FAASG   G+   ++Y+NC       R E  +SYL 
Sbjct: 75  NPDRKKLLLGAQRAWVAFRDAECGFAASGVAGGSVYPLLYSNCTTELTKARVEAFKSYLE 134

Query: 119 CPEGDLLCPFINN 131
           C EGDL CP   N
Sbjct: 135 CQEGDLGCPVPGN 147


>gi|157146286|ref|YP_001453605.1| hypothetical protein CKO_02044 [Citrobacter koseri ATCC BAA-895]
 gi|157083491|gb|ABV13169.1| hypothetical protein CKO_02044 [Citrobacter koseri ATCC BAA-895]
          Length = 131

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 70/128 (54%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++IIF    + ++ Q++A +C     Q +MN C    F    +KL  TY+  L++ E  
Sbjct: 1   MKRIIFTCAALLLSAQALADDCANASTQMEMNTCAAAQFQTADKKLNETYQNALKRAEPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR+L +K+Q+AW   R ++CA  +SG E G+ Q MI + C+     ER   L S L C E
Sbjct: 61  QRDLLKKAQIAWIALRDADCALVSSGTEGGSIQPMIASQCMTDKTDEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|304415354|ref|ZP_07396030.1| hypothetical protein REG_1819 [Candidatus Regiella insecticola
           LSR1]
 gi|304282794|gb|EFL91281.1| hypothetical protein REG_1819 [Candidatus Regiella insecticola
           LSR1]
          Length = 130

 Score =  170 bits (430), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 64/130 (49%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +K+I  L      F + AL C+    Q++MN C   ++    ++L   Y+ + E+    
Sbjct: 1   MKKMIMVLLAALPVFNASALECDNAQTQSEMNNCATAAYKKADDELNKLYENIKERTRGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            +++ +K+Q  W  YR S+C F    + + +   M+YA C +    ER  + +  L CPE
Sbjct: 61  HKKMLKKTQQKWIEYRDSDCRFQTYLSRKNSIYPMVYAYCRENKTRERVNEFKKMLDCPE 120

Query: 122 GDLLCPFINN 131
           GD+ CP   N
Sbjct: 121 GDVSCPLSVN 130


>gi|91205457|ref|YP_537812.1| hypothetical protein RBE_0642 [Rickettsia bellii RML369-C]
 gi|157827183|ref|YP_001496247.1| hypothetical protein A1I_04335 [Rickettsia bellii OSU 85-389]
 gi|91069001|gb|ABE04723.1| unknown [Rickettsia bellii RML369-C]
 gi|157802487|gb|ABV79210.1| hypothetical protein A1I_04335 [Rickettsia bellii OSU 85-389]
          Length = 134

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 2/133 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + II  L        +    ++C+    Q DMN C    F    ++L   Y+++L+  
Sbjct: 1   MRKIIILYLIFFNYLTYASDSKIDCDNAYTQFDMNYCANEDFKKADKELNQLYQEILKYT 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +  L +KSQ  W  +R ++C F +    +GT   MI + CL G    R E+L++ L 
Sbjct: 61  SEEETNLLKKSQNLWIKFRDADCEFGSFQVRDGTVFPMILSMCLAGKTKVRIEELKNILE 120

Query: 119 CPEGDLLCPFINN 131
           C EGDL C  + N
Sbjct: 121 CSEGDLSCRVLRN 133


>gi|283833727|ref|ZP_06353468.1| putative periplasmic protein [Citrobacter youngae ATCC 29220]
 gi|291070385|gb|EFE08494.1| putative periplasmic protein [Citrobacter youngae ATCC 29220]
          Length = 131

 Score =  169 bits (428), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 68/128 (53%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I+     + ++ Q++A +C     QA+MN C    F     KL  TY+  L++    
Sbjct: 1   MKRIVLTCAALLLSGQALADDCASANTQAEMNTCAAEQFKAADAKLNETYQNALKRAAPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR+L +K+Q +W   R ++CA  +SG E G+ Q+MI + CL     ER   L S L C E
Sbjct: 61  QRDLLKKAQTSWISLRDADCALISSGTEGGSVQAMISSQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|207856464|ref|YP_002243115.1| hypothetical protein SEN0986 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|206708267|emb|CAR32568.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 131

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKQIFLTCAALWFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|204930708|ref|ZP_03221581.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320167|gb|EDZ05371.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 131

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 67/128 (52%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  L++ +  
Sbjct: 1   MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSALKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ QSMI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQSMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|213428504|ref|ZP_03361254.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 131

 Score =  167 bits (423), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 43/128 (33%), Positives = 65/128 (50%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++       +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1   MKRYFPTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C E
Sbjct: 61  QRELLQKAQVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|261339324|ref|ZP_05967182.1| hypothetical protein ENTCAN_05568 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319187|gb|EFC58125.1| putative periplasmic protein [Enterobacter cancerogenus ATCC 35316]
          Length = 131

 Score =  165 bits (419), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 69/128 (53%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            + ++ A   +  +  ++A  C     QADMN CT   +    +KL  TY+ V+++ +  
Sbjct: 1   MKPLLIAGAALLFSTSALADVCASANTQADMNSCTAQQYQAADKKLNQTYQTVMKRADAA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +K+Q AW + R ++CAFAASG+  G+ Q MI   CL     ER   L S + C E
Sbjct: 61  QQPLLKKAQQAWIVLRDADCAFAASGSAGGSVQPMIANQCLAEKTTEREAYLASLMQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|170738341|ref|YP_001779601.1| hypothetical protein Bcenmc03_5990 [Burkholderia cenocepacia MC0-3]
 gi|169820529|gb|ACA95111.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           MC0-3]
          Length = 134

 Score =  164 bits (415), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 64/128 (50%), Gaps = 3/128 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--KHQ 62
           ++ +L ++A    + A NC +   QA M  C   ++     +L  TY+ V  ++      
Sbjct: 7   LLGSLALVASVAHAQA-NCADATDQATMTACADRAYKKSDGELNRTYQAVTARLRGAPPL 65

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C EG
Sbjct: 66  ADKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEEG 125

Query: 123 DLLCPFIN 130
           DL CP   
Sbjct: 126 DLACPVPG 133


>gi|146311196|ref|YP_001176270.1| hypothetical protein Ent638_1540 [Enterobacter sp. 638]
 gi|145318072|gb|ABP60219.1| protein of unknown function DUF1311 [Enterobacter sp. 638]
          Length = 131

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 66/128 (51%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++++     +  +  ++A +C     Q++MN C    +    +KL  TY+  +++    
Sbjct: 1   MKRLMITAAALLFSASALADDCANANTQSEMNICAAQQYQAADKKLNQTYQDAMKRAAVP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QR+L +K+Q AW   R ++CAFAASG   G+ Q MI   CL     +R   L S + C E
Sbjct: 61  QRDLLKKAQQAWITLRDADCAFAASGTAGGSVQPMILNQCLAEKTTDREAFLASMMQCEE 120

Query: 122 GDLLCPFI 129
           GDL CP  
Sbjct: 121 GDLSCPLP 128


>gi|254248430|ref|ZP_04941750.1| hypothetical protein BCPG_03261 [Burkholderia cenocepacia PC184]
 gi|124874931|gb|EAY64921.1| hypothetical protein BCPG_03261 [Burkholderia cenocepacia PC184]
          Length = 162

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--KHQ 62
           ++ +L ++A    + A NC +   QA M  C   ++     +L  TY+ V  ++      
Sbjct: 35  LLGSLALVASVAHAQA-NCADATDQATMTACADRAYKKSDGELNRTYQAVTARLRGAPPL 93

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C EG
Sbjct: 94  ADKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEEG 153

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 154 DLACPVP 160


>gi|107026354|ref|YP_623865.1| hypothetical protein Bcen_4003 [Burkholderia cenocepacia AU 1054]
 gi|116692458|ref|YP_837991.1| hypothetical protein Bcen2424_4364 [Burkholderia cenocepacia
           HI2424]
 gi|105895728|gb|ABF78892.1| protein of unknown function DUF1311 [Burkholderia cenocepacia AU
           1054]
 gi|116650458|gb|ABK11098.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           HI2424]
          Length = 134

 Score =  161 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--KHQ 62
           ++ +L ++A    + A NC +   QA M  C   ++     +L  TY+ V  ++      
Sbjct: 7   LLGSLALVASVAHAQA-NCADATDQATMTACADRAYKKSDGELNRTYQAVTGRLRGAPPL 65

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ AE G+A  M+ + CL      R E L+ YL+C EG
Sbjct: 66  ADKLVNAQRAWIAYRDAECHFSSANAEGGSAYPMVVSTCLDDLTKARTETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|296102966|ref|YP_003613112.1| putative secreted protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295057425|gb|ADF62163.1| putative secreted protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 130

 Score =  161 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 68/128 (53%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +++  A   + ++  ++A  C+    Q ++N C+   +    +KL  TY+  +++   
Sbjct: 1   MMKRVFLAGAALLLSASALADECDNATTQLELNTCSAQQYQAADKKLNQTYQSAIKRAAA 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR+L +K+Q AW   R ++C F  SG E G+ Q MI + CL    +ER   L S + C 
Sbjct: 61  PQRDLLKKAQQAWIALRDADCNFIGSGTEGGSVQPMIMSQCLTEKTVEREAFLASLMQCE 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


>gi|182678739|ref|YP_001832885.1| hypothetical protein Bind_1768 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634622|gb|ACB95396.1| protein of unknown function DUF1311 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 135

 Score =  161 bits (407), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 69/133 (51%), Gaps = 3/133 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M   I+  L ++A+   + + + C + + QA MN+C   +F     +L   YKK+  ++ 
Sbjct: 1   MKATILSGLMVLAMPALAFSKDKCADAMDQATMNECANVAFKKSDSQLNELYKKIETRLS 60

Query: 60  K--HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                ++L  ++Q AW  +R +EC F  S +  G+   MI + C+ G    R + L++YL
Sbjct: 61  DNTDTKKLLAQAQRAWIKFRDAECDFQRSASAGGSVMPMIISMCMDGMTQSRIKDLQNYL 120

Query: 118 TCPEGDLLCPFIN 130
            C EGD+ CP  +
Sbjct: 121 NCKEGDMSCPVPS 133


>gi|311280067|ref|YP_003942298.1| hypothetical protein Entcl_2766 [Enterobacter cloacae SCF1]
 gi|308749262|gb|ADO49014.1| hypothetical protein Entcl_2766 [Enterobacter cloacae SCF1]
          Length = 131

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 67/128 (52%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++I+ A   + ++  ++A  C+    Q  +N+CT   +    +KL  TY  VL++    
Sbjct: 1   MKRILIACGALLVSATALADECSSASTQTALNECTAAQYQAADKKLNDTYATVLKRAPDA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L + +Q  W   R ++CA  +SG+  G+ Q MI + C+    +ER   LES L C E
Sbjct: 61  QKALLKTAQQKWVALRDADCALMSSGSAGGSIQPMINSQCMADKTVERTAWLESLLHCDE 120

Query: 122 GDLLCPFI 129
           GD+ CP  
Sbjct: 121 GDISCPLP 128


>gi|213579932|ref|ZP_03361758.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
          Length = 116

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 43/113 (38%), Positives = 61/113 (53%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  QREL +K+Q+AW   
Sbjct: 1   QALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPPQRELLQKAQVAWIAL 60

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP  
Sbjct: 61  RDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPLP 113


>gi|110634827|ref|YP_675035.1| hypothetical protein Meso_2486 [Mesorhizobium sp. BNC1]
 gi|110285811|gb|ABG63870.1| protein of unknown function DUF1311 [Chelativorans sp. BNC1]
          Length = 135

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 65/132 (49%), Gaps = 3/132 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M   I+  + ++AI   + A + C+    QA MN+C   +F    +KL   YK++  ++ 
Sbjct: 1   MRTIILATVMMLAIPASAFAQDNCSAAEDQATMNECADAAFREADKKLNELYKQIEARLS 60

Query: 60  KHQ--RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                + L  ++Q  W  +R +EC+F  + A  G+   M+ A C++     R E  E YL
Sbjct: 61  DDAETKNLLVQAQRDWVKFRDAECSFQTASAAGGSVMPMLTATCMESLTQVRVEAFEGYL 120

Query: 118 TCPEGDLLCPFI 129
            C EGDL CP  
Sbjct: 121 NCEEGDLSCPVP 132


>gi|83591822|ref|YP_425574.1| hypothetical protein Rru_A0482 [Rhodospirillum rubrum ATCC 11170]
 gi|83574736|gb|ABC21287.1| Protein of unknown function DUF1311 [Rhodospirillum rubrum ATCC
           11170]
          Length = 226

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWE 74
           Q+ A  C     QA+M  C   +      +L   YK +  ++  +   +     +Q AW 
Sbjct: 110 QARAQECAAPQTQAEMTLCADQALRRTDGELNQLYKDLGGRLKNDPDTKARLVGAQKAWL 169

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
            +R  ECAFA SG E G+A  M  A C +G   +R ++L SYL C EGDL CP  
Sbjct: 170 AFRDGECAFATSGVEGGSAYPMALATCREGLTQKRVKELRSYLRCAEGDLTCPVP 224


>gi|222081429|ref|YP_002540792.1| urease-associated protein [Agrobacterium radiobacter K84]
 gi|221726108|gb|ACM29197.1| urease-associated protein [Agrobacterium radiobacter K84]
          Length = 135

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 41/126 (32%), Positives = 62/126 (49%), Gaps = 2/126 (1%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRE 64
            AL +    F     NC +   Q DMN C G ++A    +L   YK++  ++  +   ++
Sbjct: 8   IALILATPTFALAEQNCGDLTTQTDMNICAGKAYAKSDAELNVLYKQIEARLKDDADTKK 67

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDL 124
           L   +Q AW  YR +EC F++S    GT    I ++CL      R E L+ YL C +GDL
Sbjct: 68  LLVSTQKAWVGYRDAECNFSSSKVTGGTVYPFISSSCLNNMTRSRIEDLKGYLKCGDGDL 127

Query: 125 LCPFIN 130
            CP  +
Sbjct: 128 DCPVPS 133


>gi|330810871|ref|YP_004355333.1| hypothetical protein PSEBR_a3936 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378979|gb|AEA70329.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 133

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 2/105 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--KHQRELFEKSQMAWEIYRGSECAFA 84
             Q +MNQC          +L + YK++  +++     +++  K+Q AW  +R +EC F+
Sbjct: 27  TTQGEMNQCAAKENKAADNELNSLYKQITARLKDNPEAKQMLVKAQRAWIGFRDAECNFS 86

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           ASG E G+   +IY+NC+      R E  ++YL C EGDL CP  
Sbjct: 87  ASGVEGGSVYPLIYSNCITTQTKARVEAFKNYLKCKEGDLSCPVP 131


>gi|206563342|ref|YP_002234105.1| hypothetical protein BCAM1492 [Burkholderia cenocepacia J2315]
 gi|198039382|emb|CAR55347.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 134

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 66/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           ++ +L ++A    + A NC +   QA M  C   ++     +L  TY+ V  ++   +  
Sbjct: 7   LLGSLALVASVAHAQA-NCADATDQATMTACADRAYKKSDGELNRTYQAVTARLRDARPL 65

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ AE+G+A  M+ + CL      R + L+ YL+C EG
Sbjct: 66  ADKLVNAQRAWIAYRDAECRFSSANAEDGSAYPMVVSTCLDDLTKARTDTLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|254254013|ref|ZP_04947330.1| hypothetical protein BDAG_03300 [Burkholderia dolosa AUO158]
 gi|124898658|gb|EAY70501.1| hypothetical protein BDAG_03300 [Burkholderia dolosa AUO158]
          Length = 138

 Score =  156 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 62/125 (49%), Gaps = 3/125 (2%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RE 64
            ALT+ A    + A NC     QA +  C   ++     +L  TY+ V  ++   +   +
Sbjct: 13  LALTLAADIAHAQA-NCTSATDQATLTACADRAYKKADAELNRTYQAVTARLRDARPLAD 71

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDL 124
               +Q AW  YR +EC F+++ AE G+   M+ + CL+     R E L+ YL+C EGDL
Sbjct: 72  KLVNAQRAWIAYRDAECHFSSANAEGGSVYPMVMSTCLEDLTKARTETLKGYLSCEEGDL 131

Query: 125 LCPFI 129
            CP  
Sbjct: 132 ACPVP 136


>gi|239834266|ref|ZP_04682594.1| Hypothetical protein OINT_2001088 [Ochrobactrum intermedium LMG
           3301]
 gi|239822329|gb|EEQ93898.1| Hypothetical protein OINT_2001088 [Ochrobactrum intermedium LMG
           3301]
          Length = 134

 Score =  156 bits (395), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 75/133 (56%), Gaps = 2/133 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M + I  ALT +  +  + A   C+    QA MN+C G  F    +KL + Y+++  ++ 
Sbjct: 1   MLKYIAIALTAMFFSGSASASSECDNAQDQATMNKCAGQGFQKADKKLNSLYQQLERRLA 60

Query: 60  K-HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
               ++L   SQ AW  +R +EC F++SG E GT Q M+YA C +    +R+++L  +L 
Sbjct: 61  GNDAKKLLTISQRAWIKFRDAECEFSSSGTEGGTVQPMVYAMCRERLTADRSKQLSEHLK 120

Query: 119 CPEGDLLCPFINN 131
           C EGDL CP +++
Sbjct: 121 CEEGDLSCPQLSS 133


>gi|134293579|ref|YP_001117315.1| hypothetical protein Bcep1808_4893 [Burkholderia vietnamiensis G4]
 gi|134136736|gb|ABO57850.1| protein of unknown function DUF1311 [Burkholderia vietnamiensis G4]
          Length = 134

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 59/126 (46%), Gaps = 2/126 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--R 63
           +     +         NC +   QA M  C   ++     +L  TY+ V  ++   +   
Sbjct: 7   LLCALALTANLAHAQTNCADAADQAAMTACADRAYKKSDAELNRTYQAVTARLRDARPLA 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +    +Q AW  YR +EC+F+++ AE G+  SM+ + CL      R E L+ YL+C EGD
Sbjct: 67  DKLVSAQRAWIAYRDAECSFSSANAEGGSVYSMVVSTCLDDLTKTRTETLKGYLSCEEGD 126

Query: 124 LLCPFI 129
           L CP  
Sbjct: 127 LACPVP 132


>gi|78062503|ref|YP_372411.1| hypothetical protein Bcep18194_B1653 [Burkholderia sp. 383]
 gi|77970388|gb|ABB11767.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 134

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           ++ +L + A    + A NC +   QA M  C   ++     +L  TY+ V  ++   +  
Sbjct: 7   LLCSLALAANVAHAQA-NCADATDQAAMTACADRAYKKSDGELNRTYQAVTARLRDARPL 65

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ AE G+A SM+ + CL      R E L+ YL+C EG
Sbjct: 66  ADKLVNAQRAWIAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKARTETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|70731472|ref|YP_261213.1| hypothetical protein PFL_4116 [Pseudomonas fluorescens Pf-5]
 gi|68345771|gb|AAY93377.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 133

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 38/113 (33%), Positives = 60/113 (53%), Gaps = 3/113 (2%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIY 76
            A  CN T  Q DM+ C         ++L A Y+++ +++  + H ++L   +Q AW  +
Sbjct: 20  QAYECNNT-TQTDMSLCANFQHKAADKELNALYQQINQRLKDQPHSKKLLVSAQRAWVAF 78

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           R +EC+F+ SG E G+   + Y+NC+      R E  + YL C EGDL CP  
Sbjct: 79  RDAECSFSTSGVEGGSLYPVAYSNCITALTKTRVESFKQYLQCKEGDLSCPVP 131


>gi|115358523|ref|YP_775661.1| hypothetical protein Bamb_3773 [Burkholderia ambifaria AMMD]
 gi|115283811|gb|ABI89327.1| protein of unknown function DUF1311 [Burkholderia ambifaria AMMD]
          Length = 134

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 66/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           ++ AL + A    + A NC ET  QA M  C   ++     +L  TY+ V  ++   +  
Sbjct: 7   LLCALALTANLAHAQA-NCAETTDQAAMTACADRAYKKSDAELNRTYQAVTARLRDAKPL 65

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            E    +Q  W  YR +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C EG
Sbjct: 66  AEKLVNAQRTWIAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|171322144|ref|ZP_02911004.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
 gi|171092552|gb|EDT37868.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
          Length = 134

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 65/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           ++ AL + A    + A NC +   QA M  C   ++     +L  TY+ V  ++   +  
Sbjct: 7   LLCALALTANLAHAQA-NCADATDQAAMTACADRAYKKSDAELNRTYQAVTARLRDAKPL 65

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            E    +Q  W  YR +EC F+++ AE G+A SM+ A CL      RNE L+ YL+C EG
Sbjct: 66  AEKLVNAQRTWIAYRDAECNFSSANAEGGSAYSMVVATCLDDLTRIRNETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|283784819|ref|YP_003364684.1| hypothetical protein ROD_10671 [Citrobacter rodentium ICC168]
 gi|282948273|emb|CBG87844.1| putative exported protein [Citrobacter rodentium ICC168]
          Length = 131

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 49/128 (38%), Positives = 67/128 (52%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI  A   + ++  ++A  C     QADMN C    +    +KL  T++  LE+  + 
Sbjct: 1   MKKIFLAGAALLLSASALADECANAATQADMNACAITQYQTADKKLNETFRNALERAAEP 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           QREL +K+Q AW   R ++CA  ASG E G+AQ MI   CL     ER   L S L C E
Sbjct: 61  QRELLKKAQNAWIAVRDADCALIASGTEGGSAQVMIANQCLADKTDEREAFLASLLQCEE 120

Query: 122 GDLLCPFI 129
           GD+ CP  
Sbjct: 121 GDMSCPLP 128


>gi|221196455|ref|ZP_03569502.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221203126|ref|ZP_03576145.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221177060|gb|EEE09488.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221183009|gb|EEE15409.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 135

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 2/127 (1%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           ++    ++A +      NC     QA +  C  +++      L  TY+ V  ++   +  
Sbjct: 7   VLLCTLMLAASVAHAQANCANASDQATLTACAEHAYRQSDAVLNRTYQTVTARLRDARPV 66

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C EG
Sbjct: 67  ADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEEG 126

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 127 DLACPVP 133


>gi|325518758|gb|EGC98359.1| hypothetical protein B1M_42033 [Burkholderia sp. TJI49]
          Length = 133

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 3/126 (2%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--R 63
           +    ++A    + A NC     QA M  C   ++      L  TY+ V  ++   +   
Sbjct: 7   LLCSLVLAANAHAQA-NCANASDQASMTACAERAYRQSDAVLNRTYQAVTARLRDARPLD 65

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +    +Q AW  YR +EC F+++ AE G+   M+ + CL     ER E L++YL+C +GD
Sbjct: 66  DKLVAAQRAWIAYRDAECQFSSANAEGGSGYQMVVSTCLDDLTKERTETLKAYLSCEDGD 125

Query: 124 LLCPFI 129
           L CP  
Sbjct: 126 LACPVP 131


>gi|161520803|ref|YP_001584230.1| hypothetical protein Bmul_4257 [Burkholderia multivorans ATCC
           17616]
 gi|189353015|ref|YP_001948642.1| hypothetical protein BMULJ_04249 [Burkholderia multivorans ATCC
           17616]
 gi|160344853|gb|ABX17938.1| protein of unknown function DUF1311 [Burkholderia multivorans ATCC
           17616]
 gi|189337037|dbj|BAG46106.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 135

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 2/127 (1%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           ++    ++A +      NC     QA +  C   ++      L  TY+ V  ++   +  
Sbjct: 7   VLLCPLMLAASVAHAQANCANASDQATLTACAERAYKQSDAVLNRTYQTVTARLRDARPV 66

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C EG
Sbjct: 67  ADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEEG 126

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 127 DLACPVP 133


>gi|170703718|ref|ZP_02894441.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
 gi|170131373|gb|EDS99977.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
          Length = 134

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 59/126 (46%), Gaps = 2/126 (1%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--R 63
           +     +         NC +   QA M  C   ++     +L  TY+ +  ++   +   
Sbjct: 7   LLCALALTANLAHAQSNCADVTDQAAMTACADRAYKKSDAELNRTYQAITARLRDAKPLA 66

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           E     Q AW  YR +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C EGD
Sbjct: 67  EKLVNGQRAWIAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEEGD 126

Query: 124 LLCPFI 129
           L CP  
Sbjct: 127 LACPVP 132


>gi|172063276|ref|YP_001810927.1| hypothetical protein BamMC406_4247 [Burkholderia ambifaria MC40-6]
 gi|171995793|gb|ACB66711.1| protein of unknown function DUF1311 [Burkholderia ambifaria MC40-6]
          Length = 134

 Score =  150 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 65/127 (51%), Gaps = 3/127 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           ++ AL + A    + A NC E   QA M  C   ++     +L  TY+ V  ++   +  
Sbjct: 7   LLCALALTANLAHAQA-NCAEATEQAAMTACADRAYKKSDAELNRTYQAVTARLRDAKPL 65

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            E    +Q  W  YR +EC F+++ AE G+A SM+ + CL      RNE L+ YL+C EG
Sbjct: 66  AEKLVSAQRTWLAYRDAECNFSSANAEGGSAYSMVVSTCLDDLTKIRNETLKGYLSCEEG 125

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 126 DLACPVP 132


>gi|221210087|ref|ZP_03583068.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221170775|gb|EEE03241.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 135

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 2/127 (1%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           ++    ++A +      NC     QA +  C   ++      L  TY+ V  ++   +  
Sbjct: 7   VLLCPLMLAASVAHAQANCANASDQATLTACAERAYKQSDAVLNRTYQTVTARLRDARPA 66

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            +    +Q AW  YR +EC F+++ A+ G+A +M+ A CL     ER E L++YL+C EG
Sbjct: 67  ADKLVAAQRAWIAYRDAECQFSSANADGGSAYAMVVATCLDDLTKERTETLKAYLSCEEG 126

Query: 123 DLLCPFI 129
           DL CP  
Sbjct: 127 DLACPVP 133


>gi|153007841|ref|YP_001369056.1| hypothetical protein Oant_0496 [Ochrobactrum anthropi ATCC 49188]
 gi|151559729|gb|ABS13227.1| protein of unknown function DUF1311 [Ochrobactrum anthropi ATCC
           49188]
          Length = 136

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 3/126 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-R 63
           I  A +  AI   + A +C     Q+ +N+C G ++     +L   +K +  + +    +
Sbjct: 9   IGVAFSAFAIIATAQADDCQNASSQSALNECYGKAYKKSDAELNKIFKTLQRRADDADLK 68

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +   +SQ  W  +R +EC     G   G+   M Y+ CL     ER   L+ YL C EGD
Sbjct: 69  KKLVQSQRTWIAFRDAECDMQTVG--GGSISGMAYSICLSDLTAERVSDLKKYLKCEEGD 126

Query: 124 LLCPFI 129
             CPF 
Sbjct: 127 SNCPFP 132


>gi|298291881|ref|YP_003693820.1| hypothetical protein Snov_1898 [Starkeya novella DSM 506]
 gi|296928392|gb|ADH89201.1| protein of unknown function DUF1311 [Starkeya novella DSM 506]
          Length = 139

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEKSQ 70
            I+  ++A +C +   Q  ++QC G +F     +L   Y ++  ++      +     +Q
Sbjct: 19  VISGPALAQDCADP-TQMGLDQCAGAAFKKSDARLNQVYGQIAARLSGDAATKAKLVAAQ 77

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
            AW  +R +ECAF A+G E G+  SM    C +     R  +LE  L C EGD  CP  
Sbjct: 78  RAWIAFRDAECAFRAAGVEGGSIHSMTVTLCRKDVTDRRVTELEPLLNCEEGDTSCPVP 136


>gi|167584243|ref|ZP_02376631.1| hypothetical protein BuboB_02839 [Burkholderia ubonensis Bu]
          Length = 130

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEKSQMAWEIYRGSECAFAA 85
            QA M+ C   ++     +L   Y+ V  +V  ++   E    +Q AW  YR +EC F++
Sbjct: 25  DQASMSACADRAYRKSDAELNRAYEAVTARVRANRPLAEKLVSAQRAWVAYRDAECGFSS 84

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           +GAE G+   M+ + CL      R E L+ YL+C EGDL CP  
Sbjct: 85  AGAEGGSVHPMVVSMCLDDLTKARTESLQGYLSCEEGDLACPVP 128


>gi|159028823|emb|CAO89994.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 141

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 48/101 (47%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +   NCN    Q++MN C   ++     KL   Y+++L ++   +++    +Q AW  +R
Sbjct: 37  AQRPNCNNPQTQSEMNICASIAYQNADRKLNQVYRQLLPRLSAARKQKLISAQQAWIKFR 96

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            S C F  S  E G+   MIY  CL     +R + L  YL 
Sbjct: 97  DSSCEFERSAYEGGSLAPMIYGFCLANVTEQRTKDLRRYLE 137


>gi|239946946|ref|ZP_04698699.1| putative lipoprotein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921222|gb|EER21246.1| putative lipoprotein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 118

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + IIF    ++    + A++CN  L Q DM+ C    +  V ++L   Y+++L+ +  
Sbjct: 1   MKKAIIFCWLFLSSISCTFAVDCNNALTQGDMHYCADEEYKKVDKELNQIYQEILKHISD 60

Query: 61  HQRE--LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            Q +  L +KSQ  W  YR +EC F +     G+   MI   C        ++ L+ 
Sbjct: 61  KQEQVNLLKKSQNLWIKYREAECEFQSFRVYGGSVYPMILLMCFTKKTKSVSKNLKP 117


>gi|226330097|ref|ZP_03805615.1| hypothetical protein PROPEN_04010 [Proteus penneri ATCC 35198]
 gi|225200892|gb|EEG83246.1| hypothetical protein PROPEN_04010 [Proteus penneri ATCC 35198]
          Length = 129

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 1   MCRKIIFA-----LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M + I+F      +   +I  Q+   +C     Q ++NQC    F    E+L   Y++  
Sbjct: 5   MKKLILFGTISGGILFWSIHLQADNFDCRNAATQTEINQCVYQDFQQKDEELNHIYQQYY 64

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            K+E  +++  +++Q+ W  +R   C + A   + G+   M+Y++CL+    ER   L++
Sbjct: 65  AKLEGVRKDQLKQAQLVWINFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTTERISDLKN 124

Query: 116 YL 117
           Y+
Sbjct: 125 YI 126


>gi|217976558|ref|YP_002360705.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
 gi|217501934|gb|ACK49343.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
          Length = 134

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 63/132 (47%), Gaps = 4/132 (3%)

Query: 2   CRKIIFALTIIAI--AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV- 58
            R +I AL++ A      + A +C     QA +N C   +      +L A Y+ ++ ++ 
Sbjct: 1   MRPLIVALSLFAALSGMTARAEDCGAAATQAAINDCANTALKNTDAELNAIYRSLIGRLK 60

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                R+    +Q AW  +R  ECAFAAS  ++G+    I ANC      +R + L  YL
Sbjct: 61  NSDDSRQSLIAAQRAWLQFRDGECAFAASSVKDGSIYPTIVANCRNALTADRVKALGVYL 120

Query: 118 TCPEGDLLCPFI 129
            C EGD+ CP  
Sbjct: 121 NCAEGDMGCPVP 132


>gi|295096268|emb|CBK85358.1| Uncharacterized protein conserved in bacteria [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 131

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 55/108 (50%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
             C++   Q +++ C    +    +KL  TY+  +++    QR+L +K+Q AW   R ++
Sbjct: 20  DECDKATTQTELSACAAEQYQAADKKLNQTYQAAIKRAAAPQRDLLKKAQQAWIALRDAD 79

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           C    SG E GT Q MI   CL     ER   L S + C EG+L CPF
Sbjct: 80  CKLMGSGTEGGTIQPMIINQCLTEKTAEREAFLASLMQCEEGNLSCPF 127


>gi|166368170|ref|YP_001660443.1| hypothetical protein MAE_54290 [Microcystis aeruginosa NIES-843]
 gi|166090543|dbj|BAG05251.1| hypothetical protein MAE_54290 [Microcystis aeruginosa NIES-843]
          Length = 141

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 48/101 (47%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +   NCN    Q+ MN C   ++     KL   Y+++L K+   +++    +Q AW  +R
Sbjct: 37  AQRPNCNNPQTQSQMNICASIAYQNADRKLNQVYRQLLPKLSAARKQKLITAQQAWIKFR 96

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            S C F  S  E G+   MIY NCL     +R + L  YL 
Sbjct: 97  DSSCEFERSAYEGGSIAPMIYGNCLAAVTEQRTKDLRRYLE 137


>gi|229586281|ref|YP_002844782.1| hypothetical protein RAF_ORF0064 [Rickettsia africae ESF-5]
 gi|228021331|gb|ACP53039.1| Unknown [Rickettsia africae ESF-5]
          Length = 122

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 5/108 (4%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE--LFEKSQMAWEIYRGSECAFA 84
           ++Q DMN C    +  V +KL   Y+++L+ +   + +  L +KS   W  YR ++C F 
Sbjct: 1   MIQGDMNYCVAAEYKKVDKKLNQIYQEILKHISDKREQVNLLKKSPNLWIKYRDADCEFR 60

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERN---EKLESYLTCPEGDLLCPFI 129
           + G   G+   MI   CL  +   R    ++ E+ L C EG+L CPFI
Sbjct: 61  SFGVYGGSVYPMILLMCLTSYRKNRRAYKKEFEAMLKCEEGNLSCPFI 108


>gi|293607356|ref|ZP_06689695.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292814200|gb|EFF73342.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 137

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 2/118 (1%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMA 72
              +  L C+    Q DMN C    +    + L   Y+ V+E+++    +    + +Q A
Sbjct: 18  GVHAQPLKCDNATTQTDMNLCADQDYRKSDKDLNDAYRSVVERLKDDSIKTTKLQAAQKA 77

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN 130
           W  +R +ECAF++ G   G+A  M+ + CL      R ++L +YL C EGD  CP   
Sbjct: 78  WLFFRDAECAFSSGGTSGGSAYPMVLSLCLDKLTQARTKELRAYLQCEEGDTSCPVPG 135


>gi|17229369|ref|NP_485917.1| hypothetical protein alr1877 [Nostoc sp. PCC 7120]
 gi|17130967|dbj|BAB73576.1| alr1877 [Nostoc sp. PCC 7120]
          Length = 153

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 6   IFALTIIAIAFQSMA--------LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           I A + +  +  + A        +NC+    Q ++NQC+  S+    +KL   YK++L K
Sbjct: 30  ILACSTLLFSTAASAKPMLLVQNINCDNAQTQLEINQCSTQSYQNADKKLNQAYKQLLPK 89

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +++ +++    +Q AW  +R S C F +S  E G+    +Y NCL+    +R ++L+ YL
Sbjct: 90  LQRSRKQKLIAAQQAWIKFRDSSCEFESSQYEGGSIAPSVYLNCLEKLTQQRTQELQEYL 149

Query: 118 T 118
            
Sbjct: 150 Q 150


>gi|290510753|ref|ZP_06550123.1| hypothetical protein HMPREF0485_02523 [Klebsiella sp. 1_1_55]
 gi|289777469|gb|EFD85467.1| hypothetical protein HMPREF0485_02523 [Klebsiella sp. 1_1_55]
          Length = 131

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 71/128 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    
Sbjct: 1   MKRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +
Sbjct: 61  QQTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCED 120

Query: 122 GDLLCPFI 129
           GD  CP  
Sbjct: 121 GDQSCPLP 128


>gi|206575813|ref|YP_002239339.1| hypothetical protein KPK_3519 [Klebsiella pneumoniae 342]
 gi|206564871|gb|ACI06647.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
          Length = 131

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/128 (32%), Positives = 72/128 (56%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++ E  
Sbjct: 1   MKRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAEGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +
Sbjct: 61  QQTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLLSQCMTDKSVERESFLASLLQCED 120

Query: 122 GDLLCPFI 129
           GD  CP  
Sbjct: 121 GDQSCPLP 128


>gi|288936192|ref|YP_003440251.1| hypothetical protein Kvar_3339 [Klebsiella variicola At-22]
 gi|288890901|gb|ADC59219.1| protein of unknown function DUF1311 [Klebsiella variicola At-22]
          Length = 131

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 71/128 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    
Sbjct: 1   MKRTLFAVMALLASGAALADECSNANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +
Sbjct: 61  QQTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLISQCMTDKSVERESFLASLLQCED 120

Query: 122 GDLLCPFI 129
           GD  CP  
Sbjct: 121 GDQSCPLP 128


>gi|227355531|ref|ZP_03839926.1| secreted protein [Proteus mirabilis ATCC 29906]
 gi|227164327|gb|EEI49216.1| secreted protein [Proteus mirabilis ATCC 29906]
          Length = 129

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 1   MCRKIIFA------LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M +K+IF       +   +I  Q+   +C     Q ++NQC    F    E+L   Y++ 
Sbjct: 4   MMKKVIFVSAISGGILFWSIHLQADNFDCRNAETQTEINQCAYQDFQQKDEELSQIYQQY 63

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K+E  +++  + +Q  W  +R   C + A   + G+   M+Y++CL+   IER   L+
Sbjct: 64  YAKLETKRQQQLQHAQSVWMTFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTIERINDLK 123

Query: 115 SYL 117
           +Y+
Sbjct: 124 NYI 126


>gi|197285104|ref|YP_002150976.1| hypothetical protein PMI1245 [Proteus mirabilis HI4320]
 gi|194682591|emb|CAR42652.1| putative exported protein [Proteus mirabilis HI4320]
          Length = 129

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 1   MCRKIIFA------LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           M +K+IF       +   +I  Q+   +C     Q ++NQC    F    E+L   Y++ 
Sbjct: 4   MMKKVIFVSAISGGILFWSIHLQADNFDCRNAETQTEINQCAYQDFQQKDEELSQIYQQY 63

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             K+E  +++  + +Q  W  +R   C + A   + G+   M+Y++CL+   IER   L+
Sbjct: 64  YVKLETKRQQQLQHAQSVWMTFRDLSCQYEADYYQGGSLAPMVYSSCLKDKTIERINDLK 123

Query: 115 SYL 117
           +Y+
Sbjct: 124 NYI 126


>gi|13473270|ref|NP_104837.1| hypothetical protein mll3812 [Mesorhizobium loti MAFF303099]
 gi|14024018|dbj|BAB50623.1| mll3812 [Mesorhizobium loti MAFF303099]
          Length = 143

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 65/133 (48%), Gaps = 3/133 (2%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEK 57
           + R+I+ +  ++ +A  S+  A  C+ +   Q  MN C G  +     KL A YK ++  
Sbjct: 4   IMRRILLSACLVVLAGTSIVRAQECDRSDDSQQMMNICAGEDYQAADAKLNAAYKDLISS 63

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +   + L + +Q AW  +R +ECA + + +  G+  +M  + CL     +R ++L +  
Sbjct: 64  DDADGKRLLQVAQRAWITFRDAECAHSTAASAGGSIHAMEVSQCLTRLTNDRIKQLAASA 123

Query: 118 TCPEGDLLCPFIN 130
            C EGD  C   N
Sbjct: 124 NCQEGDASCASPN 136


>gi|152969596|ref|YP_001334705.1| hypothetical protein KPN_01040 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238894079|ref|YP_002918813.1| hypothetical protein KP1_2029 [Klebsiella pneumoniae NTUH-K2044]
 gi|262043595|ref|ZP_06016706.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150954445|gb|ABR76475.1| hypothetical protein KPN_01040 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238546395|dbj|BAH62746.1| hypothetical protein KP1_2029 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259039067|gb|EEW40227.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 131

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 71/128 (55%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++ +FA+  +  +  ++A  C+    Q +MNQC    +    +KL  T+++ L++    
Sbjct: 1   MKRTLFAVMALLASGAALADECSSANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGK 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           Q+ L +++Q AW   R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +
Sbjct: 61  QQTLLKQAQQAWIALRDADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCED 120

Query: 122 GDLLCPFI 129
           GD  CP  
Sbjct: 121 GDQSCPLP 128


>gi|282900925|ref|ZP_06308859.1| protein of unknown function DUF1311 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194194|gb|EFA69157.1| protein of unknown function DUF1311 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 139

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-HQRELFEKSQMAWEIY 76
           + + NC   + Q DMN C      +   KL   YK+V  +     + +L   +Q AW  Y
Sbjct: 31  AQSPNCVNRITQYDMNLCASLDAKVADGKLNQIYKQVRVRYNANPEAKLLIDAQKAWIKY 90

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLL 125
           R + CAF+    + G+   M+Y  CL+    ER ++LESYL   EG   
Sbjct: 91  RDASCAFSRGRFQGGSIVPMVYHGCLERLTKERTKELESYLQ--EGSFS 137


>gi|260461481|ref|ZP_05809728.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
 gi|259032551|gb|EEW33815.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
          Length = 139

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 63/132 (47%), Gaps = 3/132 (2%)

Query: 2   CRKIIFALTIIAIAFQSM--ALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKV 58
            R+I  +  ++ +A  S+  A  C+ +   Q  MN C G  +     +L A Y+ ++   
Sbjct: 1   MRRIFLSACLVLLAGTSIVRAQECDRSDDSQQMMNICAGEDYQAADARLNAAYQDLISSD 60

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +   + L + +Q AW  +R +ECA + + +  G+  +M  + CL     +R  +L +   
Sbjct: 61  DADGKRLLQAAQRAWIAFRDAECAHSTAASAGGSIHAMAVSQCLTRLTDDRTRQLAAAAN 120

Query: 119 CPEGDLLCPFIN 130
           C EGD+ C   +
Sbjct: 121 CEEGDVSCASPD 132


>gi|330014289|ref|ZP_08307866.1| hypothetical protein HMPREF9538_05586 [Klebsiella sp. MS 92-3]
 gi|328533269|gb|EGF60026.1| hypothetical protein HMPREF9538_05586 [Klebsiella sp. MS 92-3]
          Length = 120

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 63/116 (54%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
               ++A  C+    Q +MNQC    +    +KL  T+++ L++    Q+ L +++Q AW
Sbjct: 2   AGGAALADECSSANTQTEMNQCAAAQYQAADKKLNDTWQQALQRAVGKQQTLLKQAQQAW 61

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
              R ++CAF ASGAE G+ Q M+ + C+   ++ER   L S L C +GD  CP  
Sbjct: 62  IALRDADCAFLASGAEGGSMQPMLVSQCMTDKSVERESFLASLLQCEDGDQSCPLP 117


>gi|75910969|ref|YP_325265.1| hypothetical protein Ava_4773 [Anabaena variabilis ATCC 29413]
 gi|75704694|gb|ABA24370.1| Protein of unknown function DUF1311 [Anabaena variabilis ATCC
           29413]
          Length = 135

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 57/101 (56%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +  LNC+    Q ++NQC+  S+    +KL   YK++L K+++ +++    +Q AW  +R
Sbjct: 32  AQNLNCDNAQTQLEINQCSKQSYQNADKKLNQAYKQLLPKLQRSRKQKLIAAQQAWIKFR 91

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            S C F +S  E G+    +Y NCL+    +R ++L+ YL 
Sbjct: 92  DSSCEFESSQYEGGSIAPSVYLNCLEKLTQQRTQELQEYLQ 132


>gi|170748739|ref|YP_001754999.1| hypothetical protein Mrad2831_2321 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655261|gb|ACB24316.1| protein of unknown function DUF1311 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 144

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 1/126 (0%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +CR +  A T+++ A  + A  C E   QAD+N C G  +      L A Y ++ +K+  
Sbjct: 14  LCRGLALAATLLSPAPAAAADPC-EGTTQADLNACAGADYRAADTALNAVYGQLTKKIGP 72

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
             ++    +Q AW  YR + C     G + G+A +M Y  CL+G    R + L+ YL C 
Sbjct: 73  KTKDALRGAQKAWLSYRDATCFLETLGLDGGSAYAMAYNGCLKGLTDARIKVLKGYLDCK 132

Query: 121 EGDLLC 126
             D+ C
Sbjct: 133 ADDVSC 138


>gi|186683924|ref|YP_001867120.1| hypothetical protein Npun_F3792 [Nostoc punctiforme PCC 73102]
 gi|186466376|gb|ACC82177.1| protein of unknown function DUF1311 [Nostoc punctiforme PCC 73102]
          Length = 140

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 52/101 (51%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           +   NCN    QA +N+C  +S+    ++L   Y+++L  +EK +++    +Q AW  +R
Sbjct: 37  AQKFNCNNPQTQAAINECANSSYQNADKRLNRAYQQLLPTLEKSRKQKLIAAQQAWLKFR 96

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + C F  S  E G+    IY  CL+     R ++L+ YL 
Sbjct: 97  DTNCEFERSKYEGGSIAPSIYVGCLENLTKLRTQQLQEYLK 137


>gi|170736832|ref|YP_001778092.1| hypothetical protein Bcenmc03_4459 [Burkholderia cenocepacia MC0-3]
 gi|254249463|ref|ZP_04942783.1| hypothetical protein BCPG_04327 [Burkholderia cenocepacia PC184]
 gi|124875964|gb|EAY65954.1| hypothetical protein BCPG_04327 [Burkholderia cenocepacia PC184]
 gi|169819020|gb|ACA93602.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           MC0-3]
          Length = 138

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 52/114 (45%), Gaps = 2/114 (1%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEKSQMAWE 74
              A +C     Q  MN+C   ++A    +L   Y+ +  +++  +       ++Q AW 
Sbjct: 22  AHAAPDCANPQDQRTMNECASRAYARADAELNRRYRALQSRLKDDRDGARKLTEAQRAWI 81

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
            +R +EC F       G+A+ +  A CL+     R+  L+ YL C EGD  CP 
Sbjct: 82  AFRDTECVFQTIRVAGGSAEPLARAACLEETTRSRSAALQRYLECGEGDTNCPV 135


>gi|119385807|ref|YP_916862.1| hypothetical protein Pden_3085 [Paracoccus denitrificans PD1222]
 gi|119376402|gb|ABL71166.1| protein of unknown function DUF1311 [Paracoccus denitrificans
           PD1222]
          Length = 135

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 63/132 (47%), Gaps = 3/132 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV- 58
           M   ++ A+        + A  C ++ + QA MN+C   ++      L   + ++ +++ 
Sbjct: 1   MKHIVLAAIFCTLSLSAAQADQCMDKAVDQASMNRCAAQAYEKSDADLNKYFHEIRQRLA 60

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +   R L   SQ AW  +R +ECAFAAS    G+A  M +  CL     +R  +L  YL
Sbjct: 61  DDVDARHLLRDSQRAWITFRDAECAFAASATAGGSAYPMAHDLCLADLTQKRAYELRQYL 120

Query: 118 TCPEGDLLCPFI 129
            C EGD+ CP  
Sbjct: 121 ECEEGDMTCPVP 132


>gi|319781087|ref|YP_004140563.1| hypothetical protein Mesci_1353 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166975|gb|ADV10513.1| hypothetical protein Mesci_1353 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 140

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 1/110 (0%)

Query: 18  SMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           + A  C+ +   Q  MN C G  +     +L   Y+ ++   + + + L + +Q AW  +
Sbjct: 19  ARAQECDRSDDSQQMMNICAGEDYQAADARLNTAYQNLISSDDANGKRLLQVAQRAWITF 78

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLC 126
           R +ECA + + +E G+  SM  + CL     +R ++L +   C EGD  C
Sbjct: 79  RDAECAHSTAASEGGSIHSMEVSQCLTRLTNDRVKQLAAAANCEEGDGSC 128


>gi|311108538|ref|YP_003981391.1| hypothetical protein AXYL_05376 [Achromobacter xylosoxidans A8]
 gi|310763227|gb|ADP18676.1| hypothetical protein AXYL_05376 [Achromobacter xylosoxidans A8]
          Length = 136

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRG 78
           L+C     Q DM+ C   ++      L A YK+V  ++  ++        +Q AW  +R 
Sbjct: 23  LDCGNAATQTDMSLCADQAYRKSDAALNAAYKEVGARLKNDRDATTQLHAAQKAWLFFRD 82

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN 130
           +ECAFA+S    G+A  M  + CL      R ++L +YL C EGDL CP   
Sbjct: 83  AECAFASSSTSGGSAYPMTLSLCLDKLTQARTKELRAYLKCEEGDLSCPVPG 134


>gi|282897347|ref|ZP_06305349.1| Protein of unknown function DUF1311 [Raphidiopsis brookii D9]
 gi|281197999|gb|EFA72893.1| Protein of unknown function DUF1311 [Raphidiopsis brookii D9]
          Length = 136

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 1/109 (0%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFE 67
           L +   +  +   +C + + QA +NQC   +     +KL   YKK L   + K Q +L  
Sbjct: 22  LIVTGTSAIAQFSDCQKAVTQAQLNQCAAINAKTADQKLNDAYKKALAIYKGKPQAKLLV 81

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            ++ AW  YR + CAF+ S  E G+   M+Y NCL+    ER ++L  Y
Sbjct: 82  AAEEAWIKYRDASCAFSRSRVEGGSIMPMVYLNCLERLTKERTQELARY 130


>gi|300864982|ref|ZP_07109813.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300337017|emb|CBN54963.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 227

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 51/99 (51%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + A+ CN      +M +C  +S+A+  +KL   Y++ + K+    +    ++Q AW  +R
Sbjct: 33  AQAVKCNPNGNTLEMRKCASDSYAVADKKLNQVYQQNISKLSGEYKNRLIQAQRAWITFR 92

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            + C F A+ A  GT + ++Y  CL+    ER   L+ Y
Sbjct: 93  DATCNFEAAEALGGTLEPLLYTGCLERVTSERTAYLQRY 131


>gi|77163935|ref|YP_342460.1| hypothetical protein Noc_0404 [Nitrosococcus oceani ATCC 19707]
 gi|254436262|ref|ZP_05049769.1| hypothetical protein NOC27_3325 [Nitrosococcus oceani AFC27]
 gi|76882249|gb|ABA56930.1| hypothetical protein Noc_0404 [Nitrosococcus oceani ATCC 19707]
 gi|207089373|gb|EDZ66645.1| hypothetical protein NOC27_3325 [Nitrosococcus oceani AFC27]
          Length = 205

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 61/113 (53%), Gaps = 5/113 (4%)

Query: 11  IIAIAFQSMALNCNE-----TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +++I+++  A    E      + QA+MN   GN++   + KL+A  +++ E +   +  L
Sbjct: 78  VLSISYEEEAKQVREIEMSTAMTQAEMNIVAGNAYQSAERKLDAILEQIKEFLSPEESAL 137

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +++  AW  Y+ S   F+AS  E G+ Q +IYA+ ++   + R  +LE+ L 
Sbjct: 138 LDEANQAWRTYQKSHADFSASQYEGGSIQPLIYASTMETVTVARIVELEAELK 190


>gi|296283721|ref|ZP_06861719.1| hypothetical protein CbatJ_08869 [Citromicrobium bathyomarinum
           JL354]
          Length = 128

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 51/108 (47%), Gaps = 8/108 (7%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL--------FEKSQMA 72
           ++C+  + Q +MN C G  +     +L A +KK  ++ +   +++           +Q A
Sbjct: 20  VDCDNAMTQMEMNVCAGREYQAADRELNAVWKKASQRAKSVDKDVGDGTQHRELLAAQRA 79

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           W  +R ++C+F A+    G+   +I + CL      R ++L  YL  P
Sbjct: 80  WLTFRDAQCSFEANQYRGGSIMPLIRSTCLTALTEARTKQLREYLEFP 127


>gi|319781594|ref|YP_004141070.1| hypothetical protein Mesci_1866 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167482|gb|ADV11020.1| hypothetical protein Mesci_1866 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 119

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 2/95 (2%)

Query: 38  NSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           + F    + L  T+K++ +++  +   +  F K+Q AW  +R +EC F +SG + G+A  
Sbjct: 24  SDFKRADQALNQTFKQIQKRLTDDSDGKARFVKAQRAWIAFRNAECTFQSSGDDGGSAAP 83

Query: 96  MIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN 130
           M+ A C       R ++L++YL C EGDL CP  +
Sbjct: 84  MVAAACQADLTKARTKQLKAYLNCQEGDLSCPVPS 118


>gi|260459744|ref|ZP_05807998.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034546|gb|EEW35803.1| protein of unknown function DUF1311 [Mesorhizobium opportunistum
           WSM2075]
          Length = 119

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKH--QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
            + F    + L  T+K++ +++      +    K+Q  W  +R +EC F + G + G+A 
Sbjct: 23  ASDFKRADQGLNQTFKQIQKRLADDSGGKARLVKAQRTWIAFRNAECTFQSGGDDGGSAA 82

Query: 95  SMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
            M+ A C      +RN++L++YL C EGDL CP  
Sbjct: 83  PMVAAACQAELTKDRNKQLKAYLNCQEGDLACPVP 117


>gi|330820437|ref|YP_004349299.1| hypothetical protein bgla_2g13410 [Burkholderia gladioli BSR3]
 gi|327372432|gb|AEA63787.1| hypothetical protein bgla_2g13410 [Burkholderia gladioli BSR3]
          Length = 131

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 65/127 (51%), Gaps = 1/127 (0%)

Query: 1   MCRKIIFALTIIAIAFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + +    AL + + +  +    C ++   QA MN C   ++      L +TY+ ++ K+ 
Sbjct: 3   ILKTSACALLLASSSVFAAQPGCMDKATTQAAMNACAAGAYKQSDAALNSTYRALVAKLG 62

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
           +  +   +++Q  W  +R ++CAF ASG + G+A  M+ + CL      +   L+S+L C
Sbjct: 63  EPGKTRLKEAQRRWLAWRDAQCAFEASGVDGGSATPMVTSQCLDQLTQAQTRLLDSHLHC 122

Query: 120 PEGDLLC 126
            EGD+ C
Sbjct: 123 QEGDISC 129


>gi|330961297|gb|EGH61557.1| lipoprotein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 128

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 60/126 (47%), Gaps = 6/126 (4%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
            ++     + +   + A +CN    QA MN+C  N  A +   L   YK  +  ++   +
Sbjct: 6   TLLATFIALGVGCSAQAEDCN--TNQASMNKCAANELATLDADLNKQYKAQMAWLQTPEK 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++++ CL G    R ++L++Y+ C E
Sbjct: 64  KQALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVHSQCLAGQTRVRVKQLKAYVACRE 123

Query: 122 GDLLCP 127
               CP
Sbjct: 124 --EGCP 127


>gi|148653992|ref|YP_001281085.1| hypothetical protein PsycPRwf_2195 [Psychrobacter sp. PRwf-1]
 gi|148573076|gb|ABQ95135.1| protein of unknown function DUF1311 [Psychrobacter sp. PRwf-1]
          Length = 142

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 51/115 (44%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
            ++    + +    +    CN    QA MNQC    +     KL + YK +   +   ++
Sbjct: 21  PLMLVTLLASTHAMASEEYCNGKYDQASMNQCAQADYKDEDAKLNSAYKTLRSLLNTEEK 80

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +  ++ Q+AW  YR   C F     + G+   ++ ++CL+ H   R +++E  + 
Sbjct: 81  DQLKQVQLAWISYRDKVCDFENRNEKGGSIYPLLTSSCLKKHTEVRRKQIEGEIN 135


>gi|291569164|dbj|BAI91436.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 219

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 12/129 (9%)

Query: 1   MCRKIIFALTIIAIAFQ------------SMALNCNETLMQADMNQCTGNSFALVKEKLE 48
           M  KI  A+    +AF             +  + CN     A+M +C  + +     KL 
Sbjct: 1   MLDKIATAIFAAFLAFPGATNSEVAETHVAQGIQCNRNGSMAEMKKCADDDYRAADRKLN 60

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             Y+++  KV+  +R+    +Q AW  +R + C F ++ A  GT + +++ NCL      
Sbjct: 61  EVYQQLTPKVQGEERQRLIAAQRAWIQFRDTNCRFESAEALGGTLEGLLFTNCLTKMTTN 120

Query: 109 RNEKLESYL 117
           R  +L+ Y+
Sbjct: 121 RTAELQGYI 129


>gi|284051526|ref|ZP_06381736.1| hypothetical protein AplaP_08626 [Arthrospira platensis str.
           Paraca]
          Length = 219

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 57/129 (44%), Gaps = 12/129 (9%)

Query: 1   MCRKIIFALTIIAIAFQ------------SMALNCNETLMQADMNQCTGNSFALVKEKLE 48
           M  KI  A+    +AF             +  + CN      +M +C  + +     KL 
Sbjct: 1   MLDKIATAIFAAFLAFPGATNSEVAETHVAQGIQCNRNGSMMEMKKCADDDYRAADRKLN 60

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             Y+++  KV+  +R+    +Q AW  +R + C F ++ A  GT + +++ NCL      
Sbjct: 61  EVYQQLTPKVQGEERQRLIAAQRAWIQFRDTNCRFESAEALGGTLEGLLFTNCLTKMTTN 120

Query: 109 RNEKLESYL 117
           R  +L+ Y+
Sbjct: 121 RTAELQGYI 129


>gi|209527286|ref|ZP_03275796.1| protein of unknown function DUF1311 [Arthrospira maxima CS-328]
 gi|209492274|gb|EDZ92619.1| protein of unknown function DUF1311 [Arthrospira maxima CS-328]
          Length = 219

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 12/129 (9%)

Query: 1   MCRKIIFALTIIAIAFQ------------SMALNCNETLMQADMNQCTGNSFALVKEKLE 48
           M  KI  A+    +AF             +  + CN     A+M +C  + + +   KL 
Sbjct: 1   MLDKIATAIFAAFLAFPGATNSEVAETHVAQGIQCNPKGSMAEMKKCADDDYRVADRKLN 60

Query: 49  ATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
             Y+++  KV+  +R+    +Q AW  +R + C F ++ A  GT + +++ NCL      
Sbjct: 61  EVYQQLTPKVQGEERQRLIAAQRAWIQFRDTNCRFESAEALGGTLEGLLFTNCLTKMTTN 120

Query: 109 RNEKLESYL 117
           R  +L++Y+
Sbjct: 121 RTAELQAYI 129


>gi|227823040|ref|YP_002827012.1| putative urease-associated protein [Sinorhizobium fredii NGR234]
 gi|227342041|gb|ACP26259.1| putative urease-associated protein [Sinorhizobium fredii NGR234]
          Length = 139

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 50/126 (39%), Gaps = 13/126 (10%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +  +   +   Q   ++C +   Q D+N C    +      L  TY K +  + +  +EL
Sbjct: 10  LLLVLATSAFAQEPEVDCQKAETQMDLNICADREYQAADADLNKTYGKAIAAMRETDKEL 69

Query: 66  -------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
                         +K+Q AW  YR  +C  A   A  G+ + M+ + CL     +R  +
Sbjct: 70  GDIDAAYVGAVEALKKAQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRTAE 129

Query: 113 LESYLT 118
           L+  L 
Sbjct: 130 LKELLE 135


>gi|60256941|gb|AAX14947.1| ORF191 [Xanthomonas campestris pv. pelargonii]
          Length = 190

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 57/112 (50%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            A      A Q  A + +E + QADMN+    SF   +E+L A  + + E++   +R+ F
Sbjct: 74  LATAYEEQAVQIYASDQSEHMTQADMNRHAAASFHRAEERLVALVEDLREELSAGRRDAF 133

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           EKS  AW  YR +   F +S    G+ Q +I+A+ L+   I R  +LE  L 
Sbjct: 134 EKSHQAWLQYREASAEFQSSQYHGGSIQPLIHASALESVTISRIVELEPLLR 185


>gi|213967489|ref|ZP_03395637.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
 gi|301386451|ref|ZP_07234869.1| lipoprotein, putative [Pseudomonas syringae pv. tomato Max13]
 gi|213927790|gb|EEB61337.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
          Length = 147

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
            ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   +
Sbjct: 6   TLLAAFIALGIGCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAK 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C +
Sbjct: 64  KQALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACRD 123


>gi|302131207|ref|ZP_07257197.1| lipoprotein, putative [Pseudomonas syringae pv. tomato NCPPB 1108]
          Length = 143

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
            ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   +
Sbjct: 2   TLLAAFIALGIGCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAK 59

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C +
Sbjct: 60  KQALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACRD 119


>gi|150397585|ref|YP_001328052.1| hypothetical protein Smed_2385 [Sinorhizobium medicae WSM419]
 gi|150029100|gb|ABR61217.1| protein of unknown function DUF1311 [Sinorhizobium medicae WSM419]
          Length = 140

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 13/127 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-- 65
             T  A A Q    +C + + Q D+N C      +   +L  TY+  +  ++   +EL  
Sbjct: 13  CCTAFASAQQQPEPDCRKAVTQTDLNICADKDHRMADAELNTTYRLAVAAMQATDKELGE 72

Query: 66  -----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                       +K+Q AW  YR  +C  A   A  G+ + M+ + CL     +R ++L 
Sbjct: 73  IDAAYVGALEALKKAQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRTDELR 132

Query: 115 SYLTCPE 121
             +   E
Sbjct: 133 KIVESAE 139


>gi|60256948|gb|AAX14949.1| ORF191 [Xanthomonas campestris pv. pelargonii]
          Length = 183

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 56/110 (50%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            A      A Q  A + +E + QADMN+    SF   +E+L A  + + E++   +R+ F
Sbjct: 74  LATAYEEQAVQIYASDQSEHMTQADMNRHAAASFHRAEERLVALVEDLREELSAGRRDAF 133

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           EKS  AW  YR +   F +S    G+ Q +I+A+ L+   I R  +LE  
Sbjct: 134 EKSHQAWLQYREASAEFQSSQYHGGSIQPLIHASALESVTISRIVELEPL 183


>gi|28869237|ref|NP_791856.1| lipoprotein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28852478|gb|AAO55551.1| lipoprotein, putative [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 128

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 6/126 (4%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
            ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   +
Sbjct: 6   TLLAAFIALGIGCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAK 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C  
Sbjct: 64  KQALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACR- 122

Query: 122 GDLLCP 127
            D  CP
Sbjct: 123 -DEGCP 127


>gi|330876103|gb|EGH10252.1| lipoprotein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 128

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 60/126 (47%), Gaps = 6/126 (4%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
            ++ A+  + I   + A +C+    QA MN+C  N  A +   L   YK  +  ++   +
Sbjct: 6   TLLAAVIALGIGCSAQAEDCD--ANQASMNKCAANKLAALDADLNKQYKAQMAWLQTPAK 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C  
Sbjct: 64  KQALKDAQQKWIALRDADCLYQAGTPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACR- 122

Query: 122 GDLLCP 127
            D  CP
Sbjct: 123 -DEGCP 127


>gi|330964620|gb|EGH64880.1| lipoprotein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 128

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 59/126 (46%), Gaps = 6/126 (4%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
            ++ A   + I   + A +C+    QA MN+C  N  A +   L   YK  +  ++   +
Sbjct: 6   TLLAAFIALGIGCSAQAEDCD--ANQASMNKCAANKLAALDANLNKQYKAQMAWLQTPAK 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C  
Sbjct: 64  KQALKDAQQKWIALRDADCLYQAGTPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACR- 122

Query: 122 GDLLCP 127
            D  CP
Sbjct: 123 -DEGCP 127


>gi|331016932|gb|EGH96988.1| lipoprotein, putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 124

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 6/126 (4%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
            ++ A   + I   + A NC+    QA MN C  N  A +   L   YK  +  ++   +
Sbjct: 2   TLLAAFIALGIGCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAK 59

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C  
Sbjct: 60  KQALKDAQQKWIALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACR- 118

Query: 122 GDLLCP 127
            D  CP
Sbjct: 119 -DEGCP 123


>gi|330986197|gb|EGH84300.1| putative lipoprotein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 128

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           I+ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++   ++
Sbjct: 7   ILAAFIALGIGCSAQAQDCD--ANQASMNQCAANELSALDADLNKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|291569332|dbj|BAI91604.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 215

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 45/101 (44%), Gaps = 3/101 (2%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C     QAD++ C    +     +L +TY+++   +   +R+   ++Q+AW  +R ++C+
Sbjct: 34  CEGMNTQADLSACAIEKYRNADAQLNSTYQRLTSMISADRRQKLVQAQLAWIQFRDNQCS 93

Query: 83  FAASGA---EEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           F +S       G+   +I  +CL      R      Y+   
Sbjct: 94  FVSSATRGGRGGSMSPVIVYSCLTLLTQNRTNDFNHYIQSQ 134



 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 28/77 (36%), Gaps = 6/77 (7%)

Query: 37  GNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM 96
            N+    +  + + Y  +   +    +    +SQ +W  +R   C F       GT  S 
Sbjct: 141 ANNLGQSERSMNSMYLTIAMNLSGEAQTNLNRSQSSWFNFRNLNCQFE------GTFAST 194

Query: 97  IYANCLQGHAIERNEKL 113
               CL   A ER E L
Sbjct: 195 GQNLCLTRMAQERYESL 211


>gi|71734025|ref|YP_274036.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257484481|ref|ZP_05638522.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|71554578|gb|AAZ33789.1| lipoprotein, putative [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|331013253|gb|EGH93309.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 128

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAQDCD--ANQASMNQCAANELSALDADLNKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|302185085|ref|ZP_07261758.1| hypothetical protein Psyrps6_02039 [Pseudomonas syringae pv.
           syringae 642]
          Length = 128

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNVQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|289679641|ref|ZP_06500531.1| hypothetical protein PsyrpsF_40462 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 128

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 57/125 (45%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  +    ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLRTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|15966225|ref|NP_386578.1| hypothetical protein SMc02046 [Sinorhizobium meliloti 1021]
 gi|307308576|ref|ZP_07588278.1| protein of unknown function DUF1311 [Sinorhizobium meliloti BL225C]
 gi|307317354|ref|ZP_07596794.1| protein of unknown function DUF1311 [Sinorhizobium meliloti AK83]
 gi|1176943|sp|P42879|Y2472_RHIME RecName: Full=Uncharacterized protein R02472
 gi|545800|gb|AAB30137.1| orf5 3' of ureB [Sinorhizobium meliloti]
 gi|15075495|emb|CAC47051.1| Hypothetical protein SMc02046 [Sinorhizobium meliloti 1021]
 gi|306896943|gb|EFN27689.1| protein of unknown function DUF1311 [Sinorhizobium meliloti AK83]
 gi|306900976|gb|EFN31585.1| protein of unknown function DUF1311 [Sinorhizobium meliloti BL225C]
          Length = 139

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 50/126 (39%), Gaps = 13/126 (10%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL--- 65
                   Q    +C + + Q D+N C    +     +L  TY+ V+  ++   +EL   
Sbjct: 13  CCTAPANAQQPEPDCRKAVSQMDLNICADQDYRAADAELNKTYRLVVAAMQATDKELGDI 72

Query: 66  ----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                      +K+Q AW  YR  +C  A   A  G+ + M+ + CL     +R  +L+ 
Sbjct: 73  DAAYAGALEALKKAQRAWIGYRDGQCELAGFEARGGSMEPMLVSGCLAELTRKRTAELKE 132

Query: 116 YLTCPE 121
            +   E
Sbjct: 133 LMESAE 138


>gi|330897677|gb|EGH29096.1| hypothetical protein PSYJA_08965 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 128

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|289626416|ref|ZP_06459370.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649570|ref|ZP_06480913.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298486368|ref|ZP_07004430.1| lipoprotein, putative [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298159096|gb|EFI00155.1| lipoprotein, putative [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|330866340|gb|EGH01049.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 128

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-HQR 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L   YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAQDCD--ANQASMNQCAANELSALDADLNKQYKAQMTWLKTSAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|116253474|ref|YP_769312.1| hypothetical protein RL3733 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258122|emb|CAK09223.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 135

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 10/119 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-- 65
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK    +    ++L  
Sbjct: 11  AMLLTAGAASAQDIDCNNPKTQSDMTGCEAARHETADKALNAQYKKTRAALAAIDKDLDG 70

Query: 66  --------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                     K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+  
Sbjct: 71  DMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELKEL 129


>gi|241205999|ref|YP_002977095.1| hypothetical protein Rleg_3309 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859889|gb|ACS57556.1| protein of unknown function DUF1311 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 135

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 10/119 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-- 65
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK    +    ++L  
Sbjct: 11  AMLLTAGAASAEDVDCNSPKTQSDMTACEAARHEAADKALNAQYKKTRAVLTAIDKDLDG 70

Query: 66  --------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                     K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+  
Sbjct: 71  DRKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELKEL 129


>gi|330955391|gb|EGH55651.1| hypothetical protein PSYCIT7_29416 [Pseudomonas syringae Cit 7]
          Length = 128

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+     A MN+C  N  A +  +L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCDANR--ASMNRCAANQQAALDAELNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|66045087|ref|YP_234928.1| hypothetical protein Psyr_1843 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255794|gb|AAY36890.1| Protein of unknown function DUF1311 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 128

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C +     E+ G+   ++ + CL      R ++L++Y+ C   
Sbjct: 65  QALKDAQRKWIALRDADCLYQTGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRA- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|19070375|gb|AAL83828.1|AF347070_5 urease-associated hypothetical protein [Rhizobium leguminosarum bv.
           viciae]
          Length = 135

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 10/119 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-- 65
           A+ + A A  +  ++CN    Q+DM  C         + L A YKK    +    ++L  
Sbjct: 11  AMLLTAGAASAQDIDCNNPKTQSDMTGCEAARHEAADKVLNAQYKKTRAAMVAIDKDLDG 70

Query: 66  --------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                     K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+  
Sbjct: 71  DMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELKEL 129


>gi|218660911|ref|ZP_03516841.1| probable urease-associated protein [Rhizobium etli IE4771]
          Length = 135

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 50/122 (40%), Gaps = 10/122 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I  A+ + A +  +  ++C     Q+DM  C         + L A YKK    +    ++
Sbjct: 8   IGAAMLLAAGSSFAQDIDCQNPKTQSDMTSCEAARHETADKALNAQYKKTRAALAAIDKD 67

Query: 65  L----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           L            K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+
Sbjct: 68  LDGDMKGAEEALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELK 127

Query: 115 SY 116
             
Sbjct: 128 EL 129


>gi|330973281|gb|EGH73347.1| hypothetical protein PSYAR_22614 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 128

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 57/125 (45%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +  + +Q  W   R ++C + A   E+ G+   ++ + C+      R ++L++Y+ C   
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCMAEQTRVRLKQLQAYVACRA- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|330889878|gb|EGH22539.1| putative lipoprotein [Pseudomonas syringae pv. mori str. 301020]
          Length = 128

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 62/125 (49%), Gaps = 6/125 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    QA MNQC  N  + +   L+  YK  +  ++   ++
Sbjct: 7   LLAAFIALGIGCSAQAQDCD--ANQASMNQCAANELSALDADLKKQYKAQMTWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           + F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E 
Sbjct: 65  QAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE- 123

Query: 123 DLLCP 127
              CP
Sbjct: 124 -EGCP 127


>gi|190893132|ref|YP_001979674.1| urease-associated protein [Rhizobium etli CIAT 652]
 gi|190698411|gb|ACE92496.1| probable urease-associated protein [Rhizobium etli CIAT 652]
          Length = 135

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 49/122 (40%), Gaps = 10/122 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I  A+ + A +  +  ++C     Q+DM  C         + L A YKK    +    ++
Sbjct: 8   IGAAMLLAAGSAFAQDIDCQNPKTQSDMTSCEAARHETADKALNAQYKKTRAALAAIDKD 67

Query: 65  L----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           L            K+Q AW  YR +EC      A  GT + M+ A CL      R ++L+
Sbjct: 68  LDGDMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDRRTKELK 127

Query: 115 SY 116
             
Sbjct: 128 EL 129


>gi|330981962|gb|EGH80065.1| hypothetical protein PSYAP_25959 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 128

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 58/126 (46%), Gaps = 6/126 (4%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQ 62
           ++  A   + I   + A +C+    QA MN+C  N  A +   L   Y   +  ++   +
Sbjct: 6   RLYRAFIALGIGCSAQAEDCD--ANQASMNRCAANEQAALDADLNKQYNAQMAWLKTPAK 63

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           ++  + +Q  W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ C E
Sbjct: 64  KQALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLAEQTRVRLKQLQAYVACRE 123

Query: 122 GDLLCP 127
               CP
Sbjct: 124 --EGCP 127


>gi|209550629|ref|YP_002282546.1| hypothetical protein Rleg2_3053 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536385|gb|ACI56320.1| protein of unknown function DUF1311 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 135

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 49/122 (40%), Gaps = 10/122 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I  A+ + A +  +  ++C     Q+DM  C         + L   YKK    +    ++
Sbjct: 8   IGAAMLLSAGSASAQDVDCQNPKTQSDMTSCEAARHDTADKALNVQYKKTRAALAAVDKD 67

Query: 65  L----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           L            K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+
Sbjct: 68  LDGDMKGAEQALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLANITDKRTKELK 127

Query: 115 SY 116
             
Sbjct: 128 EL 129


>gi|86358906|ref|YP_470798.1| urease-associated protein [Rhizobium etli CFN 42]
 gi|86283008|gb|ABC92071.1| probable urease-associated protein [Rhizobium etli CFN 42]
          Length = 134

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 10/119 (8%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-- 65
           A+  +     +  ++C     Q+DM  C         + L   YKK    +    ++L  
Sbjct: 10  AMLFVVDGASAQDVDCKNPQTQSDMTSCEEARHEAADKALNEQYKKTRAAMAAIDKDLDG 69

Query: 66  --------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                     K+Q AW  YR +EC      A  GT + M+ A CL     +R ++L+  
Sbjct: 70  DMKGAEKALVKAQRAWIDYRDAECDAFGFQARGGTMEPMLVAGCLAEETDKRTKELKEL 128


>gi|302058656|ref|ZP_07250197.1| lipoprotein, putative [Pseudomonas syringae pv. tomato K40]
          Length = 131

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 4/109 (3%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQMAW 73
              + A NC+    QA MN C  N  A +   L   YK  +  ++   +++  + +Q  W
Sbjct: 1   GCSAQAENCD--ANQASMNTCAANKLAALDADLNKQYKAQMAWLQTPAKKQALKDAQQKW 58

Query: 74  EIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
              R ++C + A   E+ G+   ++ + CL      R ++L+SY+ C +
Sbjct: 59  IALRDADCLYQAGKPEDSGSIWPLVQSQCLAEQTSVRLKQLKSYVACRD 107


>gi|118591404|ref|ZP_01548802.1| probable urease-associated protein [Stappia aggregata IAM 12614]
 gi|118436076|gb|EAV42719.1| probable urease-associated protein [Stappia aggregata IAM 12614]
          Length = 140

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 42/120 (35%), Gaps = 10/120 (8%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL- 65
             L +          NC   + Q++M QC    +     +L A Y+  +EK+ +    L 
Sbjct: 15  LGLVLAGPVAAQETPNCENAMTQSEMTQCANLDWLRADAELNAVYRSAMEKMTETDAYLP 74

Query: 66  ---------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                      ++Q AW  YR   C      A  GT + M+   C       R ++L   
Sbjct: 75  EGLKGAVETLREAQRAWIPYRDKACDAYGFLARGGTMEPMLVYGCRADLTRNRIDELRQL 134


>gi|163760965|ref|ZP_02168043.1| hypothetical protein HPDFL43_02979 [Hoeflea phototrophica DFL-43]
 gi|162281746|gb|EDQ32039.1| hypothetical protein HPDFL43_02979 [Hoeflea phototrophica DFL-43]
          Length = 138

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 46/136 (33%), Gaps = 18/136 (13%)

Query: 1   MCRKI---IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R++      L     A     L+C     Q  M  C G  +     +L   + +    
Sbjct: 1   MSRRLALFFLGLLYATPALSEDKLDCANPQDQYSMTYCAGVDYENADAELNRVWPQARAA 60

Query: 58  VEKHQR---------------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL 102
            ++                  E    +Q AW  +R +EC + +     GT Q MI + CL
Sbjct: 61  AKRQDEYIADDARSRGLLTASEALLAAQRAWLKFRDAECEYQSYAFFGGTGQPMIGSLCL 120

Query: 103 QGHAIERNEKLESYLT 118
                ER E+L   L 
Sbjct: 121 AQLTRERTEQLRQGLN 136


>gi|325293753|ref|YP_004279617.1| hypothetical protein AGROH133_08201 [Agrobacterium sp. H13-3]
 gi|325061606|gb|ADY65297.1| hypothetical protein AGROH133_08201 [Agrobacterium sp. H13-3]
          Length = 136

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 55/130 (42%), Gaps = 15/130 (11%)

Query: 2   CRKIIFALTIIAI-----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
            +K  F   ++       AF   A +C     QADM  C G  +    ++L A Y+KV +
Sbjct: 3   LKKFCFGAAVLLSLAASSAFADDAPDCTSPQTQADMTICAGKDYEKADKQLNAAYQKVRK 62

Query: 57  KVEKHQR----------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
           ++ +  +          +    +Q AW  +R + C      A  GT + M+ ++CL   +
Sbjct: 63  QLAERDKTADESGKGAVDALVAAQRAWVAFRDANCDAFGFQARGGTMEPMLVSSCLADMS 122

Query: 107 IERNEKLESY 116
            +R ++L   
Sbjct: 123 NKRADELRQL 132


>gi|159185199|ref|NP_355355.2| hypothetical protein Atu2403 [Agrobacterium tumefaciens str. C58]
 gi|159140464|gb|AAK88140.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 139

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 10/106 (9%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR----------ELFEKSQ 70
            +C     QADM  C G       ++L A Y+K+ +++ +  +          +    +Q
Sbjct: 30  PDCKAPQTQADMTICAGKDHEKADKELNAAYQKLRKQLAERDKTADASGKGANDALVMAQ 89

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            AW  +R + CA A   A  G+ + M+ A+CL   + +R ++L   
Sbjct: 90  RAWVAFRDANCALAGFQARGGSMEPMLIASCLADMSSKRADELRQL 135


>gi|260551396|ref|ZP_05825596.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260405559|gb|EEW99051.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 132

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 53/123 (43%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M    +   TI      +    C+    Q+ +N C+ N      +K+ + Y   ++++  
Sbjct: 5   MRITFLIMSTITCSVTFAGIDKCSNLPNQSALNTCSSNVLNSANQKINSVYANYMKELNP 64

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            ++   +++Q AW  Y+  +C F +S   +G+    ++  CL      R ++L+    C 
Sbjct: 65  TEKLQLKEAQRAWIQYKEKDCQFQSSPVLKGSLYPFVHNACLVEKTENRIKELQDMQECR 124

Query: 121 EGD 123
            G+
Sbjct: 125 SGN 127


>gi|300311203|ref|YP_003775295.1| hypothetical protein Hsero_1878 [Herbaspirillum seropedicae SmR1]
 gi|300073988|gb|ADJ63387.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 132

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 54/110 (49%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            + A +C +   QA+MN C   +       L ATY    +K+++ ++    + Q+AW  Y
Sbjct: 21  AAQAADCTKAATQAEMNACASQTLTQSDADLNATYMAYRDKLDRARQNELREVQLAWLKY 80

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLC 126
           R   C F ++ +  G+  + +   CL     +R ++L++   C EGD+ C
Sbjct: 81  RDLSCRFESAASAGGSVAATVRQTCLAEKTRQRTDELKALAGCQEGDVAC 130


>gi|254501058|ref|ZP_05113209.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222437129|gb|EEE43808.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 137

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 42/117 (35%), Gaps = 10/117 (8%)

Query: 10  TIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL---- 65
             +  A Q+  +NC E   Q DM  C    +     +L A YK  +  +++    L    
Sbjct: 15  AALPPAVQAQDVNCKEPQTQLDMTICAKKDWEAADAELNAAYKTAMAAMKQTDSYLSDDL 74

Query: 66  ------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
                    +Q AW  +R   C      A  G+ + M+   C      +R  +L+  
Sbjct: 75  KGAAETLTTAQRAWIPFRDKACESYGFLARGGSMEPMLVLQCRADLTRQRTSQLKDL 131


>gi|222149549|ref|YP_002550506.1| hypothetical protein Avi_3481 [Agrobacterium vitis S4]
 gi|221736531|gb|ACM37494.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 136

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 52/132 (39%), Gaps = 15/132 (11%)

Query: 1   MCRKIIFALTIIAIAFQ---SMALNCNETLMQADMNQCTGNSFALVKEKLEATYK----- 52
           + R I+ A   +  +     + AL+C +   Q+DM  C    F    + + A +K     
Sbjct: 4   VSRLIMLAGFGVMSSGHGVLAQALDCKDPKTQSDMTACAVQDFDAADKAMNAQWKITRKV 63

Query: 53  ------KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHA 106
                  + + ++  ++ L  K+Q AW  YR  +C         GT + M  A C     
Sbjct: 64  FVEQDATLDDDLKGAEKALL-KAQRAWIDYRDGQCEAQGFYVRGGTMEPMEVAACKAEMT 122

Query: 107 IERNEKLESYLT 118
             R ++L+S   
Sbjct: 123 KTRTKELKSLAE 134


>gi|218508661|ref|ZP_03506539.1| urease-associated protein [Rhizobium etli Brasil 5]
          Length = 118

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 42/108 (38%), Gaps = 10/108 (9%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL----------FEK 68
             ++C     Q+DM  C         + L   YKK    +    ++L            K
Sbjct: 5   QDIDCQNPKTQSDMTSCEVARHETADKALNEQYKKTRAAMVAIDKDLDGDMKGAEKALVK 64

Query: 69  SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           +Q AW  YR ++C      A  GT + M+ A CL     +R ++L+  
Sbjct: 65  AQRAWIDYRDAQCDAFGFQARGGTMEPMLVAGCLAEETDKRTKELKEL 112


>gi|152981983|ref|YP_001355294.1| hypothetical protein mma_3604 [Janthinobacterium sp. Marseille]
 gi|151282060|gb|ABR90470.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 132

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
            Q    +C++   Q  MN C  + +    + L   YKK++ + E   ++    +Q AW  
Sbjct: 24  LQEALKDCDKN--QLTMNMCASHRYTTADKALNQQYKKLMVQQEAVGKQRLRDAQRAWIS 81

Query: 76  YRGSECAFAAS-GAEEGTAQSMIYANCLQGHAIERNEKLE 114
           +R  +C        E G+   +++ +CL+ H ++R E L+
Sbjct: 82  FRDKDCLANTGLREESGSIWPLLHYSCLERHTVQRTEDLK 121


>gi|86135932|ref|ZP_01054511.1| hypothetical protein MED193_17454 [Roseobacter sp. MED193]
 gi|85826806|gb|EAQ47002.1| hypothetical protein MED193_17454 [Roseobacter sp. MED193]
          Length = 133

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 46/123 (37%), Gaps = 11/123 (8%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + +L  + +   ++A +CN      +M  C    +     +L  TY+     +    R+L
Sbjct: 10  LASLGALLLPGPALA-DCNNPQTTREMRHCAALEYERADTELNKTYQAAQRSMRSLDRDL 68

Query: 66  ----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                       ++Q AW  +R S C         GT + ++   C      +R+ +LE 
Sbjct: 69  PNDLKGASASLLRAQRAWIPFRDSACETEGFQFRGGTLEPLMVLTCKTHLTRQRSAQLEE 128

Query: 116 YLT 118
            + 
Sbjct: 129 LIE 131


>gi|304393298|ref|ZP_07375226.1| urease-associated protein [Ahrensia sp. R2A130]
 gi|303294305|gb|EFL88677.1| urease-associated protein [Ahrensia sp. R2A130]
          Length = 141

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 41/117 (35%), Gaps = 11/117 (9%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH--------- 61
           I+     +  ++CN      +M  C           L A +K+ +    +          
Sbjct: 20  ILVGGAHAQDVDCNTAGSTVEMKFCAAKELDRADADLNAAWKQAMAGARRDDADWLPQGL 79

Query: 62  --QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             + +L   +Q  W  YR + C   A+ A  GT Q ++   CL     +R   L  Y
Sbjct: 80  PARADLLRDAQRKWITYRDAACDAQATMAYGGTLQPLLGTLCLTKLTEQRTADLREY 136


>gi|89054239|ref|YP_509690.1| hypothetical protein Jann_1748 [Jannaschia sp. CCS1]
 gi|88863788|gb|ABD54665.1| protein of unknown function DUF1311 [Jannaschia sp. CCS1]
          Length = 119

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 40/96 (41%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+    Q D+++C     A   E L   Y++V++ ++        ++Q AW  YR   C 
Sbjct: 23  CDPNQPQIDLSECHAREAARWDELLNIIYRRVIQTLDADGEVRLREAQRAWITYRDLTCE 82

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                   G+   MI + C+     +R   LE Y+ 
Sbjct: 83  MERMRYAGGSIAPMIQSQCVARLTEQRTRDLELYMR 118


>gi|332290774|ref|YP_004429383.1| hypothetical protein Krodi_0127 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332168860|gb|AEE18115.1| hypothetical protein Krodi_0127 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 370

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 55/121 (45%), Gaps = 8/121 (6%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEK 68
           I+AI   ++  NC     QA+MN+     +    ++L   Y+K+L + +      +  +K
Sbjct: 93  ILAILILTLTFNCFS-QTQAEMNKNANKEYRKADKELNIVYQKILSEYQLDSFFIDRLKK 151

Query: 69  SQMAWEIYRGSECAFA----ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT-CPEGD 123
           +Q  W  YR +E           AE G+   M  +  L+   +ER EKL  +L    EG+
Sbjct: 152 TQRIWNSYRDAELEMKFPADNKQAEYGSVYPMCVSLFLKELTVERTEKLRVWLNGIEEGN 211

Query: 124 L 124
           +
Sbjct: 212 M 212


>gi|239816230|ref|YP_002945140.1| hypothetical protein Vapar_3256 [Variovorax paradoxus S110]
 gi|239802807|gb|ACS19874.1| protein of unknown function DUF1311 [Variovorax paradoxus S110]
          Length = 130

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 36/93 (38%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
           L+C     Q  MN C    F      L   Y +V++ +    R      Q  W   R   
Sbjct: 30  LDCRPDGNQQQMNACAVRDFRAADAALNIRYGEVMKTLSPQMRVALRTEQRTWLKGRDPS 89

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           C  A+   E G+   +++ +CL+    +R  +L
Sbjct: 90  CKRASKANEGGSIWPLVFNSCLEKSTRQRTAEL 122


>gi|213028739|ref|ZP_03343186.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 63

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 32/60 (53%)

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           Q+AW   R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP  
Sbjct: 1   QVAWIALRDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPLP 60


>gi|119486568|ref|ZP_01620618.1| hypothetical protein L8106_12495 [Lyngbya sp. PCC 8106]
 gi|119456185|gb|EAW37317.1| hypothetical protein L8106_12495 [Lyngbya sp. PCC 8106]
          Length = 141

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-R 63
           + F      +   S  + C E     +M +C  + ++ +  +L  TY+ ++ K++ +Q +
Sbjct: 22  LTFNSFAAPVTQISQTIECREDGSMIEMKKCAQDKYSKIDRQLNQTYQTLMAKLDDNQRK 81

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +    +Q +W  +R   C++ AS A  G+ + ++  NCL     +R  +L+ Y++
Sbjct: 82  QRLISAQRSWIQFRDKSCSYEASEALGGSLEGLLLTNCLTRVTDQRTSELKEYVS 136


>gi|328541728|ref|YP_004301837.1| urease-associated protein [polymorphum gilvum SL003B-26A1]
 gi|326411480|gb|ADZ68543.1| Probable urease-associated protein [Polymorphum gilvum SL003B-26A1]
          Length = 139

 Score = 97.3 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 54/134 (40%), Gaps = 15/134 (11%)

Query: 4   KIIFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +++ A+ ++  A  + A    +C   L Q ++  C   ++      L A Y++ + ++ +
Sbjct: 5   RLVLAIALLLPAGAARAQETIDCGYPLSQMELTYCAEKAWEAADADLNAAYREAMARMRE 64

Query: 61  HQREL------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
               L             +++Q AW  YR   CA     A  GT +  +   CL    + 
Sbjct: 65  MDANLADMPDLQGAAEALKEAQRAWIPYRDKACAAYGFLARGGTMEPQLIYGCLATLTVR 124

Query: 109 RNEKLESYLTCPEG 122
           R E+L+      EG
Sbjct: 125 RAEELKDLAAGIEG 138


>gi|330940018|gb|EGH43212.1| hypothetical protein PSYPI_12794 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 104

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 45/100 (45%), Gaps = 4/100 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQR 63
           ++ A   + I   + A +C+    Q  MN+C  N  A +   L   Y   +  ++   ++
Sbjct: 7   LLGAFIALGIGCSAQAEDCD--ANQTSMNRCAANEQAALDADLNKQYNAQMAWLKTPAKK 64

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCL 102
           +  + +Q  W   R ++C + A   E+ G+   ++ + CL
Sbjct: 65  QALKDAQRKWIALRDADCLYQAGKPEDSGSIWPLLQSQCL 104


>gi|293610217|ref|ZP_06692518.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827449|gb|EFF85813.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124395|gb|ADY83918.1| hypothetical protein BDGL_003332 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 124

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 46/121 (38%), Gaps = 9/121 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI FA           A NC+      D   CT   +A     L   Y+ +  K+  
Sbjct: 1   MMKKIFFAFLCSFGVTSVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRVKLNT 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TC 119
            Q+ + +KSQ+AW   R +EC  +   +        +   C      ERN  L+  L  C
Sbjct: 61  AQKNILKKSQLAWIRQRDAECTDSNRNS--------VDVQCRLQTTQERNHWLQERLREC 112

Query: 120 P 120
            
Sbjct: 113 Q 113


>gi|330818529|ref|YP_004362234.1| hypothetical protein bgla_1g36750 [Burkholderia gladioli BSR3]
 gi|327370922|gb|AEA62278.1| hypothetical protein bgla_1g36750 [Burkholderia gladioli BSR3]
          Length = 118

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 6/120 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KII +L ++ I   + A  C       D   CT  + A  K+ L A Y+K+    +  
Sbjct: 1   MKKIICSLLLL-IPLSAFAETCTGNGTVYDDLTCTNRTLAEAKKNLNAIYQKIYASTQ-- 57

Query: 62  QRELFEKSQMAWEIYRGSECA---FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +  FE+SQ AW  YR  +C     AA+   +G   ++I  +CL     +R + L++ L 
Sbjct: 58  YQAEFEQSQKAWLNYRDQQCNGYLAAAASQSQGEGPALIVRDCLAELTRQRVDYLKTLLE 117


>gi|262374117|ref|ZP_06067394.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311128|gb|EEY92215.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 123

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 9/118 (7%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           KII  L +   +  +MA NC++     D   CT   +A     L   Y+++ +K+++ Q+
Sbjct: 3   KIILGLILGVASTFAMANNCDKARNTYDDIYCTNKIYASADADLNKNYQQLRQKLDETQQ 62

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK-LESYLTCP 120
           ++ +KSQ+AW  YR +EC            Q  +   C      ERN   LE    C 
Sbjct: 63  KILKKSQLAWIRYRDAECTDDQ--------QVSVDVQCRLSTTQERNHWLLERLRECQ 112


>gi|94969409|ref|YP_591457.1| hypothetical protein Acid345_2382 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551459|gb|ABF41383.1| protein of unknown function DUF1311 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 140

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 52/133 (39%), Gaps = 20/133 (15%)

Query: 1   MCRKIIFALTIIAIAFQSM-----ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M + ++ A   + +   +         C +   QA++NQCT   F     +L   Y+  L
Sbjct: 1   MKKFLLLATLFLPVLSPAQRAKPDEDPCRKIQSQAELNQCTEKKFRTANSQLLKVYQGYL 60

Query: 56  EKVEKHQREL---------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
           + ++K+                    + +Q+AW  YR + C   A     G+ Q  +Y+ 
Sbjct: 61  QLLQKNLESAQTPAAKAQSTKTLDDLKAAQLAWINYREAHCQAEADLYAGGSIQPSMYSA 120

Query: 101 CLQGHAIERNEKL 113
           C++     R  +L
Sbjct: 121 CMETITRYRITQL 133


>gi|34580972|ref|ZP_00142452.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262357|gb|EAA25861.1| unknown [Rickettsia sibirica 246]
          Length = 108

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 42/105 (40%), Gaps = 31/105 (29%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE--LFEKSQMAWEIYRGSECAFA 84
           ++Q DMN C    +  V  KL   Y+++L+ +   + +  L +KS   W  YR +     
Sbjct: 1   MIQGDMNYCVAAEYKKVDTKLNQIYQEILKHISDKREQVNLLKKSPNLWIKYRDAY---- 56

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
                                     ++ E+ L C EGDL CPFI
Sbjct: 57  -------------------------KKEFEAMLKCEEGDLSCPFI 76


>gi|169797328|ref|YP_001715121.1| hypothetical protein ABAYE3355 [Acinetobacter baumannii AYE]
 gi|184156750|ref|YP_001845089.1| hypothetical protein ACICU_00430 [Acinetobacter baumannii ACICU]
 gi|213155858|ref|YP_002317903.1| hypothetical protein AB57_0499 [Acinetobacter baumannii AB0057]
 gi|215484765|ref|YP_002327000.1| hypothetical protein ABBFA_003114 [Acinetobacter baumannii
           AB307-0294]
 gi|239500848|ref|ZP_04660158.1| hypothetical protein AbauAB_00905 [Acinetobacter baumannii AB900]
 gi|301346431|ref|ZP_07227172.1| hypothetical protein AbauAB0_09302 [Acinetobacter baumannii AB056]
 gi|301511757|ref|ZP_07236994.1| hypothetical protein AbauAB05_09265 [Acinetobacter baumannii AB058]
 gi|301594284|ref|ZP_07239292.1| hypothetical protein AbauAB059_00695 [Acinetobacter baumannii
           AB059]
 gi|332852973|ref|ZP_08434483.1| hypothetical protein HMPREF0021_02065 [Acinetobacter baumannii
           6013150]
 gi|332866407|ref|ZP_08436991.1| hypothetical protein HMPREF0020_00597 [Acinetobacter baumannii
           6013113]
 gi|332873162|ref|ZP_08441119.1| hypothetical protein HMPREF0022_00724 [Acinetobacter baumannii
           6014059]
 gi|169150255|emb|CAM88151.1| conserved hypothetical protein; putative exported protein
           [Acinetobacter baumannii AYE]
 gi|183208344|gb|ACC55742.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
 gi|213055018|gb|ACJ39920.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213988005|gb|ACJ58304.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|322506642|gb|ADX02096.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323516517|gb|ADX90898.1| hypothetical protein ABTW07_0461 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332728909|gb|EGJ60264.1| hypothetical protein HMPREF0021_02065 [Acinetobacter baumannii
           6013150]
 gi|332734633|gb|EGJ65739.1| hypothetical protein HMPREF0020_00597 [Acinetobacter baumannii
           6013113]
 gi|332738674|gb|EGJ69544.1| hypothetical protein HMPREF0022_00724 [Acinetobacter baumannii
           6014059]
          Length = 122

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 46/120 (38%), Gaps = 10/120 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+FA     I     A NC+      D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MKKIVFAFLCFGI-TTVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRAKLNTA 59

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TCP 120
           QR   +KSQ+AW   R +EC  +   +        +   C      ERN  L+  L  C 
Sbjct: 60  QRNTLKKSQLAWIRQRDAECTDSNRNS--------VDVQCRLQTTQERNHWLQERLRECQ 111


>gi|319793061|ref|YP_004154701.1| hypothetical protein Varpa_2388 [Variovorax paradoxus EPS]
 gi|315595524|gb|ADU36590.1| hypothetical protein Varpa_2388 [Variovorax paradoxus EPS]
          Length = 130

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 43/108 (39%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + AL   +    + A +CN    Q  MN C    F     +L   Y  V++ +    R  
Sbjct: 15  VLALLAGSAQAAADADDCNPNGNQQQMNACAARDFRAADAELNIRYGDVMKTLSPQMRVA 74

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               Q AW   R   C  A+   E G+   ++++ CL+    +R  +L
Sbjct: 75  LRNDQRAWLKGRDPACKRASKANEGGSIWPLVFSTCLEKSTRKRTAEL 122


>gi|319957069|ref|YP_004168332.1| hypothetical protein Nitsa_1332 [Nitratifractor salsuginis DSM
           16511]
 gi|319419473|gb|ADV46583.1| hypothetical protein Nitsa_1332 [Nitratifractor salsuginis DSM
           16511]
          Length = 157

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 9/131 (6%)

Query: 3   RKIIFALTIIAIAFQSMALN-CNE-TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +  + A  I+A + Q+     C E    Q  MN+C   S+     +L   YK++    + 
Sbjct: 9   KTALAASLILASSLQASKPKSCMERASTQGAMNRCALESYRKADAELNRVYKRIKALYKD 68

Query: 61  HQ--RELFEKSQMAWEIYRGSE--CAFAASGAEE--GTAQSMIYANCLQGHAIERNEKLE 114
            +   E  +++Q  W   R ++    F   G     G+   M  A   +   +ER   L+
Sbjct: 69  DKLFLEKLKRAQQTWIKLRDADLLLKFPHKGQPGYYGSDFPMCEAMFKRELTLERIRFLK 128

Query: 115 SYL-TCPEGDL 124
            +L    EGDL
Sbjct: 129 QWLWGAEEGDL 139


>gi|260549157|ref|ZP_05823378.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260407885|gb|EEX01357.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 123

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 46/120 (38%), Gaps = 9/120 (7%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+ AL          A NC+ T    D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MKKILLALLCSFGVTAVYADNCDTTRNTYDDIYCTNKIYASADADLNKNYQALRAKLNTA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TCP 120
           QR   +KSQ+AW   R +EC  +   +        +   C      ERN  L+  L  C 
Sbjct: 61  QRNTLKKSQLAWIRQRDAECTDSNRNS--------VDVQCRLQTTQERNHWLQERLRECQ 112


>gi|289810629|ref|ZP_06541258.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
          Length = 57

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 28/53 (52%)

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFI 129
           R ++CA   SG E G+ Q MI + CL     ER   L S L C EGDL CP  
Sbjct: 2   RDADCALIRSGTEGGSVQPMIASQCLTDKTNEREAFLASLLQCEEGDLSCPLP 54


>gi|299771697|ref|YP_003733723.1| hypothetical protein AOLE_17325 [Acinetobacter sp. DR1]
 gi|298701785|gb|ADI92350.1| hypothetical protein AOLE_17325 [Acinetobacter sp. DR1]
          Length = 123

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 45/120 (37%), Gaps = 9/120 (7%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+ A           A NC+      D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MKKIVLAFLCSFGMTAVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRVKLNMA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TCP 120
           Q+ + +KSQ+AW   R ++C  +   +        +   C      ERN  L+  L  C 
Sbjct: 61  QKNILKKSQLAWIRQRDADCTDSNRNS--------VDVQCRLQTTQERNHWLQERLRECQ 112


>gi|285017822|ref|YP_003375533.1| hypothetical protein XALc_1030 [Xanthomonas albilineans GPE PC73]
 gi|283473040|emb|CBA15545.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 135

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 45/120 (37%), Gaps = 12/120 (10%)

Query: 17  QSMALN--CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQRELFEKSQMA 72
            + A N  C+    QA ++ C          +L   Y++++ K+  +    +  + +Q  
Sbjct: 16  PARADNVGCDPAGAQAQIDACAAQDLRKADAELNTVYRQIMAKLVKQPLALDKLKTAQRL 75

Query: 73  WEIYRGSECA-------FAASGAEEGTAQSMIYANCLQGHAIERNEKLES-YLTCPEGDL 124
           W   R ++           ++    G+    +YA+        R   L + +L   EGDL
Sbjct: 76  WVQLRDADLEARYPAGNHRSAQVLYGSMYPTLYASAKAELTAARTAYLRATFLERREGDL 135


>gi|260556216|ref|ZP_05828435.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|260410271|gb|EEX03570.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
          Length = 122

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 46/120 (38%), Gaps = 10/120 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI+FA     I     A NC+      D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MKKIVFAFLCFGI-TAVYADNCDSARNTYDDIYCTNKIYASADADLNKNYQALRAKLNTV 59

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TCP 120
           QR   ++SQ+AW   R +EC  +   +        +   C      ERN  L+  L  C 
Sbjct: 60  QRNTLKRSQLAWIRQRDAECTDSNRNS--------VDVQCRLQTTQERNHWLQERLRECQ 111


>gi|262280845|ref|ZP_06058628.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257745|gb|EEY76480.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 123

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 45/120 (37%), Gaps = 9/120 (7%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            RKI FA           A NC+      D   CT   +A     L   Y+ +  K+   
Sbjct: 1   MRKIAFAFLCSLGMTVVYADNCDSARNTYDDIYCTNKIYASADVDLNKNYQALRVKLNTA 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TCP 120
           Q+ + +KSQ+AW   R +EC  +   +        +   C      ERN  L+  L  C 
Sbjct: 61  QKNILKKSQLAWIRQRDAECTDSNRNS--------VDVQCRLQTTQERNHWLQERLRECQ 112


>gi|300023292|ref|YP_003755903.1| hypothetical protein Hden_1779 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525113|gb|ADJ23582.1| protein of unknown function DUF1311 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 134

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 39/108 (36%), Gaps = 11/108 (10%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ----------RELFE 67
           +  ++C       +MN C    F    + L   Y   +  +++ +           E   
Sbjct: 21  AQKIDCENASSTVEMNFCAEKDFKAADKDLNVAYANAVAFIKERKLDKPYDSASFEEALR 80

Query: 68  KSQMAWEIYRGSEC-AFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
            SQ AW  +R ++C    A     GT  +     C+     ER ++L+
Sbjct: 81  VSQRAWLAFRDADCKDLIAQEWSGGTGTAAASLECMTAKTQERTKELK 128


>gi|126736862|ref|ZP_01752597.1| hypothetical protein RSK20926_10544 [Roseobacter sp. SK209-2-6]
 gi|126721447|gb|EBA18150.1| hypothetical protein RSK20926_10544 [Roseobacter sp. SK209-2-6]
          Length = 99

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 35/97 (36%), Gaps = 10/97 (10%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL----------FEKSQMAWEIYRGSEC 81
           M  C    +     +L A YK+    ++   ++L            ++Q AW  +R   C
Sbjct: 1   MRLCASQDYEAADAELNAVYKEARAVMKALDQDLPENLKGAGEALLQAQRAWIPFRDKAC 60

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                    G+ + +   +C      +R+E+L   L 
Sbjct: 61  ESEGFLFRGGSFEPLTVLHCKTELTRQRSEQLRFLLE 97


>gi|313497188|gb|ADR58554.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 128

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 52/126 (41%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +  +  L +  +   +MA +       C ++      MN C G    +  ++L   YK
Sbjct: 1   MIKHYLAGLALACVLPVAMADDYTAAYGQCMDKASSTVAMNACIGAETQVQDQRLNRVYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K++  Q++     Q  W  YR   C F    A  GT   +   +C+     +R  +
Sbjct: 61  QLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFH-VQASGGTLAQLEGGSCIMDMTRDRAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|50083715|ref|YP_045225.1| hypothetical protein ACIAD0471 [Acinetobacter sp. ADP1]
 gi|49529691|emb|CAG67403.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 125

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           K++ A+  + ++  S A NC++T    D   CT   FA   E L   Y+K+  ++ ++Q+
Sbjct: 7   KLLSAVIFLVVSGTSYADNCDKTRNTYDDIYCTNKIFASADEDLNRNYQKLRTQLNQNQK 66

Query: 64  ELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCP 120
           ++ +KSQ+AW   R  +C        E           C      +RN+ L E    C 
Sbjct: 67  QILKKSQLAWIRERDEQCVEDQKVDVE-----------CRLEKTQQRNQWLVERLRECK 114


>gi|167589256|ref|ZP_02381644.1| hypothetical protein BuboB_28226 [Burkholderia ubonensis Bu]
          Length = 124

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 44/114 (38%), Gaps = 15/114 (13%)

Query: 19  MALNCNET-----LMQADMN-QCTGNSFALVKEKLEATYKKVLEKVEKHQ------RELF 66
            A +CN          A +N QC          KL   YKK+L  ++         R   
Sbjct: 7   FAADCNHPPGDAGYEGAKINYQCAERDRRAADSKLNQAYKKLLGALKDDPDSGLIPRTQI 66

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMI--YANCLQGHAIERNEKLESYLT 118
             +Q  W  +R +EC F  S    G  Q +I  +A CL     +R + LE YL 
Sbjct: 67  VSAQRTWVAFRDAECDFRTS-VSGGAHQWLIVNHAQCLAELTEQRTKVLEDYLK 119


>gi|152992409|ref|YP_001358130.1| hypothetical protein SUN_0815 [Sulfurovum sp. NBC37-1]
 gi|151424270|dbj|BAF71773.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 120

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 36/85 (42%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
           QC  + +    ++L A Y+ V   + K +     K+Q AW  +R  EC F A     G+A
Sbjct: 36  QCAYHEYDYRDKQLNAVYRHVKNHLPKEEIPNLIKAQRAWITFRDRECCFEAYEMRGGSA 95

Query: 94  QSMIYANCLQGHAIERNEKLESYLT 118
           +      C      ER + L + L 
Sbjct: 96  EKQFTIGCKIALTRERVQSLRTLLP 120


>gi|312114324|ref|YP_004011920.1| hypothetical protein Rvan_1569 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219453|gb|ADP70821.1| hypothetical protein Rvan_1569 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 128

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 52/126 (41%), Gaps = 14/126 (11%)

Query: 4   KIIFAL-TIIAIAFQSMALNC--------NETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           +I FA    +A +  + A           ++ +  A    C G  F     +L   YK +
Sbjct: 2   RIFFAFFICMAASSHARAEEVRQPLDACLDKAMSTAATVDCIGRDFERNDAELNRIYKTL 61

Query: 55  LEKVEKHQ-----RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
           LEK          R    +SQ AW  +R + C +  S    GT + +I + C+    I+R
Sbjct: 62  LEKNSSEDDAQEIRGRLIESQRAWLKFRDTNCNWRGSVMLGGTGEKVIVSGCVNQMTIDR 121

Query: 110 NEKLES 115
            ++L++
Sbjct: 122 VKELKA 127


>gi|26987557|ref|NP_742982.1| hypothetical protein PP_0821 [Pseudomonas putida KT2440]
 gi|24982231|gb|AAN66446.1|AE016274_3 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 136

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 52/126 (41%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +  +  L +  +   +MA +       C ++      M+ C G    +  ++L   YK
Sbjct: 9   MIKHYLAGLALACVLPVAMADDYTAAYGQCMDKASSTVAMSACIGAETQVQDQRLNRVYK 68

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K++  Q++     Q  W  YR   C F    A  GT   +   +C+     +R  +
Sbjct: 69  QLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFH-VQASGGTLAQLEGGSCIMDMTRDRAAE 127

Query: 113 LESYLT 118
           LE  L+
Sbjct: 128 LERVLS 133


>gi|152993190|ref|YP_001358911.1| hypothetical protein SUN_1604 [Sulfurovum sp. NBC37-1]
 gi|151425051|dbj|BAF72554.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 152

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 53/127 (41%), Gaps = 17/127 (13%)

Query: 6   IFALTIIAIAFQSMAL-----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            F +  ++    S A      +     +Q+ MN C    +      L  TYK++   ++ 
Sbjct: 21  FFMIVFLSFGVNSYAETHCDMDAANKGIQSAMNICAAEDYHKANRLLNTTYKQL---LDI 77

Query: 61  HQREL-----FEKSQMAWEIYRGSECAFAASGAEE----GTAQSMIYANCLQGHAIERNE 111
           H+++         +Q AW  +R +E     + A++    G+  S++++  +     +R +
Sbjct: 78  HKKDKTFTSNLIVAQKAWIKFRDAEVKMILTYADQPGNYGSMNSLLWSMEMLSLTEQRIK 137

Query: 112 KLESYLT 118
            L+ Y+ 
Sbjct: 138 VLQGYIK 144


>gi|152992335|ref|YP_001358056.1| hypothetical protein SUN_0740 [Sulfurovum sp. NBC37-1]
 gi|151424196|dbj|BAF71699.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 120

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 1/95 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           N       M QC  + +    +KL + Y++V  K+ K +      +Q AW  +R +EC  
Sbjct: 27  NNPATNNWM-QCAYSEYDYWDKKLNSLYRQVKNKLPKEEIHNLVTAQRAWIKFRDTECYL 85

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            A     G+A+  +   C      +R ++L S+L 
Sbjct: 86  EAYEMRGGSAEKQLNIGCKISMTEKRVKELYSFLP 120


>gi|31790362|gb|AAP58619.1| hypothetical protein [uncultured Acidobacteria bacterium]
          Length = 161

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 50/125 (40%), Gaps = 7/125 (5%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE--KVEKHQ 62
           ++F L + +I       +      Q  +N+     +     ++   Y+++++  + +   
Sbjct: 31  VMFVLVVPSIVLP--FSDATTRQTQLQLNEEACAEYKKADAEMNNVYRRIMKDYRNDAPF 88

Query: 63  RELFEKSQMAWEIYRGSECA--FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT-C 119
               +K+Q+AW  YR ++    F       G+   M     L     +R + L+ ++   
Sbjct: 89  IAALKKAQLAWIRYRDADLESIFPGDARSYGSINPMCRCMHLADTTKQRTKVLQQWIDGV 148

Query: 120 PEGDL 124
            EGD+
Sbjct: 149 EEGDV 153


>gi|325271594|ref|ZP_08138101.1| hypothetical protein G1E_02228 [Pseudomonas sp. TJI-51]
 gi|324103274|gb|EGC00614.1| hypothetical protein G1E_02228 [Pseudomonas sp. TJI-51]
          Length = 128

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 55/126 (43%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           MC++ +  L +  +   ++A +       C ++      M++C G    +  ++L   YK
Sbjct: 1   MCKQYLAGLALTCVLPLAVADDYTAAYVQCMDKASSTVAMSECIGAETQVQDQRLNRVYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K++  Q++     Q  W +YR   C F    A  GT   +    C+     +R  +
Sbjct: 61  QLMGKLDAGQQKSLRDVQRKWLVYRDGNCQFH-VQASGGTMAQLEGGTCMMSMTRDRAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|148546092|ref|YP_001266194.1| hypothetical protein Pput_0848 [Pseudomonas putida F1]
 gi|148510150|gb|ABQ77010.1| protein of unknown function DUF1311 [Pseudomonas putida F1]
          Length = 128

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 51/126 (40%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +  +  L +  +   +MA +       C ++      M+ C G    +  ++L   YK
Sbjct: 1   MIKHYLAGLALACVLPVAMADDYTAAYGQCMDKASSTVAMSACIGAETQVQDQRLNRVYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K++  Q++     Q  W  YR   C F    A  GT   +    C+     +R  +
Sbjct: 61  QLMGKLDAGQQKSLRDVQRKWLAYRDGNCQFH-VQASGGTLAQLEGGTCILDMTRDRAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|30250366|ref|NP_842436.1| putative periplasmic protein [Nitrosomonas europaea ATCC 19718]
 gi|30181161|emb|CAD86356.1| putative periplasmic protein [Nitrosomonas europaea ATCC 19718]
          Length = 150

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 10/109 (9%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLE--KVEKHQRELFEKSQMAWEIYRGSEC 81
                QAD+N     ++    +KL A Y+++LE  K + +      K+Q AW  +  +E 
Sbjct: 39  ANAQTQADLNDDACGAYQEADKKLNAIYQQLLEQHKDDANFTTRLRKAQRAWLAFWDAEM 98

Query: 82  AFA----ASGAEEGTAQSMIYANCLQG--HAIERNEKLESYLTCPEGDL 124
                      E G+   M   +CL+       R E+L  +LT  EGD+
Sbjct: 99  EAIYPADNKREEYGSIYPM--CSCLEQAALVNHRIEQLSGWLTAEEGDV 145


>gi|295133448|ref|YP_003584124.1| hypothetical protein ZPR_1593 [Zunongwangia profunda SM-A87]
 gi|294981463|gb|ADF51928.1| conserved hypothetical protein [Zunongwangia profunda SM-A87]
          Length = 129

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR--ELFEKSQMAWEIYRGSECAF 83
              Q ++NQ     FA   ++L   Y+ +L+  +   +     + +Q  W  +R +E   
Sbjct: 17  AQTQTELNQDAYAEFAEADKELNNVYQNILKTYKSDSQFISKLKSTQRIWIEFRNAELEM 76

Query: 84  ---AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT-CPEGDL 124
                  +  G++  M  A  L+    ER +KL+ +L+   EGD+
Sbjct: 77  KFPRKDKSYYGSSYPMCKALYLKELTEERTKKLKVWLSGIQEGDV 121


>gi|254472834|ref|ZP_05086233.1| conserved hypothetical protein, putative [Pseudovibrio sp. JE062]
 gi|211958298|gb|EEA93499.1| conserved hypothetical protein, putative [Pseudovibrio sp. JE062]
          Length = 160

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 43/98 (43%), Gaps = 1/98 (1%)

Query: 21  LNCNETLMQ-ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
             C  T  Q + M  C    +A+  ++L A Y ++++    + +   + +Q  W  +R  
Sbjct: 57  EQCIGTKYQNSHMIYCAVQEYAVWDQRLNAAYYEIMDIASTNVQASLKSAQRNWIKFRDD 116

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            C+  A   E GT   +  + C+      R+ +LE +L
Sbjct: 117 TCSANALIYEGGTHAPLTMSVCMGDQTAVRSLQLEQFL 154


>gi|89070765|ref|ZP_01158023.1| hypothetical protein OG2516_14356 [Oceanicola granulosus HTCC2516]
 gi|89043664|gb|EAR49870.1| hypothetical protein OG2516_14356 [Oceanicola granulosus HTCC2516]
          Length = 119

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 41/100 (41%), Gaps = 2/100 (2%)

Query: 20  ALNCNET-LMQADMNQCTGNSFALVKEKLEATY-KKVLEKVEKHQRELFEKSQMAWEIYR 77
           A NC+     Q +MN C    +A     L A + + +         +    +Q AW  +R
Sbjct: 18  AQNCDSAEQTQLEMNNCAAAFYADADADLNAVWPEAMAAARAAGAGDELLAAQRAWLAFR 77

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            + C   A+    G+   M++A+CL      R + L + L
Sbjct: 78  DAACTAEAAIFAGGSIAPMVHADCLTRLTQTRRDDLYAML 117


>gi|288947728|ref|YP_003445111.1| protein of unknown function DUF1311 [Allochromatium vinosum DSM
           180]
 gi|288898244|gb|ADC64079.1| protein of unknown function DUF1311 [Allochromatium vinosum DSM
           180]
          Length = 131

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 53/128 (41%), Gaps = 12/128 (9%)

Query: 2   CRKIIFALTIIAIAFQSMALN------CNETLMQA-----DMNQCTGNSFALVKEKLEAT 50
            R++  +  +++    S A N       +  + QA     +M  C G        +L   
Sbjct: 1   MRRLALSAVLLSTCMISHANNELYTTRYSSCMDQAGGVTVEMLDCIGEELNTQDARLNGA 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           Y+K+  ++   +R+  + +Q  W  YR + C F     E GT   ++ A+C+     ER 
Sbjct: 61  YQKLRAQLSAERRKALQSAQRLWIQYRDANCDFY-LDPEGGTLHRVMAADCVLRETAERA 119

Query: 111 EKLESYLT 118
           ++LE    
Sbjct: 120 KELEGLAE 127


>gi|300698080|ref|YP_003748741.1| hypothetical protein RCFBP_mp30284 [Ralstonia solanacearum
           CFBP2957]
 gi|299074804|emb|CBJ54369.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
          Length = 239

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 44/106 (41%), Gaps = 5/106 (4%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-ELFEKSQMAWEIYRGSEC 81
           C+    +A +N C+        + L A Y  +L K+          K+QMAW  +R  +C
Sbjct: 136 CD--RDEATINVCSEYHLVEADQLLNAAYTNLLTKMRGTTSYTPLVKAQMAWTRFRDLDC 193

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
            + AS    G        NC +   + R  ++ESYL C      CP
Sbjct: 194 EYYASSLVGGAMHGQWVMNCQRERTVARTRQIESYLRCEAN--GCP 237


>gi|237755348|ref|ZP_04583977.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692479|gb|EEP61458.1| putative conserved hypothetical protein [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 160

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 3/95 (3%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
            E    A M  C+  +     ++L   YK++++K+   +REL ++SQ+ W  +R +E  F
Sbjct: 43  RENYTTAGMLSCSSQALDKWDKELNRIYKELIKKLSPEERELLKQSQLQWVKFRDAEFKF 102

Query: 84  AASGAEE-GTAQS-MIYANCLQGHAIERNEKLESY 116
             +     GT    MI    L   +  R + LE+Y
Sbjct: 103 LDNLYLGIGTMIPVMIMGEKLDIVSR-RVKMLEAY 136


>gi|170078285|ref|YP_001734923.1| hypothetical protein SYNPCC7002_A1678 [Synechococcus sp. PCC 7002]
 gi|169885954|gb|ACA99667.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 319

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 47/98 (47%), Gaps = 2/98 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR--ELFEKSQMAWEIYRGSECAFA 84
             Q +MN+    SF    + +      +L + E+++   EL ++SQ AW IYR  +    
Sbjct: 220 NTQFEMNKFAEKSFREKDKIMNDIIDNLLSEFEENKDLIELIKESQNAWLIYREKQARIW 279

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
           +   + G+  +MIY N +     +R +++ + +   EG
Sbjct: 280 SEIVKGGSMYAMIYCNHMARLTDQRIDEMNNLIDREEG 317


>gi|194290115|ref|YP_002006022.1| hypothetical protein RALTA_A2018 [Cupriavidus taiwanensis LMG
           19424]
 gi|193223950|emb|CAQ69959.1| conserved hypothetical protein, DUF1311 [Cupriavidus taiwanensis
           LMG 19424]
          Length = 134

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 40/103 (38%), Gaps = 2/103 (1%)

Query: 15  AFQSMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
              +    C  + +  ADM  C      +    L   Y+ +L ++E  +      +Q  W
Sbjct: 26  GLSADYERCTGKAVSTADMLGCAAQEMRVQDAALNGAYQSLLRRLEAPRTGQLRVAQRVW 85

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             YR + CAF  S    G+A  +  A+C+      R  +L  +
Sbjct: 86  LEYRQANCAFV-SNPGGGSAARLAGASCMLEMTAARVRELRGF 127


>gi|114570288|ref|YP_756968.1| hypothetical protein Mmar10_1738 [Maricaulis maris MCS10]
 gi|114340750|gb|ABI66030.1| protein of unknown function DUF1311 [Maricaulis maris MCS10]
          Length = 170

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 40/100 (40%), Gaps = 4/100 (4%)

Query: 18  SMALNC----NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
             A  C     E    A M  C G+ +      L  +Y+ + E +         ++Q +W
Sbjct: 61  EYAQACEQLAAEGETTAGMLACRGDEYEAWDRWLNESYRDLRESLSDESVVALREAQRSW 120

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +R  +C F AS    GT + +  A+CL     ER  +L
Sbjct: 121 IAHRDQDCLFLASLYAGGTLERVEQASCLTRKTAERAIEL 160


>gi|312963008|ref|ZP_07777494.1| hypothetical protein PFWH6_4931 [Pseudomonas fluorescens WH6]
 gi|311282777|gb|EFQ61372.1| hypothetical protein PFWH6_4931 [Pseudomonas fluorescens WH6]
          Length = 126

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 47/115 (40%), Gaps = 3/115 (2%)

Query: 5   IIFALTIIAIAFQSMALN-C-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ AL   A A ++ AL  C +     ADM  C      +   +L   Y+  L   E ++
Sbjct: 11  LLLALCGTAAAAENPALKKCMDGADTTADMVTCNIKETKVQDTRLNKAYQTALAAQEGNR 70

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           ++  +  Q  W  YR + C F  S    GT   +    C+      R ++LE  +
Sbjct: 71  KQQLQDVQRLWIKYRDANCQFIGSAT-GGTIDQVNGTGCVLDMTQARAQELEDLV 124


>gi|213027655|ref|ZP_03342102.1| putative secreted protein [Salmonella enterica subsp. enterica
          serovar Typhi str. 404ty]
          Length = 75

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 37/71 (52%)

Query: 2  CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           ++I      +  + Q++A  C     Q +MN+C    +    +KL  TY+  +++ +  
Sbjct: 1  MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNETYQSAIKRAQPP 60

Query: 62 QRELFEKSQMA 72
          QREL +K+Q+A
Sbjct: 61 QRELLQKAQVA 71


>gi|170723526|ref|YP_001751214.1| hypothetical protein PputW619_4365 [Pseudomonas putida W619]
 gi|169761529|gb|ACA74845.1| protein of unknown function DUF1311 [Pseudomonas putida W619]
          Length = 128

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 48/126 (38%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M ++ +  L +      +MA +       C ++      M+ C      L   +L   YK
Sbjct: 1   MNKQYLMGLALACCIPVAMAEDNSPSYTQCMDKASSTVAMSSCIQAETQLQDARLNRAYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K+E   ++     Q  W  YR   C F    A  GT   +    C+     ER  +
Sbjct: 61  QLMGKLEAEPKKSLRDVQRQWIAYRDGNCKFH-VQASGGTMAQLEGGMCVLDMTRERAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|167031877|ref|YP_001667108.1| hypothetical protein PputGB1_0862 [Pseudomonas putida GB-1]
 gi|166858365|gb|ABY96772.1| protein of unknown function DUF1311 [Pseudomonas putida GB-1]
          Length = 128

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 51/126 (40%), Gaps = 9/126 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-------C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M +  +  L +  +   ++A +       C ++      M+ C      +  ++L   YK
Sbjct: 1   MIKHYLAGLALACVLPLAVAEDYTAAYGQCMDKASSTVAMSACINAETQVQDQRLNRVYK 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           +++ K+E  Q++   + Q  W  YR   C F    A  GT   +    C+     +R  +
Sbjct: 61  QLMGKLEAGQQKNLREVQRKWMAYRDGNCQFH-VQASGGTLAQLEGGTCVMSMTRDRAAE 119

Query: 113 LESYLT 118
           LE  L+
Sbjct: 120 LERVLS 125


>gi|221214400|ref|ZP_03587371.1| EF hand domain protein [Burkholderia multivorans CGD1]
 gi|221165657|gb|EED98132.1| EF hand domain protein [Burkholderia multivorans CGD1]
          Length = 238

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 7/116 (6%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           I  LT +     S A  C+          C   +    K+ L   YKK+    +   +  
Sbjct: 124 IVLLTFLLFPLASFAEACDNGGNAYSDLSCVDRALDEAKKDLNEIYKKIYSSTQ--YKSE 181

Query: 66  FEKSQMAWEIYRGSEC----AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           FE+SQ AW  YR  +C    A  AS ++ G   ++I  +CL     +R + L + L
Sbjct: 182 FEQSQKAWLNYREKQCRGYVAAEASQSQ-GVGPALITKDCLYAITKQRVDYLRTLL 236


>gi|320353026|ref|YP_004194365.1| hypothetical protein Despr_0900 [Desulfobulbus propionicus DSM
           2032]
 gi|320121528|gb|ADW17074.1| hypothetical protein Despr_0900 [Desulfobulbus propionicus DSM
           2032]
          Length = 130

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           +M +C G       E+L   YK+V+ ++ + +++  + +Q AW  +R + C F A   + 
Sbjct: 44  EMIECIGAETKRQDERLNKAYKEVMAQLSETRQKQLQDAQRAWIKFRDAHCHFHAD-PDG 102

Query: 91  GTAQSMIYANCLQGHAIERNEKLESY 116
           GT  ++   +C       R ++LE +
Sbjct: 103 GTMATVRTNDCFLSATASRAQELEGF 128


>gi|207738961|ref|YP_002257354.1| hypothetical protyein transmembrane protein [Ralstonia solanacearum
           IPO1609]
 gi|206592332|emb|CAQ59238.1| hypothetical protyein transmembrane protein [Ralstonia solanacearum
           IPO1609]
          Length = 155

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 43/101 (42%), Gaps = 3/101 (2%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-ELFEKSQMAWEIYRGSECAFAAS 86
            ++ +N C+        + L A Y  +L K+          K+QMAW  +R  +C + AS
Sbjct: 55  DESTINVCSEYHLVEADQLLNAAYANLLTKMRGTTSYAPLVKAQMAWTRFRDLDCEYYAS 114

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
               GT       NC +   + R  ++ESYL C      CP
Sbjct: 115 SLVGGTMHGQWVMNCQRERTVARTRQIESYLRCEA--SGCP 153


>gi|284035669|ref|YP_003385599.1| hypothetical protein Slin_0737 [Spirosoma linguale DSM 74]
 gi|283814962|gb|ADB36800.1| protein of unknown function DUF1311 [Spirosoma linguale DSM 74]
          Length = 136

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 53/128 (41%), Gaps = 12/128 (9%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
            K++ A  ++ +A  S          Q+ +N     +F    + L + Y+K+L++    +
Sbjct: 6   PKLLIAGFLLIVATASFG------QTQSSLNNEQLQTFQQADKALNSVYQKILKQYSADK 59

Query: 63  R--ELFEKSQMAWEIYRGSECAF---AASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
              +  + +Q  W  +R +E +    A      G+AQ M  A        +R   L  +L
Sbjct: 60  EFIKNLKIAQRIWVQFRDAEVSMKYPARPAGYYGSAQPMCEAAYRTELTQQRTRTLTVWL 119

Query: 118 T-CPEGDL 124
           T   EGD+
Sbjct: 120 TGIEEGDV 127


>gi|104780210|ref|YP_606708.1| hypothetical protein PSEEN0989 [Pseudomonas entomophila L48]
 gi|95109197|emb|CAK13894.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 128

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++      M  C      L  ++L   YK+++ K+E  Q++   + Q +W  YR   CAF
Sbjct: 32  DKASSTLAMGACIQAETKLQDDRLNRVYKQLMSKLEPQQQKDLREVQRSWVKYRDGNCAF 91

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             + +  G+   +  A CL   + +R  +LE  L+
Sbjct: 92  HGTLSN-GSLYRIEGAMCLMDMSKDRAAELERVLS 125


>gi|295690840|ref|YP_003594533.1| hypothetical protein Cseg_3485 [Caulobacter segnis ATCC 21756]
 gi|295432743|gb|ADG11915.1| protein of unknown function DUF1311 [Caulobacter segnis ATCC 21756]
          Length = 133

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 51/126 (40%), Gaps = 14/126 (11%)

Query: 4   KIIFALTIIAIAFQSMALN---------C-NETLMQAD--MNQCTGNSFALVKEKLEATY 51
            I+  L+I+A      A           C      Q+   M QC      +   +L   Y
Sbjct: 5   PILLCLSILAAPVVGQAAEPKYSPAYDRCLASPEGQSTIGMIQCAAAELKVQDARLNRAY 64

Query: 52  KKVLEKVE-KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           +  +++++   QR   +K+Q AW  YR ++CA +    + GT   +    CL  H   R 
Sbjct: 65  QDAMKRLDQPRQRAALKKAQRAWIAYRDADCA-SVYDPDWGTLARIEANACLLDHTARRA 123

Query: 111 EKLESY 116
           + LE Y
Sbjct: 124 DALEMY 129


>gi|254464354|ref|ZP_05077765.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685262|gb|EDZ45744.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 134

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 44/125 (35%), Gaps = 9/125 (7%)

Query: 1   MCRKIIFALTIIAIAFQS-MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M R++I  L ++A    +  AL C     Q ++ +C       V+  L       L   E
Sbjct: 8   MLRRVIGVLIVLAQPVSADPALECGNAGSQVEIGECVAKDEERVEAALATALSFALTAAE 67

Query: 60  K--------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
                          E  Q AWE YR   CAF  +    G+   +   +C       R +
Sbjct: 68  DLDEATGRSDAVPALEAGQKAWEAYREEHCAFVGATYGGGSGTGIAIRSCRTQLGRARID 127

Query: 112 KLESY 116
           +L  Y
Sbjct: 128 ELMRY 132


>gi|325520864|gb|EGC99854.1| hypothetical protein B1M_34534 [Burkholderia sp. TJI49]
          Length = 147

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI F L  + +   S A  C +T    D   C        K+ L + Y+K+    +  
Sbjct: 29  MKKIAF-LVFLMLPATSFAGTCADTANGHDDFSCVSRELENSKKDLNSIYQKIYSSTQ-- 85

Query: 62  QRELFEKSQMAWEIYRGSECA---FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +  FE+SQ AW  YR  +C     A +   +GT   +I  +CL     +R + L++ L 
Sbjct: 86  YKREFEQSQKAWLSYREKQCNGYIAAEASQSQGTGPGLITKDCLLTITRQRADYLKTLLE 145


>gi|215481976|ref|YP_002324158.1| hypothetical protein ABBFA_000217 [Acinetobacter baumannii
           AB307-0294]
 gi|213987122|gb|ACJ57421.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
          Length = 132

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 45/118 (38%), Gaps = 4/118 (3%)

Query: 4   KIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           KI+ AL +  I F + A   N         +N+C         +K+   Y      +   
Sbjct: 2   KILIALILTTIPFATYAMCENERSNGTTISINECYKKEAQKSDKKIMQVYTNYKNTLNTT 61

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
           +++   + Q +W  Y+  +C F  +    GT    ++A C+      R  +L+    C
Sbjct: 62  EQKNLLEVQRSWISYKMKQCNFEVASY--GTIAGQLHAQCMINMNNRRINELKYMQDC 117


>gi|156974420|ref|YP_001445327.1| hypothetical protein VIBHAR_02135 [Vibrio harveyi ATCC BAA-1116]
 gi|156526014|gb|ABU71100.1| hypothetical protein VIBHAR_02135 [Vibrio harveyi ATCC BAA-1116]
          Length = 138

 Score = 78.0 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 50/117 (42%), Gaps = 4/117 (3%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + +I AL  ++    +   A++CN  +   ++NQC        +++L    +  LE  
Sbjct: 1   MKKYVIVALASLSSMAFAQEEAIDCNNAVSTLEINQCAAIELEAAQKQLNKYLETSLEHT 60

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +    +  + +Q  W+ Y  S C    +   EGT + ++  +C      +R  ++
Sbjct: 61  SYDPELIKAIQVAQKDWQAYMTSHCDSVYTKWREGTIRGVMAISCKTQLTQQRTHEI 117


>gi|70732538|ref|YP_262301.1| hypothetical protein PFL_5224 [Pseudomonas fluorescens Pf-5]
 gi|68346837|gb|AAY94443.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 163

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 40/109 (36%), Gaps = 11/109 (10%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV----------EKHQRELFEKSQ 70
           L+C    +   +++C           L  +Y+ +L +V          E+      + +Q
Sbjct: 54  LDCEHISVSEQVDRCAQQDKERADAALNQSYQALLVRVHNLYPSSLLQEQEYLGKLKNAQ 113

Query: 71  MAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESYLT 118
            AW  YR S C   A   E G  A   +   C+   + ER   LE  L 
Sbjct: 114 RAWIKYRDSTCVLEAFEVEPGKPAHVTLINLCVTRLSTERTRYLEQLLP 162


>gi|116625077|ref|YP_827233.1| hypothetical protein Acid_6008 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228239|gb|ABJ86948.1| protein of unknown function DUF1311 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 81

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 29/71 (40%)

Query: 43  VKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL 102
               L+A YK++  +++         +Q  W  YR + C         GTA  ++Y  CL
Sbjct: 2   ADSGLDAAYKEIRTRLDGEDATRLNLAQRLWIQYRDANCTAERELYAGGTAAPVVYLACL 61

Query: 103 QGHAIERNEKL 113
           +     R  +L
Sbjct: 62  EVMTRARTREL 72


>gi|307824477|ref|ZP_07654702.1| protein of unknown function DUF1311 [Methylobacter tundripaludum
           SV96]
 gi|307734461|gb|EFO05313.1| protein of unknown function DUF1311 [Methylobacter tundripaludum
           SV96]
          Length = 132

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 50/125 (40%), Gaps = 12/125 (9%)

Query: 3   RKIIFALTIIAIAFQSMALN------CNETLMQA-----DMNQCTGNSFALVKEKLEATY 51
           R ++ A  + AI    +A +          + QA      M +C          +L  TY
Sbjct: 5   RHVVIAGLMAAIVQPVLAADEGLSQTFATCMDQAGGVTPSMVECMNAETERQDVRLNKTY 64

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           K ++  +   +++  +++Q  W  YR + C F     + GT   +   +C       R +
Sbjct: 65  KDIMAGLSPERKKQLQEAQRLWLKYRKANCDFY-YDPDGGTIARVSANDCFMSATAARAK 123

Query: 112 KLESY 116
           +LE++
Sbjct: 124 ELEAF 128


>gi|229592565|ref|YP_002874684.1| hypothetical protein PFLU5181 [Pseudomonas fluorescens SBW25]
 gi|229364431|emb|CAY52239.1| putative putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 126

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 41/106 (38%), Gaps = 2/106 (1%)

Query: 13  AIAFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71
           + A  +    C +     ADM  C      +   +L   YK  L   E  +++  +  Q 
Sbjct: 20  SAADNAALKKCMDSANTTADMVSCNAKETKVQDARLNRAYKTALAAQEGARKQQLQDVQR 79

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            W  YR + C FA S    GT   +  + C+      R ++LE  +
Sbjct: 80  LWIKYRDANCGFAGSAT-GGTLDQVNGSGCVLDMTQTRAQELEDLV 124


>gi|83748393|ref|ZP_00945416.1| Hypothetical Protein RRSL_01788 [Ralstonia solanacearum UW551]
 gi|83724909|gb|EAP72064.1| Hypothetical Protein RRSL_01788 [Ralstonia solanacearum UW551]
          Length = 120

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 41/99 (41%), Gaps = 3/99 (3%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQMAWEIYRGSE 80
           +C+  +    M  C    +     +L   Y + +EK ++     L  ++Q AW  YR + 
Sbjct: 22  DCDSGVT-PSMKICASYHWEKEDIRLNRLYARSMEKAKEMGFETLLVQAQRAWLTYRDAV 80

Query: 81  CAFAA-SGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           C +    G   G  + +   +C++    ER + L + L 
Sbjct: 81  CLYEGQIGTGGGAYEGLYMLSCMETLTKERADHLAADLR 119


>gi|213967704|ref|ZP_03395851.1| hypothetical protein PSPTOT1_1621 [Pseudomonas syringae pv. tomato
           T1]
 gi|301382341|ref|ZP_07230759.1| hypothetical protein PsyrptM_06897 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062950|ref|ZP_07254491.1| hypothetical protein PsyrptK_23429 [Pseudomonas syringae pv. tomato
           K40]
 gi|302130706|ref|ZP_07256696.1| hypothetical protein PsyrptN_04882 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213927480|gb|EEB61028.1| hypothetical protein PSPTOT1_1621 [Pseudomonas syringae pv. tomato
           T1]
          Length = 125

 Score = 77.2 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 41/114 (35%), Gaps = 6/114 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI   L  +     + A  C +     D   C GN F+     L   Y  + + +   
Sbjct: 1   MKKIAIVLMAVVFPLGAHAAGCAKPRNAFDQVYCAGNLFSQSDRDLNQEYTALRKHLNPT 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           Q+   +  Q+AW   R ++C+      E+ +    +  +C       R   L+ 
Sbjct: 61  QQSSLKSGQLAWIKQRDAQCS-----EEKPSGY-FVNLDCAVDMTQSRLAFLKE 108


>gi|153833727|ref|ZP_01986394.1| putative conserved hypothetical protein [Vibrio harveyi HY01]
 gi|148870006|gb|EDL68966.1| putative conserved hypothetical protein [Vibrio harveyi HY01]
          Length = 138

 Score = 76.5 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 50/117 (42%), Gaps = 4/117 (3%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK- 57
           M + +I AL  ++    +   A++CN  +   ++NQC      + +++L       LE  
Sbjct: 1   MKKYVIVALASLSSMAFAQEEAIDCNNAVSTLEINQCAAIELKVAQKQLNKYLDTSLEHN 60

Query: 58  -VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +    +  + +Q  W+ Y  S C    +   EGT + ++  +C      +R  ++
Sbjct: 61  SYDPELIKAIQVAQKDWQAYVTSHCDSVYTQWREGTIRGVMAISCETQLTQQRTHEI 117


>gi|157411385|gb|ABV54344.1| hypothetical protein [Pseudomonas stutzeri]
          Length = 132

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 54/127 (42%), Gaps = 12/127 (9%)

Query: 2   CRKIIFALTIIAIAFQS---MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
            R ++  +   +I+  +     + C +     D+ QC       V+  L   Y+++L+++
Sbjct: 3   LRALLLLIVFFSISANAGEVSEIECEKVFSTLDVEQCIAVELDKVEASLNEAYQRLLKQL 62

Query: 59  EKHQ---------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
            +           R+    +Q AW  +R ++C         G+ ++ IY +C +  A +R
Sbjct: 63  TQADTPQDNYTEYRKKLLIAQRAWIKFREADCDTQYEMHRSGSIRNSIYLSCKKQRAEQR 122

Query: 110 NEKLESY 116
             +L SY
Sbjct: 123 INELNSY 129


>gi|121583505|ref|YP_973931.1| hypothetical protein Pnap_4780 [Polaromonas naphthalenivorans CJ2]
 gi|120596755|gb|ABM40189.1| protein of unknown function DUF1311 [Polaromonas naphthalenivorans
           CJ2]
          Length = 133

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M +C           L   YK ++ ++   ++   +++Q AW  YR + CAF     + G
Sbjct: 48  MIECITAENHRQDALLNKAYKALMAELPPPRKTQLQEAQRAWIKYRDANCAFY-DDPDGG 106

Query: 92  TAQSMIYANCLQGHAIERNEKLESY 116
           T   +   +C+     +R  +LES+
Sbjct: 107 TLARVNANSCMMAATADRARELESF 131


>gi|254497142|ref|ZP_05109959.1| hypothetical protein LDG_1556 [Legionella drancourtii LLAP12]
 gi|254353637|gb|EET12355.1| hypothetical protein LDG_1556 [Legionella drancourtii LLAP12]
          Length = 132

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 39/118 (33%), Gaps = 9/118 (7%)

Query: 4   KIIFALTIIAIAFQSMAL------NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           K  F +   +IA    A       NC       +   C      L   +L   YK     
Sbjct: 5   KTYFLVVFFSIATSLHAEKYQYNGNCKFIGNVENFKHCLDEELVLYDRELNDLYKSYF-- 62

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                 +   K++ +W  ++  +C + A+    G+   +IY  CL      R   L+ 
Sbjct: 63  -NNKPSKYLRKAETSWIKFKEDDCDYIAAEVNGGSYYDVIYKACLINKTKVRINDLKR 119


>gi|320323467|gb|EFW79552.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329490|gb|EFW85482.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 74

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLT 118
             +++ F+ +Q+ W   R ++C + A   E+ G+   ++ + CL      R ++L++Y+ 
Sbjct: 7   PAKKQAFKDAQLKWIALRDADCLYQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVA 66

Query: 119 CPEGDLLCP 127
           C E    CP
Sbjct: 67  CRE--EGCP 73


>gi|34497504|ref|NP_901719.1| hypothetical protein CV_2049 [Chromobacterium violaceum ATCC 12472]
 gi|34103359|gb|AAQ59721.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 128

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 43/106 (40%), Gaps = 9/106 (8%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE---------LFEKSQM 71
             C       ++N C    F    + L   Y+ +L+K+   + +         L  ++Q 
Sbjct: 22  DPCQNANNTLEINDCKQKQFDGRDKLLNERYRALLQKLRADEAQGGAKDKPSALLIQAQR 81

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            W  +R ++C        +G+ ++ ++ +C      +R ++L+  L
Sbjct: 82  KWIAFRDADCNTKYQIYIDGSIRNAVFLDCKIERTEQRIKELDPKL 127


>gi|83945480|ref|ZP_00957827.1| hypothetical protein OA2633_01159 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851056|gb|EAP88914.1| hypothetical protein OA2633_01159 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 160

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEK----HQRELFEKSQMAWEIYRGSECAF 83
               M +C   +  L  ++L A Y  + ++++      +RE    +Q AW  +R +EC+ 
Sbjct: 62  TTYGMMECAHRATELWDQRLNAAYFALRDRLQAREQLQRRERLLDAQRAWLAFREAECSQ 121

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            +   E GT   +I  +C       R   LE+ L
Sbjct: 122 QSLAYEGGTLMGVIANSCFNDFTARRALDLEAQL 155


>gi|262393949|ref|YP_003285803.1| hypothetical protein VEA_003178 [Vibrio sp. Ex25]
 gi|262337543|gb|ACY51338.1| hypothetical protein VEA_003178 [Vibrio sp. Ex25]
          Length = 138

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 43/114 (37%), Gaps = 2/114 (1%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           C  II A        +  +++CN  +   ++NQC        + KL+      +E     
Sbjct: 4   CLIIILASLSFGALAEEESIDCNNAMTTIEINQCAAIELESAQVKLDKYLNTSVEHNSHD 63

Query: 62  QR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L
Sbjct: 64  PELIAAIKLAQQDWQAYVSSHCDSVYTQWRDGTIRGIMAISCKTKLTKQRTHEL 117


>gi|261252704|ref|ZP_05945277.1| hypothetical protein VIA_002728 [Vibrio orientalis CIP 102891]
 gi|260936095|gb|EEX92084.1| hypothetical protein VIA_002728 [Vibrio orientalis CIP 102891]
          Length = 211

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 46/117 (39%), Gaps = 4/117 (3%)

Query: 1   MCRKIIFALTIIAIAFQS--MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK- 57
           M + +I AL  ++    +    ++C+       +NQC        K +LE   K   E  
Sbjct: 75  MKKSLIIALASLSFGAVADEETIDCDAAFTTIQINQCAAIELDAAKTELEKYLKASFEHN 134

Query: 58  -VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +    E  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L
Sbjct: 135 SFDSELVEAMKLAQTDWQTYMSSHCDSVYTQWRDGTIRGVMAISCKTKLTKQRTHEL 191


>gi|307730265|ref|YP_003907489.1| hypothetical protein BC1003_2245 [Burkholderia sp. CCGE1003]
 gi|307584800|gb|ADN58198.1| hypothetical protein BC1003_2245 [Burkholderia sp. CCGE1003]
          Length = 118

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 5/105 (4%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            S A  C+++        C   +    K +L A Y+K+    +   +  FE+SQ AW  Y
Sbjct: 15  SSFAQTCSDSGNVYGDLSCANQALDRAKRELNAIYQKIYTTTQ--YKSEFEQSQKAWLNY 72

Query: 77  RGSECA---FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           R  +C     A +   +G    +I  +CL     +R + L++ L 
Sbjct: 73  REKQCNGYIAAEASQSQGVGPGLITKDCLVTITRQRVDYLKTLLE 117


>gi|320156248|ref|YP_004188627.1| hypothetical protein VVM_02724 [Vibrio vulnificus MO6-24/O]
 gi|319931560|gb|ADV86424.1| hypothetical protein VVMO6_01402 [Vibrio vulnificus MO6-24/O]
          Length = 137

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 47/117 (40%), Gaps = 4/117 (3%)

Query: 1   MCRKIIFALTIIAIAFQS--MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + +I AL  ++    +    ++C+      ++NQC        K +LE   K   +  
Sbjct: 1   MKKSLILALASLSFGVLAGEEPIDCDTAFTTIEVNQCAAIELDAAKTELEKYLKASFDHN 60

Query: 59  EKHQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               +  E  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L
Sbjct: 61  SFDPKLVEAMKLAQTDWQTYMSSHCDSVYTQWRDGTIRGVMGISCKTKLTKQRTHEL 117


>gi|262393946|ref|YP_003285800.1| hypothetical protein VEA_003175 [Vibrio sp. Ex25]
 gi|262337540|gb|ACY51335.1| hypothetical protein VEA_003175 [Vibrio sp. Ex25]
          Length = 138

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 42/114 (36%), Gaps = 2/114 (1%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           C  II A        +  +++CN  +   ++NQC        + KLE       E     
Sbjct: 4   CLIIILASLSFGALAEEESIDCNNAMTTIEINQCAAIELESAQVKLEKYLSTSFEHNSHD 63

Query: 62  QR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L
Sbjct: 64  PELISAIKLAQRDWQAYMSSHCDSVYTQWRDGTIRGIMAISCKTKLTKQRTHEL 117


>gi|50121103|ref|YP_050270.1| hypothetical protein ECA2175 [Pectobacterium atrosepticum SCRI1043]
 gi|49611629|emb|CAG75077.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 132

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 14/127 (11%)

Query: 2   CRKIIFALTIIA---IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK- 57
            +KI+ A  ++A   ++    A +C      A+++ C        ++ L   + +   + 
Sbjct: 1   MKKILIAAAMLAGMSVSTSLWAADCANPSASAEVDSCAKQGKEATEQALNKAWSEAKGRI 60

Query: 58  ---------VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG-TAQSMIYANCLQGHAI 107
                    ++K  ++    SQ  W  YR S+C   A  AEEG TA   +  NC+     
Sbjct: 61  TTTYKADDKLQKEYQQNLVDSQRGWLKYRDSQCKMQAFLAEEGTTAHDTLTNNCISDIDK 120

Query: 108 ERNEKLE 114
           +R E+L+
Sbjct: 121 QRIEQLK 127


>gi|28872319|ref|NP_794938.1| hypothetical protein PSPTO_5207 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855573|gb|AAO58633.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 131

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 47/129 (36%), Gaps = 11/129 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL----- 55
           M     F L + ++ F      C  +    ++++C          +L  +YKK++     
Sbjct: 1   MKINFRFVLVLASLYFLPAHAECINSDTSQEVDECAKAEKNTADARLNGSYKKIIARAQG 60

Query: 56  -----EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE-EGTAQSMIYANCLQGHAIER 109
                 ++    +   + SQ AW   R + C   A   E    A      NC+ G ++ER
Sbjct: 61  QYRSDARLGDEFKAKLKDSQRAWLRLRDTNCPLEAFEIEVGQAAYLTTINNCVAGMSLER 120

Query: 110 NEKLESYLT 118
              L+  L 
Sbjct: 121 AAYLDKLLH 129


>gi|28898621|ref|NP_798226.1| hypothetical protein VP1847 [Vibrio parahaemolyticus RIMD 2210633]
 gi|28806839|dbj|BAC60110.1| hypothetical protein [Vibrio parahaemolyticus RIMD 2210633]
          Length = 152

 Score = 74.2 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 51/130 (39%), Gaps = 13/130 (10%)

Query: 2   CRKIIFALTIIAIAFQSMA----------LNC-NETLMQADMNQCTGNSFALVKEKLEAT 50
           C K +F   ++  +F S A            C ++    A +  C   +      +L   
Sbjct: 20  CMKQVFLPLLLLTSFSSFAQIEHPIDVELEACISDNSSTAGIGNCGSKAHEQWDAELNYY 79

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMIYANCLQGHAIE 108
           YK ++  ++ +Q+    +SQ +W  YR  E A   S  G++ G+   +   + +     E
Sbjct: 80  YKTLMNVLDSNQKSSLRESQRSWIKYRDLEVANIKSIYGSKRGSMWGLTALSDITEITKE 139

Query: 109 RNEKLESYLT 118
           R   L+ Y  
Sbjct: 140 RALALKKYFE 149


>gi|51245570|ref|YP_065454.1| hypothetical protein DP1718 [Desulfotalea psychrophila LSv54]
 gi|50876607|emb|CAG36447.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 149

 Score = 73.8 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
           M + II  L + A    +  L+C++     D+N+C        +++++    K +++   
Sbjct: 11  MIKYIILGLGLFASVASAAELDCSKASNTLDINECAALELEGAEKEMQRYLGKSIKQYSF 70

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +    +  + +Q +W  Y  S C    +   +GT +  +  +C       R  +L
Sbjct: 71  DPAVVDSIKVAQQSWSQYEKSHCDSVYTVWRDGTIRGAMALSCQIRLTERRTHEL 125


>gi|28872323|ref|NP_794942.1| hypothetical protein PSPTO_5211 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855578|gb|AAO58637.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 131

 Score = 73.8 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 47/129 (36%), Gaps = 11/129 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL----- 55
           M     F L + ++ F      C  +    ++++C          +L  +YKK++     
Sbjct: 1   MKINFRFVLVLASLYFLPAHAECINSGTSQEVDECAKAEKNTADARLNGSYKKLIARAQG 60

Query: 56  -----EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE-EGTAQSMIYANCLQGHAIER 109
                 ++    +   + SQ AW   R + C   A   E    A      NC+ G ++ER
Sbjct: 61  QYRSDARLGDEFKAKLKDSQRAWLRLRDTNCPLEAFEIEVGQAAYLTTINNCVAGMSLER 120

Query: 110 NEKLESYLT 118
              L+  L 
Sbjct: 121 AAYLDKLLP 129


>gi|77461786|ref|YP_351293.1| hypothetical protein Pfl01_5565 [Pseudomonas fluorescens Pf0-1]
 gi|77385789|gb|ABA77302.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 251

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 52/124 (41%), Gaps = 11/124 (8%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           R I  +L +++ +       C    +    ++C          KL ++YKK++ + E   
Sbjct: 4   RCIALSLGLLSASAVLAEDTCKVITVSWQYDECVEADRKSADAKLNSSYKKLMARFESRW 63

Query: 63  RE----------LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNE 111
           +           + + SQ AW   R + C   A+  E G+ A +++   C+   ++ER  
Sbjct: 64  KPEPEQGKAYMAMAKDSQRAWIKLRDTTCPLDATDVEPGSQAYTLVLNKCIARMSLERAA 123

Query: 112 KLES 115
            L++
Sbjct: 124 FLDA 127


>gi|153870861|ref|ZP_02000170.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
 gi|152072677|gb|EDN69834.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
          Length = 143

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 37/105 (35%), Gaps = 10/105 (9%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           +      M +C   +  L   +L   YK +  K+    +   + +Q  W  YR +E  FA
Sbjct: 43  KNQTTMGMIKCEDQAINLWDAELNRVYKALRSKLNTKAKAQLQTAQRQWMKYRDAE--FA 100

Query: 85  A----SGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLL 125
                  + +GT   ++          +R   L  YL     DL 
Sbjct: 101 TIDAIYSSMDGTIWRVVATGARTEIVKQRVLLLTGYLE----DLS 141


>gi|170749429|ref|YP_001755689.1| hypothetical protein Mrad2831_3022 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655951|gb|ACB25006.1| protein of unknown function DUF1311 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 148

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 41/123 (33%), Gaps = 15/123 (12%)

Query: 6   IFALTIIAIAFQSM---ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           + A   ++   ++    A  C           C   +      +L A YKK L  ++   
Sbjct: 19  LLACLAVSTGSRAEPPSAKLCLTETSTPGTTDCMNRALHEADARLNAAYKKALSVIDHDD 78

Query: 63  -----------RELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQSMIYANCLQGHAIERN 110
                      +   EK+Q AW  +R ++C     S    G+  +     CL    ++R 
Sbjct: 79  RTQDPDARALWKTRLEKAQRAWIAFRDADCGDLTFSEWANGSGANPAVPACLYDKTVQRT 138

Query: 111 EKL 113
             L
Sbjct: 139 ADL 141


>gi|134094657|ref|YP_001099732.1| hypothetical protein HEAR1434 [Herminiimonas arsenicoxydans]
 gi|133738560|emb|CAL61605.1| conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 134

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 53/131 (40%), Gaps = 10/131 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M +  +  L ++  +  +  ++ C       +M+ C    +     KL++TY+ +  ++ 
Sbjct: 1   MKKITLLFLALLPFSAFAQQIDPCIGKGSAQEMSACAKEEYKKASTKLDSTYQALQAQMP 60

Query: 60  KHQ---------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
                       ++  + +Q AW  +   +C            Q + Y +C++ HA+ R 
Sbjct: 61  AKDVAGIPYPAVKKQLKLAQQAWSGFVEQDCKTINIYNTGSVLQDVEYFSCMRLHAVHRT 120

Query: 111 EKLESYLTCPE 121
             LE +L+  E
Sbjct: 121 ADLEQFLSRRE 131


>gi|260364947|ref|ZP_05777518.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|260879657|ref|ZP_05892012.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260898869|ref|ZP_05907310.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|308086629|gb|EFO36324.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|308093386|gb|EFO43081.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308111746|gb|EFO49286.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
          Length = 132

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 50/128 (39%), Gaps = 13/128 (10%)

Query: 4   KIIFALTIIAIAFQSMA----------LNC-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           K +F   ++  +F S A            C ++    A +  C   +      +L   YK
Sbjct: 2   KQVFLPLLLLTSFSSFAQIEHPIDVELEACISDNSSTAGIGNCGSKAHEQWDAELNYYYK 61

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMIYANCLQGHAIERN 110
            ++  ++ +Q+    +SQ +W  YR  E A   S  G++ G+   +   + +     ER 
Sbjct: 62  TLMNVLDSNQKSSLRESQRSWIKYRDLEVANIKSIYGSKRGSMWGLTALSDITEITKERA 121

Query: 111 EKLESYLT 118
             L+ Y  
Sbjct: 122 LALKKYFE 129


>gi|238025688|ref|YP_002909919.1| hypothetical protein bglu_1g00100 [Burkholderia glumae BGR1]
 gi|237874882|gb|ACR27215.1| Hypothetical protein bglu_1g00100 [Burkholderia glumae BGR1]
          Length = 118

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA---FAASGAEE 90
            CT       K++L   Y+K+    +   ++  ++SQ AW  YR  EC     A +   +
Sbjct: 32  ACTSRDLVASKKELNEIYRKIYASTQ--YKDELDRSQKAWLNYREKECNGYVAAEASQSQ 89

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
           G    +I  +CL     +R + L+ +L 
Sbjct: 90  GAGPGLIVKDCLVTITRQRVDYLKRFLE 117


>gi|308186545|ref|YP_003930676.1| type VI secretion system-associated hypothetical protein [Pantoea
           vagans C9-1]
 gi|308057055|gb|ADO09227.1| Putative type VI secretion system-associated hypothetical protein
           [Pantoea vagans C9-1]
          Length = 152

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 12/123 (9%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE----- 59
           ++  L     + Q+M  +C+      ++N+C   +    +  L   YK    ++E     
Sbjct: 29  LLCVLASYVSSVQAM-SDCSNGNNTQEVNECAEKNKTESELNLNKEYKAAKIRIEHLYKG 87

Query: 60  -----KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
                   R  F  +Q  W  YR S+C   A  A+EG+ A   +   C+     ER   L
Sbjct: 88  HDQESSQYRSAFVDTQRNWLKYRDSQCRLEAYAADEGSDAYVSVMNFCIDRLDKERTAIL 147

Query: 114 ESY 116
           +  
Sbjct: 148 KQL 150


>gi|262375777|ref|ZP_06069009.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262309380|gb|EEY90511.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 131

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 34/85 (40%), Gaps = 1/85 (1%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C          +L   YK+ +  +  ++++  ++ Q  W  YR + C F A     G
Sbjct: 44  MLDCIAAETDRQDTRLNNAYKQTMASLNANRKKQLQEVQRLWIRYRDANCDFYAD-PNGG 102

Query: 92  TAQSMIYANCLQGHAIERNEKLESY 116
           T  ++   +C       R  +LE+ 
Sbjct: 103 TIATVNSNSCYMEATAARATELENL 127


>gi|207739046|ref|YP_002257439.1| hypothetical protein RSIPO_03742 [Ralstonia solanacearum IPO1609]
 gi|206592418|emb|CAQ59324.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 90

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 37/89 (41%), Gaps = 2/89 (2%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQMAWEIYRGSECAFAA-SGAE 89
           M  C    +     +L   Y + +EK ++     L  ++Q AW  YR + C +    G  
Sbjct: 1   MKICASYHWEKEDIRLNRLYARSMEKAKEMGFETLLVQAQRAWLTYRDAVCLYEGQIGTG 60

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYLT 118
            G  + +   +C++    ER + L + L 
Sbjct: 61  GGAYEGLYMLSCMETLTKERADHLAADLR 89


>gi|78061978|ref|YP_371886.1| hypothetical protein Bcep18194_B1128 [Burkholderia sp. 383]
 gi|77969863|gb|ABB11242.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 462

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 44/117 (37%), Gaps = 15/117 (12%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           + R  +  L   A    +  L+C +   Q +   C  N       +L   Y+K+ + + +
Sbjct: 9   LRRTFLLVLLAHAPQAFAAGLDCAQATSQTEKAICASNDLHQDDGRLSVFYRKLSDALPQ 68

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
             R     +Q+ W   R  +C     GA+ G         CL+   + R   L+S L
Sbjct: 69  GHRAALRTAQLGWLKTRD-QC-----GADHG---------CLEQRYLTRIGDLQSQL 110


>gi|255321854|ref|ZP_05363004.1| conserved hypothetical protein [Campylobacter showae RM3277]
 gi|255300958|gb|EET80225.1| conserved hypothetical protein [Campylobacter showae RM3277]
          Length = 148

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 44/109 (40%), Gaps = 4/109 (3%)

Query: 16  FQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
            Q+    C  +    A M QC    FA+  + L   YKK +  +    ++  +  Q  W 
Sbjct: 42  SQARVDECMQKDSSTAGMIQCIDAEFAIQDKLLNQNYKKAMSVLNDENKKKLKDIQRKWV 101

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
            Y+ ++C F       GT  ++  A+C      ER  +L +     EG+
Sbjct: 102 AYKEAKCPFV---PPMGTLYAVTAADCYLQMTKERARELANLAEDFEGN 147


>gi|16127221|ref|NP_421785.1| hypothetical protein CC_2991 [Caulobacter crescentus CB15]
 gi|221236022|ref|YP_002518459.1| hypothetical protein CCNA_03086 [Caulobacter crescentus NA1000]
 gi|13424625|gb|AAK24953.1| hypothetical protein CC_2991 [Caulobacter crescentus CB15]
 gi|220965195|gb|ACL96551.1| hypothetical exported protein [Caulobacter crescentus NA1000]
          Length = 184

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH-QRELFEKSQMAWEIYRGSECAF 83
           E      M  C G    +   +L   Y+  L ++E+  Q+   +K+Q AW  +R ++CA 
Sbjct: 89  EGQSTYGMIACIGQEVGVQDARLNRAYQAALMRLERPRQKAALQKAQRAWIAFRDADCA- 147

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A    + G+   +    C+     +R E+LE +
Sbjct: 148 AYVDEDWGSLARVEANQCVLDRTRQRAEELERF 180


>gi|296121228|ref|YP_003629006.1| hypothetical protein Plim_0963 [Planctomyces limnophilus DSM 3776]
 gi|296013568|gb|ADG66807.1| protein of unknown function DUF1311 [Planctomyces limnophilus DSM
           3776]
          Length = 129

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 48/125 (38%), Gaps = 10/125 (8%)

Query: 1   MCRKIIFALTIIAIAFQSM-ALNC---------NETLMQADMNQCTGNSFALVKEKLEAT 50
           M  K+ +A+ +  +   ++ A +             L Q +MN  +      + +KL   
Sbjct: 1   MQTKLHYAVLMAMVLTSALRADDAKLRDLEAHLQSALTQIEMNIASSKIAEYLDKKLVEK 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
            + V + ++     LF ++   W  YR ++  F A     G+ + +++         ER 
Sbjct: 61  ERDVAKDLDPEALRLFSEASKLWRDYRSAQTTFEADLYRGGSIRPLVHNRTYSRLTQERL 120

Query: 111 EKLES 115
             LE 
Sbjct: 121 SALEG 125


>gi|126729534|ref|ZP_01745347.1| hypothetical protein SSE37_03650 [Sagittula stellata E-37]
 gi|126709653|gb|EBA08706.1| hypothetical protein SSE37_03650 [Sagittula stellata E-37]
          Length = 174

 Score = 71.5 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 37/110 (33%), Gaps = 12/110 (10%)

Query: 18  SMALNC--NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE----------KHQREL 65
           + A  C          M+ C          +L A Y  V+ +              Q + 
Sbjct: 61  AAAETCMERNGSATVVMSACYDKEAQWWDSRLNAIYSDVMAQARDMDTENGEHAPSQADA 120

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             + Q AW  YR   C++ AS    GT     +  CL     E++  LE+
Sbjct: 121 LRRMQRAWIDYRDETCSYEASQWGGGTGAGPAFNACLMRMTAEQSHYLET 170


>gi|330448040|ref|ZP_08311688.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492231|dbj|GAA06185.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 138

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/117 (17%), Positives = 53/117 (45%), Gaps = 4/117 (3%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + ++ AL  ++    +    L+C+      ++N+C        + +L   +   LE  
Sbjct: 1   MKKYLLIALVCVSFPTFAAKKVLDCDNPRNTLEINECAAGKLDSAQAELSKYFAASLEHN 60

Query: 59  EKHQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           ++  +  +  E++Q  WE+Y  ++C+   +   +GT ++++  +C      ER   +
Sbjct: 61  KEDPKLVKAIEQAQKDWEVYMKAQCSAVYTQWRDGTIRNVMALDCKTQLTKERTHDI 117


>gi|156974299|ref|YP_001445206.1| hypothetical protein VIBHAR_02014 [Vibrio harveyi ATCC BAA-1116]
 gi|156525893|gb|ABU70979.1| hypothetical protein VIBHAR_02014 [Vibrio harveyi ATCC BAA-1116]
          Length = 129

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
           +C     +   + L   YK+ + +++  ++E   K+Q  W  YR ++C      +E G+ 
Sbjct: 47  KCMNEELSKRDKLLNTAYKQYMARIQDFRKEDLRKTQRLWIQYRDAKCDMF-YHSESGSG 105

Query: 94  QSMIYANCLQGHAIERNEKL 113
                 +CL    I+R ++L
Sbjct: 106 GLEDLHDCLITETIQRTKEL 125


>gi|117621024|ref|YP_856384.1| hypothetical protein AHA_1850 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562431|gb|ABK39379.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 134

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 49/128 (38%), Gaps = 11/128 (8%)

Query: 2   CRKIIFALTIIAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
            +++ FAL  I+++  S    NC+ +    ++  C  +       +L  TY  +   +  
Sbjct: 1   MKRLSFALFFISLSVFSNTDRNCDISAPSTNLAACYESKSKQADAELNKTYNNLKSTLLS 60

Query: 59  EKHQRE-------LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI-YANCLQGHAIERN 110
             + ++          +SQ  W   R ++C    +  E+ +   +I    CL     ER 
Sbjct: 61  SGYDKQSKEKYWSQLVQSQRYWIKLRDAQCYARGAFFEDSSIAQLIEIKKCLMNITKERV 120

Query: 111 EKLESYLT 118
             L + + 
Sbjct: 121 FFLNNEIQ 128


>gi|156936788|ref|YP_001436139.1| hypothetical protein VIBHAR_p08272 [Vibrio harveyi ATCC BAA-1116]
 gi|156530035|gb|ABU75119.1| hypothetical protein VIBHAR_p08272 [Vibrio harveyi ATCC BAA-1116]
          Length = 129

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
           +C     +   + L   YK+ + +++  ++E   K+Q  W  YR ++C      +E G+ 
Sbjct: 47  KCMNEELSKRDKLLNTAYKQYMARIQDFRKEDLRKTQRLWIQYRDAKCDMF-YHSESGSG 105

Query: 94  QSMIYANCLQGHAIERNEKL 113
                 +CL    I+R ++L
Sbjct: 106 GLEDLHDCLITETIQRTKEL 125


>gi|323525336|ref|YP_004227489.1| hypothetical protein BC1001_0978 [Burkholderia sp. CCGE1001]
 gi|323382338|gb|ADX54429.1| hypothetical protein BC1001_0978 [Burkholderia sp. CCGE1001]
          Length = 145

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 46/134 (34%), Gaps = 18/134 (13%)

Query: 1   MCRKIIFALT-IIAIAFQSMALNCN--------ETLMQADMNQCTGNSFALVKEKLEATY 51
           + R + FA   ++  +   +A +C         E+  Q+    C+  +       + + Y
Sbjct: 9   LLRLLCFAAFHVLTHSAPVLAGDCAAVSGGIGLESATQS--LACSKAALKRDDTLMNSVY 66

Query: 52  KKVLEKVEKH------QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQG 104
           K +L+ +          R     +Q AW  +R SEC F  S          +    CL  
Sbjct: 67  KDLLKVLHDDPSGENFARSGLVSAQRAWIAFRDSECDFRVSLVGGAHQWREVNEVECLSE 126

Query: 105 HAIERNEKLESYLT 118
               R   L  YL 
Sbjct: 127 LTKGRTNMLSEYLK 140


>gi|84385754|ref|ZP_00988784.1| hypothetical protein V12B01_12045 [Vibrio splendidus 12B01]
 gi|84379070|gb|EAP95923.1| hypothetical protein V12B01_12045 [Vibrio splendidus 12B01]
          Length = 140

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 13/110 (11%), Positives = 40/110 (36%), Gaps = 2/110 (1%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK--VEKHQ 62
           ++     +  +     ++C   +   ++N C        + +L+       E    +   
Sbjct: 8   VLLTCLPLLASASDDVIDCENAMNTIEINHCAAIELESAQAELDKYLAASFEHNDYDAEL 67

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
               +K+Q +W+ Y  + C    +   +G+ + ++  +C      +R  +
Sbjct: 68  VASIKKAQDSWQAYMSAHCNSVYTQWRDGSIRGVMALSCKTTLTKQRTHE 117


>gi|118444363|ref|YP_877264.1| lipoprotein [Clostridium novyi NT]
 gi|118134819|gb|ABK61863.1| lipoprotein, putative [Clostridium novyi NT]
          Length = 228

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 30/88 (34%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
                +M Q     +    + L   Y ++ + + K   E  +K +  W  YR  E    A
Sbjct: 135 AGTTLEMRQAAEEEYMTWDKHLNEIYSELKKDLSKDTMEKLKKEETQWISYRDREAKKDA 194

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKL 113
              + G+   +     L     +R  +L
Sbjct: 195 DSFKGGSFMPVQNLLSLGDLTKQRCYEL 222


>gi|90577512|ref|ZP_01233323.1| hypothetical protein VAS14_10714 [Vibrio angustum S14]
 gi|90440598|gb|EAS65778.1| hypothetical protein VAS14_10714 [Vibrio angustum S14]
          Length = 128

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
           +C     +   + L   YK+ + +++  ++E   K+Q  W  YR ++C      +E G+ 
Sbjct: 46  KCMNEELSKRDKLLNTAYKQYMARIQDFRKEDLRKTQRLWIQYRDAKCGMF-YHSESGSG 104

Query: 94  QSMIYANCLQGHAIERNEKL 113
                ++C+    I+R ++L
Sbjct: 105 GLEDLSDCMITETIQRTKEL 124


>gi|299768365|ref|YP_003730391.1| hypothetical protein AOLE_00575 [Acinetobacter sp. DR1]
 gi|298698453|gb|ADI89018.1| hypothetical protein AOLE_00575 [Acinetobacter sp. DR1]
          Length = 119

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 42/121 (34%), Gaps = 7/121 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALN----CNETLMQA-DMNQCTGNSFALVKEKLEATYKKVL 55
           M +KI   +  I I+  + A      C        D+  C    +    + L A Y+K +
Sbjct: 1   MNKKIQTYILTIFISSCAFADKVGSVCIPDSTVFNDILNCYLADYKKNDKILNALYQKKI 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             + K  +E   +SQ  W   + + C   A   E G         C      ER   L+ 
Sbjct: 61  SNLSKGNKEKLRESQRDWIKEKEAVC--VADENEYGRESHFEAIKCQTEMTKERIYFLKK 118

Query: 116 Y 116
           Y
Sbjct: 119 Y 119


>gi|188532785|ref|YP_001906582.1| hypothetical protein ETA_06380 [Erwinia tasmaniensis Et1/99]
 gi|188027827|emb|CAO95684.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 125

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 43/123 (34%), Gaps = 11/123 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALN---------CNET--LMQADMNQCTGNSFALVKEKLEAT 50
            +  I     +  +F   A           C +    +   M  C      +  ++L   
Sbjct: 1   MKIFIATFIALLFSFTVQAKELAYSVSYNQCMDKAGGVTVSMRDCLAGEIIVQDKRLNDN 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           YKK + ++    ++ F  +Q  W  +R  +C   AS    GT  ++I  +C      +R 
Sbjct: 61  YKKFISEMSSDVKKNFIDAQRQWVKFRDLDCNAFASQEAGGTLSAVIADSCYLKMTAQRA 120

Query: 111 EKL 113
           +  
Sbjct: 121 DDF 123


>gi|261252798|ref|ZP_05945371.1| hypothetical protein VIA_002822 [Vibrio orientalis CIP 102891]
 gi|260936189|gb|EEX92178.1| hypothetical protein VIA_002822 [Vibrio orientalis CIP 102891]
          Length = 137

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 47/117 (40%), Gaps = 4/117 (3%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK- 57
           M + +I AL  ++    +   A++C+       +++C        K +LE   K   E  
Sbjct: 1   MKKSLIIALASLSFGALADEKAIDCDAAFTTIQISRCAAIELDAAKTELEKYLKASFEHN 60

Query: 58  -VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +    E  + +Q  W+ Y  S C    +   +GT + ++  +C      +R  +L
Sbjct: 61  SFDSELVEAMKLAQTDWQTYMSSHCDSVYTQWRDGTIRGVMAISCKTKLTKQRTHEL 117


>gi|115359025|ref|YP_776163.1| hypothetical protein Bamb_4276 [Burkholderia ambifaria AMMD]
 gi|115284313|gb|ABI89829.1| protein of unknown function DUF1311 [Burkholderia ambifaria AMMD]
          Length = 129

 Score = 70.3 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 45/118 (38%), Gaps = 9/118 (7%)

Query: 1   MCRKII---FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +K +   FAL  +A+ F + A  C +     D   C+ N F+ +  +L   Y +V + 
Sbjct: 1   MKKKNLLASFALLGLAVPFAAQAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKH 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +   Q+   + SQ+AW   R   C+             ++   C       R   L  
Sbjct: 61  LSGDQQAKLKTSQLAWMKQRDDRCSETRDDGY------LVNLQCAIDATQSRLSFLRE 112


>gi|254503390|ref|ZP_05115541.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222439461|gb|EEE46140.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 137

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 51/126 (40%), Gaps = 13/126 (10%)

Query: 6   IFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           +    ++ +   ++A    +C   L  ++   C   +     E L A Y++ LEK+ +  
Sbjct: 8   VLPAVLLGLCAPALADEKIDCGYPLNNSERTYCAEKALDQANEDLTAAYERALEKMTEVD 67

Query: 63  REL----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
             L           + +Q AW  +R  +C   +     GT  + +Y NC+    ++R + 
Sbjct: 68  TSLPEHLKGSPNALKAAQEAWTDFRDKDCTAYSFPFRGGTRGNELYRNCMIVMTMQRIDD 127

Query: 113 LESYLT 118
           L + + 
Sbjct: 128 LNAMVE 133


>gi|223934928|ref|ZP_03626847.1| protein of unknown function DUF1311 [bacterium Ellin514]
 gi|223896381|gb|EEF62823.1| protein of unknown function DUF1311 [bacterium Ellin514]
          Length = 138

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 52/125 (41%), Gaps = 12/125 (9%)

Query: 4   KIIFALTIIAIAFQSMA------------LNCNETLMQADMNQCTGNSFALVKEKLEATY 51
           + I A   + +   ++A             N ++   Q + N  +         KL  T 
Sbjct: 2   RTIIAFLCLFLTVAALAGEPSDSNLQQLKNNLDQAKTQTETNLTSKAIADFWDAKLLRTE 61

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           +K+  ++ + + + F +++  W+ YR SE +F A  +E G+ Q +I  +        R  
Sbjct: 62  RKIESRLNRQEHKKFLQTKKLWQKYRSSEVSFRAGFSEGGSIQPLIANSTYSHITEHRVI 121

Query: 112 KLESY 116
           +LE+ 
Sbjct: 122 ELEAL 126


>gi|254464043|ref|ZP_05077454.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206684951|gb|EDZ45433.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 114

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 35/93 (37%), Gaps = 3/93 (3%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-ELFEKSQMAWEIYRGSECAF 83
               Q D N C    + +   +L   + +V    +     +     Q AW   R + C  
Sbjct: 23  NGQTQIDANFCAMEKWEIADRELNRLWSQVKPAADARGTGQALLAEQRAWLKRRDAACGP 82

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               A  G+A  M Y +C++   + RN+ L + 
Sbjct: 83  E--QASGGSAAPMFYWDCMEQETLRRNQALRAL 113


>gi|148975601|ref|ZP_01812472.1| hypothetical protein VSWAT3_03536 [Vibrionales bacterium SWAT-3]
 gi|145965029|gb|EDK30280.1| hypothetical protein VSWAT3_03536 [Vibrionales bacterium SWAT-3]
          Length = 140

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 41/117 (35%), Gaps = 5/117 (4%)

Query: 1   MCRKIIFALTIIAIAFQSM---ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M + I   L             A++C+  +   ++N C        + +L+       E 
Sbjct: 1   MKKAIALLLLTYFSGLAHAGEDAVDCDNAMNTLEINHCAALELESAQVELDKYLAASFEH 60

Query: 58  VEKHQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
             +        + +Q +W+ Y  + C    +   +G+ + ++  +C      +R  +
Sbjct: 61  NAEDTELVGAIKVAQESWKAYMTTHCDSVYTQWRDGSIRGLMALSCKTKLTKQRTHE 117


>gi|302386455|ref|YP_003822277.1| hypothetical protein Closa_2075 [Clostridium saccharolyticum WM1]
 gi|302197083|gb|ADL04654.1| hypothetical protein Closa_2075 [Clostridium saccharolyticum WM1]
          Length = 287

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 30/93 (32%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                M         L   +  A Y  + +++    R+  E SQ  W   R ++   AA 
Sbjct: 187 SNTYSMKALVEKELKLWDREQNAIYAAITQELNDEDRKALETSQQEWIKSRDTKAEDAAK 246

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
               G+ + + Y   L      R   L   Y+ 
Sbjct: 247 KYSGGSLEELEYTASLTESTRARAYDLVAEYMN 279


>gi|330448459|ref|ZP_08312107.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492650|dbj|GAA06604.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 128

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
           +C     +   + L   YK+ + +++  ++E   K+Q  W  YR ++C      +E G+ 
Sbjct: 46  KCMNEELSKRDKLLNTAYKQYMTRIQDFRKEDLRKTQRLWIQYRDAKCGMF-YHSESGSG 104

Query: 94  QSMIYANCLQGHAIERNEKL 113
                 +C+    I+R ++L
Sbjct: 105 GLEDLNDCMIKETIQRTKEL 124


>gi|113868482|ref|YP_726971.1| hypothetical protein H16_A2515 [Ralstonia eutropha H16]
 gi|113527258|emb|CAJ93603.1| Hypothetical protein H16_A2515 [Ralstonia eutropha H16]
          Length = 121

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 41/101 (40%), Gaps = 2/101 (1%)

Query: 15  AFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
              +    C  + +  AD+  C      +    L + Y+ +L ++E  +      +Q AW
Sbjct: 13  GLSAEYERCMAKAISTADILGCAAVETRVQDVALNSAYQGLLRRLEAPRTGQLRVAQRAW 72

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             +R + CA+ A     GTA  +  A C+   +  R  +L 
Sbjct: 73  LEFRQANCAYVA-NPAGGTAARVAGATCMARMSAARVRELR 112


>gi|118591405|ref|ZP_01548803.1| probable urease-associated protein [Stappia aggregata IAM 12614]
 gi|118436077|gb|EAV42720.1| probable urease-associated protein [Stappia aggregata IAM 12614]
          Length = 143

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 51/125 (40%), Gaps = 18/125 (14%)

Query: 9   LTIIAIAFQSMAL--------NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
              +A+A  + A         +C   L  A+ + C   +      +++  + ++  ++ +
Sbjct: 12  ALFLAVAGTAGAEEEKVKDNIDCGYPLTNAERSFCADKALKEADARMQEAFDRLRVRLVE 71

Query: 61  HQREL----------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
              +L           +++Q AW+ Y   +C   +     GT  + +Y NCL    ++R 
Sbjct: 72  IDADLPDHLKGAPASLDEAQTAWKTYADKDCTAYSFPFRGGTRGNELYRNCLIVLTMKRT 131

Query: 111 EKLES 115
           E L++
Sbjct: 132 EDLDA 136


>gi|88859453|ref|ZP_01134093.1| putative periplasmic protein [Pseudoalteromonas tunicata D2]
 gi|88818470|gb|EAR28285.1| putative periplasmic protein [Pseudoalteromonas tunicata D2]
          Length = 121

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 45/105 (42%), Gaps = 7/105 (6%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL--FEKSQMAWEI--YRGSECA 82
           + Q DMNQC G  +   + +L     ++ +  +  ++ L   EKSQ  WE       +  
Sbjct: 1   MSQRDMNQCAGIDYKKAESELFRVITEINKLYKDEEKFLVNLEKSQRNWEAQLELDLDLK 60

Query: 83  FAASGA--EEGTAQSMIYANCLQGHAIERNEKLESYL-TCPEGDL 124
           F  +G     G+   M Y+       ++R   L+ +L    EG++
Sbjct: 61  FPRAGDPMYYGSIFPMCYSGYKTRLTLQRIAFLKEWLIGSREGEV 105


>gi|317048721|ref|YP_004116369.1| hypothetical protein Pat9b_2512 [Pantoea sp. At-9b]
 gi|316950338|gb|ADU69813.1| protein of unknown function DUF1311 [Pantoea sp. At-9b]
          Length = 131

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 48/127 (37%), Gaps = 12/127 (9%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M + II  L    +   + A + C + +   ++  C  ++    ++ L   Y     ++ 
Sbjct: 1   MKKGIIVFLFFGVLQNYANAQDVCGKAVNDGEVFSCFNSAKQAAEKTLNEEYIAAKNRIA 60

Query: 60  KHQREL----------FEKSQMAWEIYRGSECAFAASGAEEGTA-QSMIYANCLQGHAIE 108
                             +SQ  W  YR  +C   +  AE+GT     +   C+    +E
Sbjct: 61  AEYSASPADLQSYTSTLTESQRGWLKYRDGQCNLESFMAEKGTVTYDTLKDKCVARVDLE 120

Query: 109 RNEKLES 115
           R E+L++
Sbjct: 121 RVEQLKA 127


>gi|167624363|ref|YP_001674657.1| hypothetical protein Shal_2440 [Shewanella halifaxensis HAW-EB4]
 gi|167354385|gb|ABZ76998.1| conserved hypothetical protein [Shewanella halifaxensis HAW-EB4]
          Length = 135

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 46/115 (40%), Gaps = 2/115 (1%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + I+F L + + A  +  +NC+      ++NQC        K +++    K  E    
Sbjct: 1   MKKYILFTLALASTASFADEINCDTAYSTIEINQCAAMELDAAKAEMQTYLAKSYEHNSY 60

Query: 61  HQR--ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +     + +Q  W+ Y  S C    +   +GT + ++  +C       R  ++
Sbjct: 61  DPQLINAIKVAQNDWQQYLTSHCDSVYTQWRDGTIRGVMAISCKTRLTKLRTYEI 115


>gi|86145123|ref|ZP_01063454.1| hypothetical protein MED222_04380 [Vibrio sp. MED222]
 gi|85836700|gb|EAQ54820.1| hypothetical protein MED222_04380 [Vibrio sp. MED222]
          Length = 143

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 13/117 (11%), Positives = 42/117 (35%), Gaps = 5/117 (4%)

Query: 1   MCRKI---IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M + +   +     +  +     ++C   +   ++N C        + +L+   +   E 
Sbjct: 1   MKKALTVVLLTCLPLLASASDDVVDCENAMNTIEINHCASIELDTAQVELDQYLEASFEH 60

Query: 58  --VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
              +       + +Q +W+ Y  + C    +   +G+ + ++  +C      +R  +
Sbjct: 61  NAYDAELVSSIKMAQDSWQAYMTAHCDSVYTQWRDGSIRGLMALSCKTKLTKQRTHE 117


>gi|302037308|ref|YP_003797630.1| hypothetical protein NIDE1981 [Candidatus Nitrospira defluvii]
 gi|300605372|emb|CBK41705.1| conserved exported protein of unknown function, COG3755 [Candidatus
           Nitrospira defluvii]
          Length = 135

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 48/113 (42%), Gaps = 5/113 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +IF+   +  A Q    +C  +  Q ++N C       ++ K++  Y +++  +E+   +
Sbjct: 14  VIFSFISLVSANQDQ-QDCESSQTQLELNACWSQLAGEIEGKVKTAYLEIVRALEQAGEK 72

Query: 65  ----LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               L +++Q  WE YR  +C  A    E G+    + A C       R   L
Sbjct: 73  NALKLLKRAQRYWEQYRDVQCEGARQLYEGGSVAKTVEATCRAKTGRNRIGDL 125


>gi|91223897|ref|ZP_01259161.1| hypothetical protein V12G01_19172 [Vibrio alginolyticus 12G01]
 gi|91191389|gb|EAS77654.1| hypothetical protein V12G01_19172 [Vibrio alginolyticus 12G01]
          Length = 138

 Score = 68.8 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 36/92 (39%), Gaps = 12/92 (13%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQREL------------FEKSQMAWEIYRGSEC 81
           QC         ++L  +YK+ + ++ + ++ L            F K+Q AW  YR +EC
Sbjct: 41  QCVEKKMESADKELNESYKEAIARIGEEEKALRETWSQTELVEPFRKAQRAWLKYRDAEC 100

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            F    +     Q +    C     +ER E  
Sbjct: 101 EFTGLSSTPSPWQGVQIEECKLRMTLERVEYF 132


>gi|260558007|ref|ZP_05830219.1| predicted protein [Acinetobacter baumannii ATCC 19606]
 gi|260408517|gb|EEX01823.1| predicted protein [Acinetobacter baumannii ATCC 19606]
          Length = 117

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 45/119 (37%), Gaps = 8/119 (6%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +K++ AL ++          C +T       +C        K K+   Y K++  ++  
Sbjct: 1   MKKLMLALLVLFCGVAHA--EC-KTGNIYSDIECFEKQLKTDKAKMNKIYNKLVSNLDSE 57

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEE----GTAQSMIYANCLQGHAIERNEKLESY 116
            +   E SQ AW  YR  +C+    G       G    +I  +C      ER  +L+S 
Sbjct: 58  GKASLENSQKAWLDYRTKQCS-GLMGYYGAQTLGAGSHLIILSCEADKTKERLNELKSL 115


>gi|330806680|ref|YP_004351142.1| hypothetical protein PSEBR_a21 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374788|gb|AEA66138.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 124

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/115 (15%), Positives = 42/115 (36%), Gaps = 10/115 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + ++    +   +  + A++C+      D   C         + +   YKK +  +  
Sbjct: 1   MIKSLLVGTLLAMASASASAMSCDNPRNAYDRTYCASLKMVQSDQDINDQYKKTMSALNP 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            Q++  + +Q+ W   R S C          +   ++Y +C       R   L++
Sbjct: 61  DQKKKVKAAQIQWIKNRDSAC----------SNDGLLYLDCANEKTEARIVILKA 105


>gi|217979002|ref|YP_002363149.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
 gi|217504378|gb|ACK51787.1| protein of unknown function DUF1311 [Methylocella silvestris BL2]
          Length = 333

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/112 (16%), Positives = 35/112 (31%), Gaps = 9/112 (8%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
            I        +A  + AL+C +     +   C   +     E +  TY  +   ++   R
Sbjct: 6   TISVLTAAWLVAAPARALDCAKANTPIETAICANPAALAADEAMTKTYDGLAASLKPEHR 65

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +    SQ  W   R + C          + +     +CL     +R   L  
Sbjct: 66  QALLISQRRWLEQRANLCV---------SEEGKAVDSCLVEKTDDRRSFLAG 108


>gi|206563929|ref|YP_002234692.1| hypothetical protein BCAM2089 [Burkholderia cenocepacia J2315]
 gi|198039969|emb|CAR55947.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 129

 Score = 68.4 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   CT   F+     L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAAHAAGCGKPRSAFDQVYCTSTQFSQSDRDLNDEYGRLRKQLSGDQQATLKAGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C    S     +   ++   C       R   L  
Sbjct: 77  LKQRDAQC----SETRGSSY--LVDIQCANDMTQSRLSFLRE 112


>gi|254250158|ref|ZP_04943478.1| hypothetical protein BCPG_05042 [Burkholderia cenocepacia PC184]
 gi|124876659|gb|EAY66649.1| hypothetical protein BCPG_05042 [Burkholderia cenocepacia PC184]
          Length = 129

 Score = 68.4 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   CT   F+     L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAAHAAGCGKPRSAFDQVYCTSTQFSQSDRDLNDEYGRLRKQLSGDQQATLKAGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C    S     +   ++   C       R   L  
Sbjct: 77  LKQRDAQC----SETRGSSY--LVDIQCANDMTQSRLSFLRE 112


>gi|83649633|ref|YP_438068.1| large extracellular alpha-helical protein [Hahella chejuensis KCTC
           2396]
 gi|83637676|gb|ABC33643.1| Large extracellular alpha-helical protein [Hahella chejuensis KCTC
           2396]
          Length = 2040

 Score = 68.4 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 44/115 (38%), Gaps = 16/115 (13%)

Query: 9   LTIIAIAFQSMA------LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           L ++AI+   ++       +C +   Q +   C     A    KL   Y  V++ +E+  
Sbjct: 9   LFLLAISGSGLSWAGQPSFDCAKASQQVEHIICDSEPLAAQDAKLAKLYGNVMKSLEQSA 68

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           ++  +  Q  W   R  +C       E          +CL G   +RN +L + L
Sbjct: 69  KDKLKSEQREWLRNRNRDCDLNGDAGE----------SCLLGRYRQRNAELSAML 113


>gi|170737747|ref|YP_001779007.1| hypothetical protein Bcenmc03_5390 [Burkholderia cenocepacia MC0-3]
 gi|169819935|gb|ACA94517.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           MC0-3]
          Length = 129

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   CT   F+     L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAAHAAGCAKPRSAFDQVYCTSTQFSQSDRDLNDEYGRLRKQLSGDQQATLKAGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C    S     +   ++   C       R   L  
Sbjct: 77  LKQRDAQC----SETRGSSY--LVDIQCANDMTQSRLSFLRE 112


>gi|254285006|ref|ZP_04959972.1| conserved hypothetical protein, putative [Vibrio cholerae AM-19226]
 gi|150425009|gb|EDN16786.1| conserved hypothetical protein, putative [Vibrio cholerae AM-19226]
          Length = 162

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/117 (14%), Positives = 45/117 (38%), Gaps = 4/117 (3%)

Query: 1   MCRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           M + ++  L   +    +   +L+C   +   ++NQC   +    + +L    +   E  
Sbjct: 25  MKKWLLIMLASFSSVVSAENESLDCKNAMNTFEINQCASMALDSAQAELTKYLEASFEHN 84

Query: 59  --EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +       + +Q  W+ Y  S C    +   +G+ + ++  +C      +R  ++
Sbjct: 85  ANDPDLVSAIQVAQKDWQSYMSSHCNSVYTQWRDGSIRGVLAISCKTQLTRQRTHEI 141


>gi|239503713|ref|ZP_04663023.1| hypothetical protein AbauAB_15497 [Acinetobacter baumannii AB900]
          Length = 117

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 45/119 (37%), Gaps = 8/119 (6%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +K++  L ++          C +T       +C        K K+   Y K+   ++  
Sbjct: 1   MKKLMLTLLVLFCGVAHA--EC-KTGNVYSDIECFEKQLKTDKAKMNKIYNKLASNLDSE 57

Query: 62  QRELFEKSQMAWEIYRGSECA----FAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +   E SQ AW  YR  +C+    +  S A    +  +I  +C      ER  +L+S 
Sbjct: 58  GKASLENSQKAWLDYRTKQCSGLMGYYGSQAMGAGSH-LIILSCEADKTKERLNELKSL 115


>gi|93005476|ref|YP_579913.1| hypothetical protein Pcryo_0646 [Psychrobacter cryohalolentis K5]
 gi|92393154|gb|ABE74429.1| protein of unknown function DUF1311 [Psychrobacter cryohalolentis
           K5]
          Length = 138

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 48/123 (39%), Gaps = 9/123 (7%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I+ +   +       A NC++ +   D   C    +    ++L  +Y K+ + +   Q+ 
Sbjct: 17  ILTSAAFMFPMLSWGAQNCDKPVNDFDGLYCLTKVYLEADKELNNSYSKLNKFLSSTQKS 76

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLTCPEGD 123
             ++ Q+AW   R  +C   +   E G   +M   +C     I+R   L E    C  G 
Sbjct: 77  KLKRRQLAWMRDRNDQC---SYHDEGGFYVNM---DCATRTTIKRVNFLNERARECSAG- 129

Query: 124 LLC 126
             C
Sbjct: 130 -SC 131


>gi|34499742|ref|NP_903957.1| hypothetical protein CV_4287 [Chromobacterium violaceum ATCC 12472]
 gi|34105593|gb|AAQ61947.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 136

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           A M  C     A   ++L  TY+K++  +   +++  + +Q  W  YR + C+ A    +
Sbjct: 46  AGMLDCLSAEHARQDKQLNDTYRKLMAALPAKRQQRLQVAQRLWLKYRAANCS-AYVDPD 104

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESY 116
            G+A+S++ A+C       R  +L   
Sbjct: 105 GGSAESLVAADCELASTAARAAELSRL 131


>gi|88799406|ref|ZP_01114984.1| hypothetical protein MED297_17408 [Reinekea sp. MED297]
 gi|88777945|gb|EAR09142.1| hypothetical protein MED297_17408 [Reinekea sp. MED297]
          Length = 93

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 4/89 (4%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAE 89
           M  CT  + A   ++L   Y+++  ++ +  R+    +Q  W  Y+ +E     +  G+ 
Sbjct: 1   MTNCTNVALAEWDDELNRIYRELRLQLGEGARDSLLIAQRKWIEYKEAEIQNINAIYGSL 60

Query: 90  EGTAQ-SMIYANCLQGHAIERNEKLESYL 117
           +GT    M     L      R  +L+SYL
Sbjct: 61  DGTMYIPMRANAILT-ITKSRTLELKSYL 88


>gi|302670090|ref|YP_003830050.1| hypothetical protein bpr_I0725 [Butyrivibrio proteoclasticus B316]
 gi|302394563|gb|ADL33468.1| hypothetical protein bpr_I0725 [Butyrivibrio proteoclasticus B316]
          Length = 396

 Score = 67.2 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 14/100 (14%), Positives = 37/100 (37%), Gaps = 1/100 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY-RGSECA 82
           ++   Q +MN      F +   +L + + +  E  +   +E   + Q  W    + +   
Sbjct: 191 DQDSTQVEMNMAASLYFQVWDAELNSLWNRFSESADAQTKERVLEDQRHWNAMKQDAALE 250

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
                 + G+   ++Y + ++     R  +L   +   +G
Sbjct: 251 ALGPQDQGGSIYPLLYDSFMEESTKGRCYELAKEIAAAKG 290


>gi|218890779|ref|YP_002439643.1| hypothetical protein PLES_20401 [Pseudomonas aeruginosa LESB58]
 gi|218771002|emb|CAW26767.1| hypothetical protein PLES_20401 [Pseudomonas aeruginosa LESB58]
          Length = 128

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 40/119 (33%), Gaps = 10/119 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           M + +  AL   +    +        C       D   C    F+    +L   +  + +
Sbjct: 1   MNKPLATALPATSSLLLADGALAADACGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRK 60

Query: 57  KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +   Q+ L +KSQ+AW   R + C+ +            +  +C      +R + L  
Sbjct: 61  HLNDGQKALLKKSQIAWIKERDAACSESKDNGY------FVNLDCATEKTRQRLDFLRE 113


>gi|27382610|ref|NP_774139.1| hypothetical protein blr7499 [Bradyrhizobium japonicum USDA 110]
 gi|27355782|dbj|BAC52764.1| blr7499 [Bradyrhizobium japonicum USDA 110]
          Length = 339

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 41/98 (41%), Gaps = 4/98 (4%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
            + Q++MN     S+A + E+L+    +V        R+  +  Q  W  +R +E    A
Sbjct: 246 PMTQSEMNDRAAQSYAALNEELDKICAQVRAYT---GRDEVDAVQKLWGEFRNAEAERQA 302

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
                GT + M+Y          R ++L  ++  P GD
Sbjct: 303 QRHLGGTIRRMLYILAATRITEARIKELRDWIEDP-GD 339


>gi|255524897|ref|ZP_05391845.1| protein of unknown function DUF1311 [Clostridium carboxidivorans
           P7]
 gi|255511375|gb|EET87667.1| protein of unknown function DUF1311 [Clostridium carboxidivorans
           P7]
          Length = 228

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 36/93 (38%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              ADM       +      L   Y  +  ++  +  +  +  ++ W   R ++   +AS
Sbjct: 136 GTTADMRTSVNERYKKWDAALNEIYGVLKGQLSANDMKNLQSEEIQWISNRDAKAEKSAS 195

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
             + G+ +S++Y   L      R  +L E Y+ 
Sbjct: 196 EMKGGSMESVLYTGSLAATTRSRCYELVEKYMH 228


>gi|291617915|ref|YP_003520657.1| Hypothetical Protein PANA_2362 [Pantoea ananatis LMG 20103]
 gi|291152945|gb|ADD77529.1| Hypothetical Protein PANA_2362 [Pantoea ananatis LMG 20103]
          Length = 133

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 57/128 (44%), Gaps = 14/128 (10%)

Query: 1   MCRKIIFALTIIAIAF--QSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M + +I  L ++ +       AL +C++     ++  C   + +  +  L   YK    +
Sbjct: 1   MNKILISTLLLVGVQVLNPVYALSDCSQGNNDQEVYSCAEKNKSETEVMLNKEYKAAKSR 60

Query: 58  VEKHQR----------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQGHA 106
           V+   +           +  ++Q AW  YR ++C  A+  A++G+  S+ Y   C+  H 
Sbjct: 61  VQDIYKGNDEDLNKYINILTEAQRAWLKYRENDCELASFAADKGSDASVSYKNMCISEHN 120

Query: 107 IERNEKLE 114
            +R ++L+
Sbjct: 121 EQRIKRLK 128


>gi|300312670|ref|YP_003776762.1| hypothetical protein Hsero_3373 [Herbaspirillum seropedicae SmR1]
 gi|125992536|emb|CAM35232.1| probable conserved hypothetical protein [Herbaspirillum
           seropedicae]
 gi|300075455|gb|ADJ64854.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 139

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 42/94 (44%), Gaps = 2/94 (2%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA--SGAE 89
           M + T  +  +  ++L  +Y  ++ ++   Q+E+   SQ AW  +R ++    +    A+
Sbjct: 46  MREATNQARQMWDKELNKSYLHLMSRLPAAQQEVLRASQRAWIKFRDADGEVISRIVAAQ 105

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
           +GT   +   +        R  +L+ Y    EG+
Sbjct: 106 QGTIFQLTATSYWMELTKARALQLDGYDRSFEGE 139


>gi|327439017|dbj|BAK15382.1| hypothetical protein SSIL_0959 [Solibacillus silvestris StLB046]
          Length = 262

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 32/85 (37%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA 88
           Q +M    G  F+     L   Y  + + +  +      + Q  W  YR  +   AA   
Sbjct: 172 QVEMTAAEGEIFSKWDMLLNEIYADLKKTLPPNDMSKLREEQRDWLEYRDEKAKEAALQY 231

Query: 89  EEGTAQSMIYANCLQGHAIERNEKL 113
           + G+ +++ Y +       ER  +L
Sbjct: 232 KGGSMETLQYVSTQAQLTKERCYEL 256


>gi|254254380|ref|ZP_04947697.1| hypothetical protein BDAG_03677 [Burkholderia dolosa AUO158]
 gi|124899025|gb|EAY70868.1| hypothetical protein BDAG_03677 [Burkholderia dolosa AUO158]
          Length = 129

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 44/118 (37%), Gaps = 9/118 (7%)

Query: 1   MCRKIIF---ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +K +    AL  +A+ F + A  C +     D   C+ N F+ +  +L   Y ++ ++
Sbjct: 1   MKKKSLLVCCALAALAVPFAAHAAGCAKPRSAFDQVYCSSNEFSQLDRELNDQYGRLRKQ 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +   Q+   +  Q+AW   R   C+             ++   C       R   L  
Sbjct: 61  LSGDQQAKLKSGQLAWMKQRDDRCSEKRDDGY------LVNLQCAIDATQSRLSFLRE 112


>gi|49078032|gb|AAT49744.1| PA3021 [synthetic construct]
          Length = 129

 Score = 66.8 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNDGQKTLLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDNGY------FVNLDCATEKTRQRLDFLRE 113


>gi|304397311|ref|ZP_07379190.1| protein of unknown function DUF1311 [Pantoea sp. aB]
 gi|304355460|gb|EFM19828.1| protein of unknown function DUF1311 [Pantoea sp. aB]
          Length = 132

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 49/130 (37%), Gaps = 14/130 (10%)

Query: 1   MCR--KIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R  K++     ++++  ++A   C +      + QCT     L ++ L   Y+   ++
Sbjct: 1   MKRISKLVLIGVSLSVSASAIADETCAKQPSDGTLFQCTVQQKTLAEDDLNKAYQTAKKR 60

Query: 58  ----------VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN-CLQGHA 106
                     +          +Q  W  YR  +C   A  AEEG+  S +  N C+    
Sbjct: 61  IVQMYGTQKKLADDYVATLVDTQRNWLKYRDGQCRLEAFAAEEGSNASAVATNLCVIRID 120

Query: 107 IERNEKLESY 116
            ER   L+  
Sbjct: 121 KERIALLKQL 130


>gi|168211487|ref|ZP_02637112.1| putative lipoprotein [Clostridium perfringens B str. ATCC 3626]
 gi|170710505|gb|EDT22687.1| putative lipoprotein [Clostridium perfringens B str. ATCC 3626]
          Length = 258

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 37/89 (41%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           E   Q  MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  A  
Sbjct: 164 EGSTQMGMNIISGKQAKLYDAELNEIYDYLKQNLSKEKAKELEKSEMAWIKEKESNIAEI 223

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               E G+   ++  + +   + ER   L
Sbjct: 224 RKQYEGGSITPLMVNSEVAKESKERCYYL 252


>gi|168216184|ref|ZP_02641809.1| putative lipoprotein [Clostridium perfringens NCTC 8239]
 gi|182381795|gb|EDT79274.1| putative lipoprotein [Clostridium perfringens NCTC 8239]
          Length = 258

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 37/89 (41%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           E   Q  MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  A  
Sbjct: 164 EGSTQMGMNIISGKQAKLYDAELNEIYDYLKQNLSKEKAKELEKSEMAWIKEKESNIAEI 223

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               E G+   ++  + +   + ER   L
Sbjct: 224 RKQYEGGSVTPLMVNSEVAKESKERCYYL 252


>gi|169346827|ref|ZP_02865775.1| putative lipoprotein [Clostridium perfringens C str. JGS1495]
 gi|169296886|gb|EDS79010.1| putative lipoprotein [Clostridium perfringens C str. JGS1495]
          Length = 253

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 37/89 (41%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           E   Q  MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  A  
Sbjct: 159 EGSTQMGMNIISGKQAKLYDAELNQIYDYLKQNLSKEKSKELEKSEMAWIKEKESNIAEI 218

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               E G+   ++  + +   + ER   L
Sbjct: 219 KKQYEGGSVTPLMVNSEVAKESKERCYYL 247


>gi|107102571|ref|ZP_01366489.1| hypothetical protein PaerPA_01003635 [Pseudomonas aeruginosa PACS2]
 gi|254235994|ref|ZP_04929317.1| hypothetical protein PACG_01950 [Pseudomonas aeruginosa C3719]
 gi|254241724|ref|ZP_04935046.1| hypothetical protein PA2G_02435 [Pseudomonas aeruginosa 2192]
 gi|126167925|gb|EAZ53436.1| hypothetical protein PACG_01950 [Pseudomonas aeruginosa C3719]
 gi|126195102|gb|EAZ59165.1| hypothetical protein PA2G_02435 [Pseudomonas aeruginosa 2192]
          Length = 128

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNDGQKALLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDNGY------FVNLDCATEKTRQRLDFLRE 113


>gi|116051022|ref|YP_790151.1| hypothetical protein PA14_24990 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313108313|ref|ZP_07794345.1| hypothetical protein PA39016_001330039 [Pseudomonas aeruginosa
           39016]
 gi|115586243|gb|ABJ12258.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310880847|gb|EFQ39441.1| hypothetical protein PA39016_001330039 [Pseudomonas aeruginosa
           39016]
          Length = 128

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNDGQKALLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDNGY------FVNLDCATEKTRQRLDFLRE 113


>gi|15598217|ref|NP_251711.1| hypothetical protein PA3021 [Pseudomonas aeruginosa PAO1]
 gi|9949124|gb|AAG06409.1|AE004727_5 hypothetical protein PA3021 [Pseudomonas aeruginosa PAO1]
          Length = 128

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNDGQKTLLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDNGY------FVNLDCATEKTRQRLDFLRE 113


>gi|168212418|ref|ZP_02638043.1| putative lipoprotein [Clostridium perfringens CPE str. F4969]
 gi|170715914|gb|EDT28096.1| putative lipoprotein [Clostridium perfringens CPE str. F4969]
          Length = 258

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 39/92 (42%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           + N    QA MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  
Sbjct: 161 DSNRGSTQAGMNGISGEQAKLYDNELNQIYDYLKQNLSKEKAKELEKSEMAWIKEKESNI 220

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           A      E G+   ++  + +   + ER   L
Sbjct: 221 AEIRKQYEGGSITPLMVNSEVAKESKERCYYL 252


>gi|107025826|ref|YP_623337.1| hypothetical protein Bcen_3470 [Burkholderia cenocepacia AU 1054]
 gi|116692990|ref|YP_838523.1| hypothetical protein Bcen2424_4896 [Burkholderia cenocepacia
           HI2424]
 gi|105895200|gb|ABF78364.1| protein of unknown function DUF1311 [Burkholderia cenocepacia AU
           1054]
 gi|116650990|gb|ABK11630.1| protein of unknown function DUF1311 [Burkholderia cenocepacia
           HI2424]
          Length = 129

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 35/102 (34%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F   A  C +     D   CT   F+     L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAGHAAGCGKPRSAFDQVYCTSTQFSQSDRDLNDEYGRLRKQLSGDQQATLKTGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C    S     +   ++   C       R   L  
Sbjct: 77  LKQRDAQC----SETRGSSY--LVDIQCANDMTQSRLSFLRE 112


>gi|310765177|gb|ADP10127.1| hypothetical protein EJP617_04460 [Erwinia sp. Ejp617]
          Length = 125

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 44/123 (35%), Gaps = 11/123 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALN---------CNETLM--QADMNQCTGNSFALVKEKLEAT 50
            +  I A  ++  +F   A           C +        M  C  +   +  ++L   
Sbjct: 1   MKLFIAAFIVLLFSFTVQAKEGAYSDSYNQCMDKADGVTVSMRHCYVDEIIVQDKRLNDN 60

Query: 51  YKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           Y+K +  +    ++ F  +Q     +R ++C   AS    GT  ++I  +C      +R 
Sbjct: 61  YRKFISTMSADVKKNFIDAQRQGVKFRDADCHAFASLEAGGTLSAVIADSCYLKMTAQRA 120

Query: 111 EKL 113
           +  
Sbjct: 121 DDF 123


>gi|110798657|ref|YP_695444.1| putative lipoprotein [Clostridium perfringens ATCC 13124]
 gi|110673304|gb|ABG82291.1| putative lipoprotein [Clostridium perfringens ATCC 13124]
          Length = 258

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 37/89 (41%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           E   Q  MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  A  
Sbjct: 164 EGSTQMGMNIISGKQAKLYDAELNQIYDYLKQNLSKEKSKELEKSEMAWIKEKESNIAEI 223

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               E G+   ++  + +   + ER   L
Sbjct: 224 KKQYEGGSVTPLMVNSEVAKESKERCYYL 252


>gi|90577411|ref|ZP_01233222.1| hypothetical protein VAS14_10209 [Vibrio angustum S14]
 gi|90440497|gb|EAS65677.1| hypothetical protein VAS14_10209 [Vibrio angustum S14]
          Length = 141

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 46/116 (39%), Gaps = 4/116 (3%)

Query: 1   MCR--KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE-- 56
           M +   IIF             L+C+      ++N C   +    +E+L       +E  
Sbjct: 1   MKKYWLIIFVCLSFPSFAAKKVLDCDNPRNTLEINDCASLTLTSAQEELSKYLAASVEHN 60

Query: 57  KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
           K +    +  EK+Q  WE+Y  ++C    +   EGT ++++  +C      ER   
Sbjct: 61  KKDPELVKAIEKAQKDWEVYMKAQCNAVYTQWREGTIRNVMALDCKTQLTKERTHD 116


>gi|325527862|gb|EGD05124.1| hypothetical protein B1M_07992 [Burkholderia sp. TJI49]
          Length = 129

 Score = 66.1 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 37/102 (36%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   C+   F+    +L   Y ++ +++   Q+   +  Q+AW
Sbjct: 17  VPFAAHAAGCAKPHSAFDQVYCSSTQFSQSDRELNDEYGRLRKQLSGDQQAALKAGQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R ++C+   +         ++   C       R   L  
Sbjct: 77  LKQRDAQCSETRNNGY------LVDLQCATDMTQSRLSFLRE 112


>gi|134294050|ref|YP_001117786.1| hypothetical protein Bcep1808_5374 [Burkholderia vietnamiensis G4]
 gi|134137207|gb|ABO58321.1| protein of unknown function DUF1311 [Burkholderia vietnamiensis G4]
          Length = 129

 Score = 66.1 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 44/118 (37%), Gaps = 9/118 (7%)

Query: 1   MCRKIIFA---LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +K + A   L  +A+ F + A  C +     D   C+ N F+ +  +L   Y ++ ++
Sbjct: 1   MKKKNLLASCALFALAVPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDEYGRLRKQ 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           +   Q+   +  Q+AW   R   C+             ++   C       R   L  
Sbjct: 61  LSGDQQAKLKSGQLAWMKQRDDRCSETRDDGY------LVNLQCAIDATQSRLTFLRE 112


>gi|312878941|ref|ZP_07738741.1| protein of unknown function DUF1311 [Aminomonas paucivorans DSM
           12260]
 gi|310782232|gb|EFQ22630.1| protein of unknown function DUF1311 [Aminomonas paucivorans DSM
           12260]
          Length = 144

 Score = 66.1 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 36/107 (33%), Gaps = 11/107 (10%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
           +A + +        N+           +L   YK ++ ++    R+  + SQ  W  YR 
Sbjct: 37  LARDSSTAGTVEASNRAAA----KWDRELNRVYKALMAQMGPEARQKLQASQRRWLAYRD 92

Query: 79  SECAFAAS-------GAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +E     +         E GT   M+ A         R  +L  YL 
Sbjct: 93  AERTAVGAMAGDLYEQNEGGTLWGMVAAVRSMEILRARALELTEYLD 139


>gi|163742502|ref|ZP_02149888.1| hypothetical protein RG210_06434 [Phaeobacter gallaeciensis 2.10]
 gi|161384087|gb|EDQ08470.1| hypothetical protein RG210_06434 [Phaeobacter gallaeciensis 2.10]
          Length = 136

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 29/100 (29%), Gaps = 8/100 (8%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK--------HQRELFEKSQMAW 73
            C  T  Q ++  C           L        E                  E +Q +W
Sbjct: 32  ECGGTGSQIELRDCLNGDQIRANAALSRALDYAREAAADLDGITGRQSASPALETAQKSW 91

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           E +R + C F  +    G+   +   +C      +R E L
Sbjct: 92  EAFRDAHCDFVGATFGGGSGTGIAILSCRITLTRDRVEAL 131


>gi|254440143|ref|ZP_05053637.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 307]
 gi|198255589|gb|EDY79903.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 307]
          Length = 174

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 33/100 (33%), Gaps = 13/100 (13%)

Query: 28  MQADMNQCTGNSFALVKEKLEATY---KKVLEKVEKH----------QRELFEKSQMAWE 74
               M  CT   +      L   Y      + +++            + +    +Q AW 
Sbjct: 67  TTVGMMFCTLAEYEAWDRLLNRDYGPMMDGMRRLDAEDAEFFPEFANRADALRDAQRAWI 126

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             R ++CA   +    G+ + +  A+CL     +R   L 
Sbjct: 127 PLRDAQCALEYAMWGGGSMRQIAGASCLLDLTAKRTIYLR 166


>gi|75910212|ref|YP_324508.1| hypothetical protein Ava_4008 [Anabaena variabilis ATCC 29413]
 gi|75703937|gb|ABA23613.1| hypothetical protein Ava_4008 [Anabaena variabilis ATCC 29413]
          Length = 417

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 1/95 (1%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
           LNC +   Q  +NQC        +    + Y    E++ K  +  F  +Q  W+ YR + 
Sbjct: 255 LNCVD-ETQIGLNQCAVYWSKTTQFLQSSIYGDWAERLSKQYQPTFGIAQKYWQDYREAH 313

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           C       +EG+   M+Y  CL     +R   L+ 
Sbjct: 314 CTELVEPFQEGSMAPMLYHRCLARLNNDRIADLKG 348



 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 8/66 (12%), Positives = 21/66 (31%)

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
            Y+ V  ++    +     +  +W  ++   C              +  + CL     +R
Sbjct: 96  VYQDVESQLIPPLQNQLAIANQSWHQFQTQHCQQLTQRLRNTPDFPIATSVCLARLNNDR 155

Query: 110 NEKLES 115
             +L+ 
Sbjct: 156 ILELQR 161


>gi|152984279|ref|YP_001347509.1| hypothetical protein PSPA7_2137 [Pseudomonas aeruginosa PA7]
 gi|150959437|gb|ABR81462.1| hypothetical protein PSPA7_2137 [Pseudomonas aeruginosa PA7]
          Length = 128

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + +   Q+ L +KSQ+AW   R + C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGSLRKHLNDGQKALLKKSQIAWIKERDAACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDNGY------FVNLDCATQKTRQRLDFLRE 113


>gi|323499234|ref|ZP_08104211.1| hypothetical protein VISI1226_03410 [Vibrio sinaloensis DSM 21326]
 gi|323315622|gb|EGA68656.1| hypothetical protein VISI1226_03410 [Vibrio sinaloensis DSM 21326]
          Length = 134

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/130 (18%), Positives = 47/130 (36%), Gaps = 16/130 (12%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQAD--MN--QCTGNSFALVKEKLEATYKKVLEK 57
            +K++  LT+++    +     +   MQ    M    C          +L  TY++ + +
Sbjct: 1   MKKLLMCLTLVSAPLLAADGVEDPCNMQGGGVMAGYLCVEQKLKAADAELNKTYQQAIIR 60

Query: 58  VEKHQREL------------FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
           + + +  L            F  SQ AW  ++ +EC F    +     Q +    C    
Sbjct: 61  IREEETALRKTWSETELVEPFRASQRAWLKFKDAECEFVGLSSTPSPWQGVQIEECKLEM 120

Query: 106 AIERNEKLES 115
            +ER E  + 
Sbjct: 121 ILERIEYFKG 130


>gi|78063034|ref|YP_372942.1| hypothetical protein Bcep18194_B2187 [Burkholderia sp. 383]
 gi|77970919|gb|ABB12298.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 134

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 42/121 (34%), Gaps = 9/121 (7%)

Query: 5   IIFALTIIAIAFQSMALN------CNETLMQ---ADMNQCTGNSFALVKEKLEATYKKVL 55
           +       A+A  ++A        C         AD+  C    +     +L A YK  +
Sbjct: 13  LTAGALFCAVASSALADEAERAAICKTAEETGYTADIRNCLRLKYEAADRRLNAVYKTKM 72

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +++  +      +  W   R + CA +      GT   + + +C       R + +E+
Sbjct: 73  ANLDEQGKARLRNDERRWLKARDATCAESRQPDAGGTLGLVEHDSCFVDETERRVKVIEA 132

Query: 116 Y 116
           +
Sbjct: 133 F 133


>gi|319653791|ref|ZP_08007886.1| hypothetical protein HMPREF1013_04505 [Bacillus sp. 2_A_57_CT2]
 gi|317394517|gb|EFV75260.1| hypothetical protein HMPREF1013_04505 [Bacillus sp. 2_A_57_CT2]
          Length = 217

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 31/83 (37%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
              A++ +     +    E+L   Y  + ++++K Q +   + Q  W   R      ++ 
Sbjct: 125 TTTAELVEQEAERYRNWDEELNKIYGLLEDQLDKGQMDQLREEQRIWIQQRDEAAKKSSL 184

Query: 87  GAEEGTAQSMIYANCLQGHAIER 109
             + G+ + + Y         ER
Sbjct: 185 KYKGGSMEPLEYVATQASLTRER 207


>gi|262372847|ref|ZP_06066126.1| predicted protein [Acinetobacter junii SH205]
 gi|262312872|gb|EEY93957.1| predicted protein [Acinetobacter junii SH205]
          Length = 115

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +K +  LT+   +    A  C ++    +  +C       ++ +L   YKKV ++ E 
Sbjct: 1   MMKKSLLILTLAMSSEIYAAQICAKSANSFEATECLDKEVKRLRTELNTIYKKVYKQTEA 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA-NCLQGHAIERNEKLESY 116
             R+  + +Q +W  Y+  +C    S     +  +MI+  +C      +R E L+S 
Sbjct: 61  --RKELDTAQKSWSNYKDQQCGDFVSVDSGYSPSTMIFNLDCQVTLLKQRIEFLKSL 115


>gi|152982086|ref|YP_001353309.1| hypothetical protein mma_1619 [Janthinobacterium sp. Marseille]
 gi|151282163|gb|ABR90573.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 135

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 55/128 (42%), Gaps = 10/128 (7%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           M +  +  LT++ +A  +  ++ C       +MN C   +    +EKL+  YK +L+++ 
Sbjct: 1   MNKITLAFLTLLPVAAFAQQVDPCLSKGTPQEMNACAKEADQKAQEKLDTVYKALLKQIP 60

Query: 60  K---------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
                       ++    +Q  W  +   +C   +   +    + + Y +C + HA +R 
Sbjct: 61  AQDQEGIPYVATKKQLRIAQKEWSKFVEQDCKTVSIYNKGSILKDIEYFSCTRLHAEQRT 120

Query: 111 EKLESYLT 118
             LE +L+
Sbjct: 121 SDLERFLS 128


>gi|330825433|ref|YP_004388736.1| hypothetical protein Alide2_2872 [Alicycliphilus denitrificans
           K601]
 gi|329310805|gb|AEB85220.1| protein of unknown function DUF1311 [Alicycliphilus denitrificans
           K601]
          Length = 132

 Score = 65.3 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 39/113 (34%), Gaps = 1/113 (0%)

Query: 10  TIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
            +   A  + A   C       + N C    +      L+  Y  V+  +  H+R    +
Sbjct: 14  CLGGTAAWAQAGGACRPGGSVEETNACAVRDYQEADTALQILYGDVMRALSAHERPALRQ 73

Query: 69  SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
              AW+  R ++C  A    E+      +Y  CL      R + L  +L   E
Sbjct: 74  DHQAWQRARITQCKQAQRAQEQRPEWPRLYHECLVAQTRARRQALMHWLHHGE 126


>gi|160899129|ref|YP_001564711.1| hypothetical protein Daci_3694 [Delftia acidovorans SPH-1]
 gi|160364713|gb|ABX36326.1| protein of unknown function DUF1311 [Delftia acidovorans SPH-1]
          Length = 133

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 37/97 (38%), Gaps = 1/97 (1%)

Query: 23  CNETLMQA-DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           C+     A   N C   +F      L   Y  V++++ + +R      Q  W   R + C
Sbjct: 36  CDPASTAAASRNACAVQAFQEADTALNIRYLDVMQQLPQGKRTGLRHDQNGWIKGRTARC 95

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             A   +E       +Y +CL     ER + LE +L 
Sbjct: 96  KAATRDSETQPEGPRLYHDCLTAATQERMQALERWLQ 132


>gi|168204972|ref|ZP_02630977.1| putative lipoprotein [Clostridium perfringens E str. JGS1987]
 gi|170663448|gb|EDT16131.1| putative lipoprotein [Clostridium perfringens E str. JGS1987]
          Length = 258

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 37/89 (41%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           E   Q  MN  +G    L   +L   Y  + + + K + +  EK++MAW   + S  A  
Sbjct: 164 EGSTQMGMNIISGKQAKLYDAELNEIYDYLKQNLSKEKSKELEKNEMAWIKEKESNIAEI 223

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL 113
               E G+   ++  + +   + ER   L
Sbjct: 224 RKQYEGGSITPLMVNSEVAKESKERCYYL 252


>gi|296388484|ref|ZP_06877959.1| hypothetical protein PaerPAb_10051 [Pseudomonas aeruginosa PAb1]
          Length = 128

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       D   C    F+    +L   +  + + + + Q+ L +KSQ+AW   R   C+
Sbjct: 27  CGTPRNAFDSVYCRSGEFSQADRELNQQFGTLRKHLNEGQKALLKKSQIAWIKERDEACS 86

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +            +  +C      +R + L  
Sbjct: 87  ESKDNGY------FVNLDCATEKTRQRLDFLRE 113


>gi|302878718|ref|YP_003847282.1| hypothetical protein Galf_1499 [Gallionella capsiferriformans ES-2]
 gi|302581507|gb|ADL55518.1| hypothetical protein Galf_1499 [Gallionella capsiferriformans ES-2]
          Length = 130

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 43  VKEKLEATYKKVLEKVE----KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY 98
             + L   Y+ ++  +     +  ++    +Q AW I+R  EC F +     G+   +  
Sbjct: 50  ADKDLNDAYRNLMTVMNKPAWREAKKKLIAAQRAWIIFRDRECEF-SQELIGGSNH-VNQ 107

Query: 99  ANCLQGHAIERNEKLESY 116
           + C+     +R E ++S 
Sbjct: 108 SECIADMTEKRAEYIKSL 125


>gi|251781148|ref|ZP_04824068.1| putative liporotein [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243085463|gb|EES51353.1| putative liporotein [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 217

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 33/93 (35%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
               +M       +      L   Y  + +++        +  ++ W   R  +    + 
Sbjct: 125 GSTLEMKSAAKEEYERWDRALNEIYGVLQKQLSSDDMNKLKDEEIKWIAARDEQAKKDSL 184

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
             + GTA+++IY   L     ER  +L E Y+ 
Sbjct: 185 QYKGGTAETLIYGMSLGQSTKERCYELVEKYMK 217


>gi|121594364|ref|YP_986260.1| hypothetical protein Ajs_2008 [Acidovorax sp. JS42]
 gi|120606444|gb|ABM42184.1| protein of unknown function DUF1311 [Acidovorax sp. JS42]
          Length = 142

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 37/99 (37%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       + N C    +       +  Y  V+  +  H+R    + Q AW+  R ++C 
Sbjct: 35  CRPGGTVDETNACAVQRYQEADTATQILYGDVMRALSAHERPALRQDQAAWQRTRAAQCK 94

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            A   AE       +Y +CL  H   R + L  +L   E
Sbjct: 95  QAQRAAESRPEWPRLYHDCLTVHTQARRDALMHWLHHGE 133


>gi|182624999|ref|ZP_02952777.1| putative lipoprotein [Clostridium perfringens D str. JGS1721]
 gi|177909796|gb|EDT72214.1| putative lipoprotein [Clostridium perfringens D str. JGS1721]
          Length = 258

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 39/92 (42%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           + N    QA MN  +G    L   +L   Y  + + + K + +  EKS+MAW   + S  
Sbjct: 161 DSNRGSTQAGMNGISGEQAKLYDNELNKIYDYLKQNLSKEKAKELEKSEMAWIKEKESNI 220

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           A      E G+   ++  + +   + ER   L
Sbjct: 221 AEIKKQYEGGSVTPLMVNSEVAKESKERCYYL 252


>gi|241766505|ref|ZP_04764371.1| protein of unknown function DUF1311 [Acidovorax delafieldii 2AN]
 gi|241363275|gb|EER58825.1| protein of unknown function DUF1311 [Acidovorax delafieldii 2AN]
          Length = 138

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 40/113 (35%), Gaps = 1/113 (0%)

Query: 6   IFALTIIAIAFQSMA-LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +  + +      + A   C       + N C   +F     ++   Y  V+  +  H+R 
Sbjct: 17  VACVMLAGTHAHAQAGAACKPGGSVDETNACAVQAFQAADTQMAILYGDVMRALSAHERP 76

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
              + Q AW+  R + C  A   AE       +Y  CL      R + L  +L
Sbjct: 77  QLRQEQTAWQRERTTRCKQATRNAESAPHGPRLYHECLAAETQARRKDLMRWL 129


>gi|170724057|ref|YP_001751745.1| hypothetical protein PputW619_4900 [Pseudomonas putida W619]
 gi|169762060|gb|ACA75376.1| protein of unknown function DUF1311 [Pseudomonas putida W619]
          Length = 138

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 50/123 (40%), Gaps = 7/123 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
           M   ++ A+   A A +  +  C+          C   +    + +L + Y  +++++  
Sbjct: 4   MAWLVLLAIVSGAQAGEEESTPCDNVETDQQTFACAAFNKQTAERELNSAYDDLIQRMLD 63

Query: 59  ----EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
               E   +   E ++  W   R ++C     G + G+ A  + + +C+   + ER+E L
Sbjct: 64  QYGDEAGLQSQIESARKVWAQLRDADCKVETYGEQAGSKAFQIAWNSCIAQRSDERSEYL 123

Query: 114 ESY 116
            S 
Sbjct: 124 RSL 126


>gi|146305153|ref|YP_001185618.1| hypothetical protein Pmen_0112 [Pseudomonas mendocina ymp]
 gi|145573354|gb|ABP82886.1| protein of unknown function DUF1311 [Pseudomonas mendocina ymp]
          Length = 136

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 44/121 (36%), Gaps = 12/121 (9%)

Query: 6   IFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
            F L     A   ++  +C        + QC   +     + L + Y+  L+++    R+
Sbjct: 10  FFLLFFTFPALSDAIQKSCEVIEDSQQVAQCAEYAKGQSDKLLNSAYRAALDRIRHQYRQ 69

Query: 65  ----------LFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKL 113
                     L   +Q  W   R ++C   A   EE   A  +   NCL   + +R + L
Sbjct: 70  APLMADQYISLLRGAQREWIKLRDADCKLEAFEIEETAEAYQVTINNCLARMSNDRADYL 129

Query: 114 E 114
           +
Sbjct: 130 K 130


>gi|325496982|gb|EGC94841.1| hypothetical protein ECD227_1079 [Escherichia fergusonii ECD227]
          Length = 135

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 35/107 (32%), Gaps = 28/107 (26%)

Query: 34  QCTGNSFALVKEKLEATYKKVL----------------EKVEKHQRELFEKSQMAWEIYR 77
            C    + L   KL   Y  V                 +K++  Q  L ++SQ AW  +R
Sbjct: 20  TCMKQEYQLADAKLNKVYGDVYRYIELVPRAWWNKGEKDKIDVEQLNLLKESQRAWINFR 79

Query: 78  GSECAFAASGAEEGTAQSMIYA--------NCLQGHAIERNEKLESY 116
             EC    S  ++      +           C+      R  +L+SY
Sbjct: 80  DKECTLVISSEDD----PKLTNPYAEVEWLKCMTLQTNTRIRQLQSY 122


>gi|327394306|dbj|BAK11728.1| hypothetical protein PAJ_1648 [Pantoea ananatis AJ13355]
          Length = 268

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 45/128 (35%), Gaps = 17/128 (13%)

Query: 5   IIFALTIIAIAFQSMALN---------------C--NETLMQADMNQCTGNSFALVKEKL 47
           +IF+L++  I+  S A                 C    +     ++ C  N       +L
Sbjct: 29  LIFSLSVFLISSTSKANEKNHVTLNDEGRIFLVCLSKSSATNEKLSNCYRNEIKRQDARL 88

Query: 48  EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAI 107
              Y+  L    +  R+ + ++Q  W  YR + C    + A    A+ +    C     I
Sbjct: 89  NQNYQHFLATRREDARQRYVEAQRQWVKYRDTNCNAQIANAANEDAELIAGDRCYLKMTI 148

Query: 108 ERNEKLES 115
            R ++L  
Sbjct: 149 NRADELAP 156


>gi|331092245|ref|ZP_08341073.1| hypothetical protein HMPREF9477_01716 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330401677|gb|EGG81256.1| hypothetical protein HMPREF9477_01716 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 145

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 38/95 (40%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++T  Q +MN+ +   + L  ++L   +K + E++   +     + Q  W   +      
Sbjct: 51  SDTATQMEMNEYSEQLYKLWDDELNRLWKVLKEELSSTEMAKLLEEQRTWIAEKEKAINE 110

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
               +  GTA +M      +    +R  +L  YL 
Sbjct: 111 IGEISGGGTATTMNKNMTGEDLTRKRVYELLEYLP 145


>gi|84686415|ref|ZP_01014309.1| hypothetical protein 1099457000216_RB2654_01190 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665598|gb|EAQ12074.1| hypothetical protein RB2654_01190 [Rhodobacterales bacterium
           HTCC2654]
          Length = 162

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 33/94 (35%), Gaps = 9/94 (9%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQR---------ELFEKSQMAWEIYRGSECAFA 84
            C    +     +L A Y  + E++    +         +    +Q AW  +R + CAF 
Sbjct: 67  ACIWAEYEDWDAELNALYGPLRERLANDDKVNEMPVSTSDALRDAQRAWIPWRDAACAFE 126

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            S    GT      A CL     ER   L + L 
Sbjct: 127 RSKWGGGTGGGPAEAGCLMQMTAERALSLRNELE 160


>gi|221066512|ref|ZP_03542617.1| protein of unknown function DUF1311 [Comamonas testosteroni KF-1]
 gi|220711535|gb|EED66903.1| protein of unknown function DUF1311 [Comamonas testosteroni KF-1]
          Length = 163

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 38/118 (32%), Gaps = 5/118 (4%)

Query: 6   IFALTIIAIAFQSMAL-----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           + A   IA +    AL     +C         N C    F       +  Y  V+  +  
Sbjct: 41  LLAALFIAASLSQQALAQAGADCVPGGTTTQTNACAIKDFQQADTDHQILYGDVMRALSA 100

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           H+R    K Q  W   R ++C  A    E        Y  CL      R+  L+ +L 
Sbjct: 101 HERPALRKEQGEWSRQRITQCKQATKAFEAQPDWPSRYHGCLVQQITARDATLKRWLH 158


>gi|188590029|ref|YP_001921878.1| putative lipoprotein [Clostridium botulinum E3 str. Alaska E43]
 gi|188500310|gb|ACD53446.1| putative lipoprotein [Clostridium botulinum E3 str. Alaska E43]
          Length = 218

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 33/93 (35%), Gaps = 1/93 (1%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
               +M       +      L   Y  + +++        +  ++ W   R  +    + 
Sbjct: 125 GSTLEMKSAAKEEYERWDRALNEIYGVLQKQLSSDDMNKLKDEEIKWIASRDEQAKKDSL 184

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
             + GTA+++IY   L     ER  +L E Y+ 
Sbjct: 185 KYKGGTAETLIYGMSLGQSTKERCYELVEKYMK 217


>gi|222111005|ref|YP_002553269.1| hypothetical protein Dtpsy_1812 [Acidovorax ebreus TPSY]
 gi|221730449|gb|ACM33269.1| protein of unknown function DUF1311 [Acidovorax ebreus TPSY]
          Length = 142

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 37/99 (37%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       + N C    +       +  Y  V+  +  H+R    + Q AW+  R ++C 
Sbjct: 35  CRPGGTVDETNACAVQRYQEADTATQILYGDVMRALSAHERPTLRQDQAAWQRTRAAQCK 94

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            A   AE       +Y +CL  H   R + L  +L   E
Sbjct: 95  QAQRAAESRPEWPRLYHDCLTVHTQARRDALMHWLHHGE 133


>gi|222081857|ref|YP_002541222.1| urease-associated protein [Agrobacterium radiobacter K84]
 gi|221726536|gb|ACM29625.1| urease-associated protein [Agrobacterium radiobacter K84]
          Length = 179

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 34/97 (35%), Gaps = 4/97 (4%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
                 D   C   + A   +++   Y  +L+++     +  + +Q +W  YR  E    
Sbjct: 77  NNGSTGDQTACETKALASYDKRMNLAYSTLLKELSPPAAQDLKTAQRSWIAYRDLEAKAR 136

Query: 85  AS--GAEEGTAQ-SMIYANCLQGHAIERNEKLESYLT 118
            S     +G+    M     +     ER   LE Y+ 
Sbjct: 137 ESFFETRKGSMYAPMEVDAEVA-LTKERALLLERYVR 172


>gi|294677048|ref|YP_003577663.1| hypothetical protein RCAP_rcc01511 [Rhodobacter capsulatus SB 1003]
 gi|294475868|gb|ADE85256.1| protein of unknown function DUF1311 [Rhodobacter capsulatus SB
           1003]
          Length = 167

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 34/98 (34%), Gaps = 3/98 (3%)

Query: 20  ALNCNETLMQA--DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQMAWEIY 76
           A  C         D   C     A     L A YK    ++      E  + +Q AW  Y
Sbjct: 64  AQGCTAAATDTTRDTIACIEAETAAWDGLLNAEYKARRAEMTAPGLAERLQNAQRAWIAY 123

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           R +EC   ++   + T   ++ ANC       R  +L 
Sbjct: 124 RDAECGLESARWGDATLAGVVGANCRMEMTATRASELR 161


>gi|78061663|ref|YP_371571.1| hypothetical protein Bcep18194_B0813 [Burkholderia sp. 383]
 gi|77969548|gb|ABB10927.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 129

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 35/101 (34%), Gaps = 6/101 (5%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
            F + A  C +     D   C+   F+     L   Y ++ +++   Q+   +  Q+AW 
Sbjct: 18  PFTAHAAGCAKPHSAFDQVYCSSTQFSQTDRDLNDEYGRLRKQLSSDQQATLKTGQLAWL 77

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R ++C+   +         ++   C       R   L  
Sbjct: 78  KQRDAQCSETRNNGY------LVDLQCATDMTQSRLSFLRE 112


>gi|24113255|ref|NP_707765.1| hypothetical protein SF1918 [Shigella flexneri 2a str. 301]
 gi|110805850|ref|YP_689370.1| hypothetical protein SFV_1915 [Shigella flexneri 5 str. 8401]
 gi|24052257|gb|AAN43472.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110615398|gb|ABF04065.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281601318|gb|ADA74302.1| hypothetical protein SFxv_2142 [Shigella flexneri 2002017]
 gi|332757295|gb|EGJ87632.1| hypothetical protein SF274771_2289 [Shigella flexneri 2747-71]
 gi|332757428|gb|EGJ87763.1| hypothetical protein SFK671_2332 [Shigella flexneri K-671]
 gi|333003278|gb|EGK22824.1| hypothetical protein SFK218_2722 [Shigella flexneri K-218]
 gi|333017607|gb|EGK36919.1| hypothetical protein SFK304_2481 [Shigella flexneri K-304]
          Length = 162

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN----------------CNETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +                   +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDTSAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K++  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGAKKLDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|300715066|ref|YP_003739869.1| conserved uncharacterized protein [Erwinia billingiae Eb661]
 gi|299060902|emb|CAX58009.1| conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 133

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 42/132 (31%), Gaps = 9/132 (6%)

Query: 1   MCRKIIFALTIIAIAFQS-------MALNC-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M + I     ++A    +           C ++      M QC   +      ++   Y 
Sbjct: 1   MKKTIAITGLLMAFYGHADVSPIDTAQQQCLDKASTTVAMQQCFSAANQAWDSEMNQQYG 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG-AEEGTAQSMIYANCLQGHAIERNE 111
           K+   +   Q+     +Q AW  YR S      +  ++ GT  S+            +  
Sbjct: 61  KLTATLNSEQKAKLRTAQRAWLKYRDSWLDATKARLSDGGTMASLQVGAQSVSLVKNQAL 120

Query: 112 KLESYLTCPEGD 123
            L+S      G+
Sbjct: 121 ALKSLADGNSGN 132


>gi|241664831|ref|YP_002983191.1| hypothetical protein Rpic12D_3253 [Ralstonia pickettii 12D]
 gi|240866858|gb|ACS64519.1| protein of unknown function DUF1311 [Ralstonia pickettii 12D]
          Length = 153

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 36/92 (39%), Gaps = 2/92 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE--CAFA 84
              A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++     A
Sbjct: 60  ETTAGMTECTHAAYQAYDRQMNTLYQAVMSKSDPVSREAIRNAQRAWLAYRNAQKAADNA 119

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
              A+ G+  S             R  +LE Y
Sbjct: 120 PWRADAGSVASPDIEGLNVEAIRARIAELEYY 151


>gi|167590292|ref|ZP_02382680.1| hypothetical protein BuboB_33462 [Burkholderia ubonensis Bu]
          Length = 129

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 47/129 (36%), Gaps = 15/129 (11%)

Query: 1   MCRKII---FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M + ++    AL  +A+ F + A  C +     D   C+   F+ +  +L   Y ++ ++
Sbjct: 1   MKKHLLAASCALFALAVPFAAHAAGCAKPRGAFDQVYCSSTQFSQLDRELNDQYGRLRKQ 60

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +   Q+   +  Q+AW   R  +C    S   +      +   C       R   L    
Sbjct: 61  LSGDQQASLKTGQLAWLKQRDDKC----STTRDDGYY--VNLECAIDMTQSRLSFLR--- 111

Query: 118 TCPEGDLLC 126
              E D  C
Sbjct: 112 ---ERDREC 117


>gi|110802017|ref|YP_698210.1| putative lipoprotein [Clostridium perfringens SM101]
 gi|110682518|gb|ABG85888.1| putative lipoprotein [Clostridium perfringens SM101]
          Length = 258

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 41/92 (44%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           + N    QA MN  +G    L  ++L   Y  + + + K + +  EKS+MAW   + ++ 
Sbjct: 161 DSNRGSTQAGMNGISGEQAKLYDDELNEIYDYLKQNLSKEKAKELEKSEMAWIKEKENKI 220

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           A      E G+   ++  + +   + ER   L
Sbjct: 221 AEIKKQYEGGSITPLMVNSEVAKESKERCYYL 252


>gi|153872634|ref|ZP_02001469.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
 gi|152070895|gb|EDN68526.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
          Length = 366

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 39/110 (35%), Gaps = 13/110 (11%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
             II+    + + NC++         C+        E+L   YK++   + K + +  +K
Sbjct: 24  FLIISPPIAAASFNCSKAHTVIKKTICSNTQLNKADEQLGKIYKQLRNSLPKWKFDTIKK 83

Query: 69  SQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            Q  W   R   C+       +G         CLQ     R  +L + + 
Sbjct: 84  EQRQWLKQRNFNCS-------DGNVY------CLQSMNELRIIELRAEIE 120



 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 40/100 (40%), Gaps = 13/100 (13%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A QS + +C +     + + C  N  +LV  ++   Y ++ + + + + +L  + Q  W 
Sbjct: 123 AIQSPSFDCAKARTVVEKSICRNNQLSLVDSEMGEIYSQLRQVLPRWEFDLLRREQRHWL 182

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             R   C+       +G        +CLQ     R  +L 
Sbjct: 183 KQRNFNCS-------DGDI------SCLQSIYERRITELR 209


>gi|319763239|ref|YP_004127176.1| hypothetical protein Alide_2556 [Alicycliphilus denitrificans BC]
 gi|317117800|gb|ADV00289.1| hypothetical protein Alide_2556 [Alicycliphilus denitrificans BC]
          Length = 132

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 36/99 (36%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C       + N C    +      L+  Y  V+  +  H+R    +  +AW+  R ++C 
Sbjct: 28  CRPGGSVEETNACAVRDYQEADTALQILYGDVMRALSAHERPALRQDHLAWQRARITQCK 87

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
            A    E+      +Y  CL      R + L  +L   E
Sbjct: 88  QAQRAQEQRPEWPRLYHECLVAQTRARRQALMHWLHHGE 126


>gi|194429338|ref|ZP_03061864.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194412645|gb|EDX28941.1| conserved hypothetical protein [Escherichia coli B171]
          Length = 162

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKTDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|304396926|ref|ZP_07378806.1| protein of unknown function DUF1311 [Pantoea sp. aB]
 gi|304355722|gb|EFM20089.1| protein of unknown function DUF1311 [Pantoea sp. aB]
          Length = 136

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 47/122 (38%), Gaps = 11/122 (9%)

Query: 1   MCRKIIFALTIIA-------IAFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M   +   L  ++       I   +    C N       MNQC   +  +  + +   Y 
Sbjct: 1   MKPGLFLMLICLSTSALAEDIPSDASPDRCLNNASTTLAMNQCYAAASKVWDQAMNKQYN 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG-AEEGTAQSMIYANCLQGHAIERNE 111
           K+++ +    +     +Q AW  YR S    + S  + +GT  S+  +   Q  ++ RN+
Sbjct: 61  KLMKTLSGEPKNKLRAAQRAWLSYRDSWLEASRSQLSSQGTLGSVALSA--QSLSLVRNQ 118

Query: 112 KL 113
            L
Sbjct: 119 AL 120


>gi|312963514|ref|ZP_07777996.1| hypothetical protein PFWH6_5438 [Pseudomonas fluorescens WH6]
 gi|311282320|gb|EFQ60919.1| hypothetical protein PFWH6_5438 [Pseudomonas fluorescens WH6]
          Length = 133

 Score = 63.8 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 51/129 (39%), Gaps = 15/129 (11%)

Query: 2   CRKIIFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + I  AL +IA    +        C+         +C   +    ++ L+  Y+ +LE+
Sbjct: 1   MKSIFLALALIATGVHAAEDTDSTPCDGIENDKQTLECASYNKTTAEQLLKDNYQALLER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           +                  + +Q  WE  R ++CA     A  GT A ++   +CL   +
Sbjct: 61  MGSTYGHDKTKLADITARLKDAQQKWEKLRDADCAVDTFPAVTGTKAYAIAQNDCLARMS 120

Query: 107 IERNEKLES 115
            ER+E LES
Sbjct: 121 DERSEFLES 129


>gi|309780362|ref|ZP_07675113.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308921065|gb|EFP66711.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 153

 Score = 63.4 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 36/92 (39%), Gaps = 2/92 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE--CAFA 84
              A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++     A
Sbjct: 60  ETTAGMTECTHAAYQAYDRQMNTLYQAVMSKTDPVSREAIRNAQRAWLAYRTAQKAADNA 119

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
              A+ G+  S             R  +LE Y
Sbjct: 120 PWRADAGSVASPDIEGLNVEAIRARIAELEYY 151


>gi|114707530|ref|ZP_01440426.1| hypothetical protein FP2506_11692 [Fulvimarina pelagi HTCC2506]
 gi|114537089|gb|EAU40217.1| hypothetical protein FP2506_11692 [Fulvimarina pelagi HTCC2506]
          Length = 169

 Score = 63.4 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 36/114 (31%), Gaps = 16/114 (14%)

Query: 18  SMALNC---NETLMQADMNQCTGNSFALVKEKLEATYKK-------------VLEKVEKH 61
           + A  C   +E      M  C           L   Y+              V    +  
Sbjct: 53  AYADACMDTSEGQTTLGMTNCVRAESDAWDAILNENYQASMTEAKAVDADRSVSSSTDSE 112

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                  +Q AW  +R +ECA      ++G+ +  + A C+     ER  +L S
Sbjct: 113 AAASLRAAQRAWITFRDAECARIFELYKDGSIRLPLTAGCVNRLTAERALELRS 166


>gi|156932436|ref|YP_001436352.1| hypothetical protein ESA_00215 [Cronobacter sakazakii ATCC BAA-894]
 gi|156530690|gb|ABU75516.1| hypothetical protein ESA_00215 [Cronobacter sakazakii ATCC BAA-894]
          Length = 141

 Score = 63.4 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 36/109 (33%), Gaps = 16/109 (14%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+      D   C           L   YK  +  +   Q+++ + +Q++W   R  ECA
Sbjct: 40  CDNPRSPYDTTYCAALEMVQGDRDLNQQYKNTMSVLSPAQKQVVKNAQISWLKVRDHECA 99

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESY------LTCPEGDLL 125
                  EG+    +   C       R   L+S         C + DL 
Sbjct: 100 -------EGS---TLLLGCANEKMAARIALLKSIERECRNAGCNDADLS 138


>gi|254454818|ref|ZP_05068255.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 238]
 gi|198269224|gb|EDY93494.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 238]
          Length = 174

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 41/120 (34%), Gaps = 14/120 (11%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK------- 60
           A  +   +   MA   +       M  CT   +      L   Y  +++ ++        
Sbjct: 48  AACVGQGSGLCMASETDGQTTVGMM-FCTLAEYEAWDRLLNRDYGPIMDGLQAMDDQDVE 106

Query: 61  ------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                 ++ +    +Q AW   R ++CA   +    G+ + +  A+CL     +R   L 
Sbjct: 107 FFPEFANRADSLRDAQRAWIPLRDTQCALEYAMWGAGSMRQIAGASCLLDLTAKRVIYLR 166


>gi|319650736|ref|ZP_08004875.1| hypothetical protein HMPREF1013_01480 [Bacillus sp. 2_A_57_CT2]
 gi|317397593|gb|EFV78292.1| hypothetical protein HMPREF1013_01480 [Bacillus sp. 2_A_57_CT2]
          Length = 218

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 35/96 (36%), Gaps = 1/96 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
            +      M +          + L   Y+ + +++ K + E     Q  W  YR      
Sbjct: 123 TDDETTIGMTKSEEEILKKWDQALNEIYQVLEKQLPKSEMEKLRGEQRKWIAYRDETAKE 182

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           AA   E GT +S+ Y     G   +R  +L E Y+ 
Sbjct: 183 AAKKYEGGTLESLEYIASQAGTTKDRCYELVEGYMK 218


>gi|229593041|ref|YP_002875160.1| hypothetical protein PFLU5667 [Pseudomonas fluorescens SBW25]
 gi|229364907|emb|CAY52989.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 133

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 51/129 (39%), Gaps = 15/129 (11%)

Query: 2   CRKIIFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + I  AL +IA    +        C+         +C   +    ++ L+  Y+ +LE+
Sbjct: 1   MKSIFLALALIATGVHAAEDTDSTPCDGIENDKQTLECASYNKTTAEQLLKDNYQGLLER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           +                  + +Q  WE  R ++CA     A  GT A ++   +CL   +
Sbjct: 61  MGSTYGSDKTKLADITARLKDAQQKWEKLRDADCAVDTFPAVNGTKAYAIAQNDCLARMS 120

Query: 107 IERNEKLES 115
            ER+E LES
Sbjct: 121 DERSEFLES 129


>gi|170699068|ref|ZP_02890124.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
 gi|171321523|ref|ZP_02910462.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
 gi|170136026|gb|EDT04298.1| protein of unknown function DUF1311 [Burkholderia ambifaria
           IOP40-10]
 gi|171093195|gb|EDT38404.1| protein of unknown function DUF1311 [Burkholderia ambifaria MEX-5]
          Length = 129

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   C+ N F+ +  +L   Y +V + +   Q+   + SQ+AW
Sbjct: 17  VPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKHLSGDQQAKLKTSQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R   C+             ++   C       R   L  
Sbjct: 77  MKQRDDRCSETRDDGY------LVNLQCAIDATQSRLSFLRE 112


>gi|172063822|ref|YP_001811473.1| hypothetical protein BamMC406_4803 [Burkholderia ambifaria MC40-6]
 gi|171996339|gb|ACB67257.1| protein of unknown function DUF1311 [Burkholderia ambifaria MC40-6]
          Length = 129

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           + F + A  C +     D   C+ N F+ +  +L   Y +V + +   Q+   + SQ+AW
Sbjct: 17  VPFAAHAAGCGKPRSAFDQVYCSSNEFSQLDRELNDQYGRVRKHLSGDQQAKLKTSQLAW 76

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R   C+             ++   C       R   L  
Sbjct: 77  MKQRDDRCSETRDDGY------LVNLQCAIDATQSRLSFLRE 112


>gi|333004492|gb|EGK24021.1| hypothetical protein SFK272_2516 [Shigella flexneri K-272]
 gi|333017866|gb|EGK37172.1| hypothetical protein SFK227_2240 [Shigella flexneri K-227]
          Length = 162

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDTSAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K++  Q  L +KSQ AW  +R  EC    S       Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGAKKLDTEQLNLLKKSQRAWLDFRDKECELILSNEV---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|295688602|ref|YP_003592295.1| hypothetical protein Cseg_1176 [Caulobacter segnis ATCC 21756]
 gi|295430505|gb|ADG09677.1| protein of unknown function DUF1311 [Caulobacter segnis ATCC 21756]
          Length = 144

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 36/98 (36%), Gaps = 7/98 (7%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-------FEKSQMAWEI 75
           C +     ++N+C   +      +++  Y+  ++++   QR           ++Q AW  
Sbjct: 18  CPDARTTVEVNECLNETLRGFDGEMKRYYEAAVKRLATEQRPPADDALSGLVRAQEAWRA 77

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           Y  +EC        EGT ++     C       R   L
Sbjct: 78  YSDAECGAVYDYWREGTIRTSFELQCSIRQTRLRTFSL 115


>gi|260599449|ref|YP_003212020.1| hypothetical protein CTU_36570 [Cronobacter turicensis z3032]
 gi|260218626|emb|CBA33925.1| hypothetical protein CTU_36570 [Cronobacter turicensis z3032]
          Length = 112

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 42/117 (35%), Gaps = 16/117 (13%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           +  + +++C+      D+  C           L   YK  +  +   Q+++ + +Q++W 
Sbjct: 3   SAAAWSMSCDNPRSPYDVTYCAALEMVQGDRDLNQQYKNTMSALSPAQKQVVKNAQISWL 62

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY------LTCPEGDLL 125
             R  ECA       EG+    +   C       R   L+S         C + DL 
Sbjct: 63  KVRDHECA-------EGS---TLLLGCANEKMAARITLLKSIERECRNAGCNDADLS 109


>gi|331677762|ref|ZP_08378437.1| conserved hypothetical protein [Escherichia coli H591]
 gi|331074222|gb|EGI45542.1| conserved hypothetical protein [Escherichia coli H591]
          Length = 169

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 11  FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 70

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 71  LNKAYGEAYLYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 127

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 128 LSDPYSESEWLSCMIIQTNTRTRQLQLYHNSED 160


>gi|209919303|ref|YP_002293387.1| hypothetical protein ECSE_2112 [Escherichia coli SE11]
 gi|293446264|ref|ZP_06662686.1| yecT protein [Escherichia coli B088]
 gi|209912562|dbj|BAG77636.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|291323094|gb|EFE62522.1| yecT protein [Escherichia coli B088]
          Length = 169

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 11  FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 70

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 71  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 127

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 128 LSDPYSESEWLSCMIIQTNTRTRQLQLYHNSED 160


>gi|262037412|ref|ZP_06010876.1| putative urease-associated protein [Leptotrichia goodfellowii
           F0264]
 gi|261748574|gb|EEY35949.1| putative urease-associated protein [Leptotrichia goodfellowii
           F0264]
          Length = 145

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 38/89 (42%), Gaps = 10/89 (11%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRE----------LFEKSQMAWEIYRGSECAFAASG 87
            ++    +++   YKK++ K+E+ +++             K+Q +W  +R +E  F+   
Sbjct: 50  KTYEAWDKEMNIVYKKLINKIEEIEKKYGEEYKGFKASLIKTQKSWVEFRDNEADFSQRP 109

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
              G+   +I A        +R  +L  Y
Sbjct: 110 FGRGSMGRVIRAGTRAEMTKDRALELAEY 138


>gi|218554465|ref|YP_002387378.1| hypothetical protein ECIAI1_1964 [Escherichia coli IAI1]
 gi|300904764|ref|ZP_07122592.1| hypothetical protein HMPREF9536_02833 [Escherichia coli MS 84-1]
 gi|301306902|ref|ZP_07212948.1| hypothetical protein HMPREF9347_05498 [Escherichia coli MS 124-1]
 gi|331668573|ref|ZP_08369421.1| conserved hypothetical protein [Escherichia coli TA271]
 gi|218361233|emb|CAQ98817.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|300403278|gb|EFJ86816.1| hypothetical protein HMPREF9536_02833 [Escherichia coli MS 84-1]
 gi|300837877|gb|EFK65637.1| hypothetical protein HMPREF9347_05498 [Escherichia coli MS 124-1]
 gi|315257290|gb|EFU37258.1| conserved hypothetical protein [Escherichia coli MS 85-1]
 gi|323186347|gb|EFZ71697.1| hypothetical protein ECOK1357_0296 [Escherichia coli 1357]
 gi|324017958|gb|EGB87177.1| hypothetical protein HMPREF9542_03358 [Escherichia coli MS 117-3]
 gi|324118937|gb|EGC12826.1| hypothetical protein ERBG_01046 [Escherichia coli E1167]
 gi|331063767|gb|EGI35678.1| conserved hypothetical protein [Escherichia coli TA271]
          Length = 162

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYHNSED 153


>gi|239833310|ref|ZP_04681638.1| Hypothetical protein OINT_2000064 [Ochrobactrum intermedium LMG
           3301]
 gi|239821373|gb|EEQ92942.1| Hypothetical protein OINT_2000064 [Ochrobactrum intermedium LMG
           3301]
          Length = 181

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 30/83 (36%), Gaps = 6/83 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                     +L   Y +V+  +    +   ++SQ  W  YR SEC +            
Sbjct: 30  AYADLKAADRRLNNLYSQVVNSLPASNQMQLKESQRNWIKYRDSECRYQQVNYA-----I 84

Query: 96  MIY-ANCLQGHAIERNEKLESYL 117
           M+  A+C +    +R + L   L
Sbjct: 85  MVSEADCKEFLTRQRADHLNQQL 107


>gi|146307165|ref|YP_001187630.1| hypothetical protein Pmen_2138 [Pseudomonas mendocina ymp]
 gi|145575366|gb|ABP84898.1| protein of unknown function DUF1311 [Pseudomonas mendocina ymp]
          Length = 129

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 10/106 (9%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE---KHQRELFEKSQMAWEIYR 77
           L+ +  +  A +  C        K+++   Y+++  K++       +  E +Q AW IYR
Sbjct: 31  LDASGAINNASVAGCAEGVSEAAKKEMNRVYQQLFLKLQEGAPQDAQQLEATQKAWLIYR 90

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
            S+C     G   G+   M Y  C     I+R E+L+  L    GD
Sbjct: 91  NSQCDLQ--GKHVGS--PM-YYTCPMQLNIQRVEELKFLL--ENGD 129


>gi|299532370|ref|ZP_07045762.1| hypothetical protein CTS44_16283 [Comamonas testosteroni S44]
 gi|298719608|gb|EFI60573.1| hypothetical protein CTS44_16283 [Comamonas testosteroni S44]
          Length = 163

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 34/104 (32%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A      +C      A  N C    F       +  Y  V+  +  H+R    K Q  W 
Sbjct: 55  ALAQAGADCVPGGTTAQTNACAIKDFQQADTDHQILYGDVMRALSAHERPALRKEQGEWS 114

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +R ++C  A    E        Y  CL      RN  L+ +L 
Sbjct: 115 RHRITQCKQATKAFEAQPDWPSRYHGCLVQQITTRNAVLKRWLH 158


>gi|157155222|ref|YP_001463182.1| hypothetical protein EcE24377A_2109 [Escherichia coli E24377A]
 gi|191168076|ref|ZP_03029875.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|193065460|ref|ZP_03046529.1| conserved hypothetical protein [Escherichia coli E22]
 gi|260844287|ref|YP_003222065.1| hypothetical protein ECO103_2139 [Escherichia coli O103:H2 str.
           12009]
 gi|260855817|ref|YP_003229708.1| hypothetical protein ECO26_2729 [Escherichia coli O26:H11 str.
           11368]
 gi|260868475|ref|YP_003234877.1| hypothetical protein ECO111_2463 [Escherichia coli O111:H- str.
           11128]
 gi|300917541|ref|ZP_07134198.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300924969|ref|ZP_07140894.1| hypothetical protein HMPREF9548_03079 [Escherichia coli MS 182-1]
 gi|301327667|ref|ZP_07220874.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|307314211|ref|ZP_07593821.1| protein of unknown function DUF1311 [Escherichia coli W]
 gi|309796013|ref|ZP_07690426.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|157077252|gb|ABV16960.1| conserved hypothetical protein [Escherichia coli E24377A]
 gi|190901874|gb|EDV61624.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|192926865|gb|EDV81490.1| conserved hypothetical protein [Escherichia coli E22]
 gi|257754466|dbj|BAI25968.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257759434|dbj|BAI30931.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257764831|dbj|BAI36326.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|300415246|gb|EFJ98556.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300418844|gb|EFK02155.1| hypothetical protein HMPREF9548_03079 [Escherichia coli MS 182-1]
 gi|300845762|gb|EFK73522.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|306906180|gb|EFN36698.1| protein of unknown function DUF1311 [Escherichia coli W]
 gi|308120463|gb|EFO57725.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|315061183|gb|ADT75510.1| predicted protein [Escherichia coli W]
 gi|323152634|gb|EFZ38910.1| hypothetical protein ECEPECA14_5446 [Escherichia coli EPECa14]
 gi|323158638|gb|EFZ44652.1| hypothetical protein ECE128010_5096 [Escherichia coli E128010]
 gi|323180675|gb|EFZ66220.1| hypothetical protein ECOK1180_0664 [Escherichia coli 1180]
 gi|323378240|gb|ADX50508.1| hypothetical protein EKO11_1891 [Escherichia coli KO11]
          Length = 162

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|73542596|ref|YP_297116.1| hypothetical protein Reut_A2912 [Ralstonia eutropha JMP134]
 gi|72120009|gb|AAZ62272.1| Protein of unknown function DUF1311 [Ralstonia eutropha JMP134]
          Length = 162

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 40/102 (39%), Gaps = 11/102 (10%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            C++     D   C    F    ++L A+Y ++   +    ++  + +Q+ W  YR + C
Sbjct: 58  ECDKYRTSYDKTYCFAKLFLESDKELNASYTELRGLIADGAKQKLKDTQLEWIKYRDASC 117

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL-TCPEG 122
              +SGA        I  +C      +R E L   +  C  G
Sbjct: 118 --ESSGA--------IDVDCNYRVNRDRAEYLRDRVRECKAG 149


>gi|332089610|gb|EGI94712.1| hypothetical protein SB521682_2192 [Shigella boydii 5216-82]
          Length = 162

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 52/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +   +D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDSDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|326317407|ref|YP_004235079.1| hypothetical protein Acav_2600 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374243|gb|ADX46512.1| protein of unknown function DUF1311 [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 140

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 35/98 (35%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+     A+ N C   ++      +   Y  V+  +  H+R    + Q AW+  R + C 
Sbjct: 37  CDPKGTVAETNACAVQAWQQADTAIAILYGDVMRALSAHERPQLRQEQAAWQRERVTRCK 96

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            A    E       +Y  CL      R   L  +LT  
Sbjct: 97  QATRATEALPEGPRLYHECLAAETEARRRGLMRWLTLE 134


>gi|187930640|ref|YP_001901127.1| hypothetical protein Rpic_3576 [Ralstonia pickettii 12J]
 gi|187727530|gb|ACD28695.1| protein of unknown function DUF1311 [Ralstonia pickettii 12J]
          Length = 152

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 36/92 (39%), Gaps = 2/92 (2%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE--CAFA 84
              A M +CT  ++     ++   Y+ V+ K +   RE    +Q AW  YR ++     A
Sbjct: 59  ETTAGMTECTHTAYQAYDRQMNTLYQAVMRKSDPVSREAIRNAQRAWLAYRNAQKAADNA 118

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
              A+ G+  S             R  +LE Y
Sbjct: 119 PWRADSGSMASPDIEGLNVEAIRARIAELEYY 150


>gi|16127224|ref|NP_421788.1| hypothetical protein CC_2994 [Caulobacter crescentus CB15]
 gi|221236025|ref|YP_002518462.1| hypothetical protein CCNA_03089 [Caulobacter crescentus NA1000]
 gi|13424628|gb|AAK24956.1| hypothetical protein CC_2994 [Caulobacter crescentus CB15]
 gi|220965198|gb|ACL96554.1| hypothetical protein CCNA_03089 [Caulobacter crescentus NA1000]
          Length = 137

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 48/136 (35%), Gaps = 19/136 (13%)

Query: 1   MCRKIIFALTII---AIAFQSMALN----------CNE---TLMQADMNQCTGNSFALVK 44
           + R ++ A  ++    +A Q+ A +          C E         + +C         
Sbjct: 2   LLRTMMIAAALLCLAPVAAQAQAEDGVSFSPDYDRCREKPENDNTPGILRCGDAEIKFQD 61

Query: 45  EKLEATYKKVLE--KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCL 102
            +L   YK  +   K     +    K+Q AW  +R ++CA        GT + +   +C 
Sbjct: 62  ARLNKAYKADMADLKDSPAAKAALLKAQRAWIAFRDADCA-TVQALSGGTIRPIYVQSCY 120

Query: 103 QGHAIERNEKLESYLT 118
             H   R + LE  L 
Sbjct: 121 LKHTARRAQALEELLQ 136


>gi|194434118|ref|ZP_03066387.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|293415192|ref|ZP_06657835.1| yecT protein [Escherichia coli B185]
 gi|331653287|ref|ZP_08354292.1| conserved hypothetical protein [Escherichia coli M718]
 gi|194417662|gb|EDX33762.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|291432840|gb|EFF05819.1| yecT protein [Escherichia coli B185]
 gi|323968299|gb|EGB63706.1| hypothetical protein ERJG_00330 [Escherichia coli M863]
 gi|327253006|gb|EGE64660.1| hypothetical protein ECSTEC7V_2251 [Escherichia coli STEC_7v]
 gi|331049385|gb|EGI21457.1| conserved hypothetical protein [Escherichia coli M718]
 gi|332095164|gb|EGJ00195.1| hypothetical protein SD15574_1564 [Shigella dysenteriae 155-74]
          Length = 162

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGAKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|82543643|ref|YP_407590.1| hypothetical protein SBO_1123 [Shigella boydii Sb227]
 gi|81245054|gb|ABB65762.1| conserved hypothetical protein [Shigella boydii Sb227]
          Length = 169

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 11  FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 70

Query: 47  LEATYKKVLEKVEK-----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +    +E+            Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 71  LNKAYGEAYRYIEQVPRTGVKKPDIEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 127

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 128 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 160


>gi|332096735|gb|EGJ01726.1| hypothetical protein SB359474_1240 [Shigella boydii 3594-74]
          Length = 162

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVLEKVEK-----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +    +E+            Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDIEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|329297928|ref|ZP_08255264.1| hypothetical protein Pstas_17950 [Plautia stali symbiont]
          Length = 136

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           N+    A M+QC   +     +++ A Y ++++K+    ++    +Q AW  YR S    
Sbjct: 27  NKESSTAGMSQCYSTANKAWDKEMNAQYSQLMKKLTGEPKDKLRNAQRAWLAYRDSWTDA 86

Query: 84  AASG--AEEGTAQSMIYANCLQGHAIERNEKL 113
           + S   + +G+  ++      QG ++ RN+ L
Sbjct: 87  SRSYFLSSQGSMAALSVGA--QGVSLVRNQAL 116


>gi|120611271|ref|YP_970949.1| hypothetical protein Aave_2603 [Acidovorax citrulli AAC00-1]
 gi|120589735|gb|ABM33175.1| hypothetical protein Aave_2603 [Acidovorax citrulli AAC00-1]
          Length = 140

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 35/98 (35%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C+     A+ N C   ++      +   Y  V+  +  H+R    + Q AW+  R + C 
Sbjct: 37  CDPKGTVAETNACAVQAWQQADTAIAILYGDVMRALSAHERPQLRQEQAAWQRERVTRCK 96

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            A    E       +Y  CL      R   L  +LT  
Sbjct: 97  QATRATEALPEGPRLYHECLTAETEARRRGLMRWLTLE 134


>gi|323174606|gb|EFZ60227.1| hypothetical protein ECLT68_0768 [Escherichia coli LT-68]
          Length = 162

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECKLILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|331642495|ref|ZP_08343630.1| conserved hypothetical protein [Escherichia coli H736]
 gi|331039293|gb|EGI11513.1| conserved hypothetical protein [Escherichia coli H736]
          Length = 169

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 11  FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLVDAQ 70

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 71  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 127

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 128 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 160


>gi|89108717|ref|AP_002497.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|90111353|ref|NP_416391.4| predicted protein [Escherichia coli str. K-12 substr. MG1655]
 gi|170081533|ref|YP_001730853.1| hypothetical protein ECDH10B_2018 [Escherichia coli str. K-12
           substr. DH10B]
 gi|193069891|ref|ZP_03050840.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194439080|ref|ZP_03071163.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|218695443|ref|YP_002403110.1| hypothetical protein EC55989_2056 [Escherichia coli 55989]
 gi|238901092|ref|YP_002926888.1| hypothetical protein BWG_1691 [Escherichia coli BW2952]
 gi|256017919|ref|ZP_05431784.1| hypothetical protein ShiD9_03312 [Shigella sp. D9]
 gi|256022458|ref|ZP_05436323.1| hypothetical protein E4_03724 [Escherichia sp. 4_1_40B]
 gi|300819861|ref|ZP_07100046.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300951500|ref|ZP_07165335.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300956610|ref|ZP_07168889.1| hypothetical protein HMPREF9547_02427 [Escherichia coli MS 175-1]
 gi|301029327|ref|ZP_07192424.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|301645606|ref|ZP_07245535.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|307138542|ref|ZP_07497898.1| hypothetical protein EcolH7_10495 [Escherichia coli H736]
 gi|332278951|ref|ZP_08391364.1| conserved hypothetical protein [Shigella sp. D9]
 gi|3025153|sp|P76296|YECT_ECOLI RecName: Full=Uncharacterized protein yecT
 gi|85675156|dbj|BAE76549.1| hypothetical protein [Escherichia coli str. K12 substr. W3110]
 gi|87081997|gb|AAC74947.2| predicted protein [Escherichia coli str. K-12 substr. MG1655]
 gi|169889368|gb|ACB03075.1| predicted protein [Escherichia coli str. K-12 substr. DH10B]
 gi|192956791|gb|EDV87245.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194422039|gb|EDX38043.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|218352175|emb|CAU97914.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|238862993|gb|ACR64991.1| predicted protein [Escherichia coli BW2952]
 gi|260449000|gb|ACX39422.1| protein of unknown function DUF1311 [Escherichia coli DH1]
 gi|299877753|gb|EFI85964.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|300316592|gb|EFJ66376.1| hypothetical protein HMPREF9547_02427 [Escherichia coli MS 175-1]
 gi|300449250|gb|EFK12870.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300527558|gb|EFK48620.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|301076138|gb|EFK90944.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|315136520|dbj|BAJ43679.1| hypothetical protein ECDH1ME8569_1823 [Escherichia coli DH1]
 gi|315617900|gb|EFU98498.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|323940455|gb|EGB36646.1| hypothetical protein ERDG_02804 [Escherichia coli E482]
 gi|323972614|gb|EGB67817.1| hypothetical protein ERHG_01357 [Escherichia coli TA007]
 gi|332101303|gb|EGJ04649.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332343603|gb|AEE56937.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 162

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|170019778|ref|YP_001724732.1| hypothetical protein EcolC_1755 [Escherichia coli ATCC 8739]
 gi|169754706|gb|ACA77405.1| protein of unknown function DUF1311 [Escherichia coli ATCC 8739]
          Length = 162

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 52/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q+
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQN 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|299069711|emb|CBJ40987.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CMR15]
          Length = 176

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 42/115 (36%), Gaps = 20/115 (17%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK------------- 68
           +C+  +  A++ +C     +  +++L A Y +VL  ++K   E                 
Sbjct: 27  DCDNPVTSAEVAECADREHSAAEQRLNAVYSQVLASLQKVDAEYLRSYPNHQPLRAAASL 86

Query: 69  --SQMAWEIYRGSECAFA-----ASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             +Q AW  +R   C        +    +G   ++    C    +  R  +LE+ 
Sbjct: 87  AAAQRAWLTFRRQSCHVEELVALSGNPNQGDLSAIAVTTCESRLSSARTVELENL 141


>gi|310765201|gb|ADP10151.1| DUF1311 protein [Erwinia sp. Ejp617]
          Length = 132

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 42/108 (38%), Gaps = 11/108 (10%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE---KHQREL-------FEKS 69
           A  C E L    + QCT     L +E L   Y    +++    +  + L       F  S
Sbjct: 23  ADICAEQLSDGSLWQCTERQKKLAEEDLNQAYIAAKKRIVQMYRSDKPLGEQYVATFTDS 82

Query: 70  QMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESY 116
           Q  W  YR  +C+  A  AEEG+   +     C+      R+E ++  
Sbjct: 83  QRHWLKYRDGQCSLEAFAAEEGSTVHATAVNICIARIDKARSEMIKQM 130


>gi|325522862|gb|EGD01325.1| hypothetical protein B1M_27114 [Burkholderia sp. TJI49]
          Length = 132

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-- 62
           +      A    + A +C    +  + + Q + + F    ++L  TY+KVL+ + + +  
Sbjct: 5   VVTALTFAWLTAAQAQSCEPDSVARECLQQRSQDEFQQADDELNRTYQKVLKAMSRPRGE 64

Query: 63  -------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                  +  F ++Q  W  +  +ECA      E G  +++    C      +R  +L++
Sbjct: 65  YVNYPALKVKFVEAQRQWIRFLDNECAAWYLINEAGADRNLDLLTCEIDRTRDRTRQLKA 124

Query: 116 YLT 118
           +L 
Sbjct: 125 WLE 127


>gi|288871324|ref|ZP_06117227.2| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
 gi|288863873|gb|EFC96171.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
          Length = 306

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 32/96 (33%), Gaps = 1/96 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           +       M         L   ++   Y  +++ +++  R   E  Q  W   R ++   
Sbjct: 203 SSDSTTYSMKTLAEKELRLWNIEMNTIYADIIDGLDEEARSKLEGEQQTWTKSRDTKAEE 262

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           AA     G+ + + Y          R   L E+Y+ 
Sbjct: 263 AARKYSGGSLEGVEYTASQAESTRTRTYDLVETYIQ 298


>gi|323977938|gb|EGB73024.1| hypothetical protein ERFG_01460 [Escherichia coli TW10509]
          Length = 162

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 53/153 (34%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDINVIKSCLRQEYNLVDVQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASG--AEEGTA 93
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S    ++ +A
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQDLSA 123

Query: 94  QSMIYA-----NCLQGHAIERNEKLESYLTCPE 121
               Y+     +C+      R  +L+ Y    +
Sbjct: 124 P---YSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|320641731|gb|EFX11119.1| hypothetical protein ECO5101_14754 [Escherichia coli O157:H7 str.
           G5101]
          Length = 162

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 50/153 (32%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q  A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSGDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGAKKPDTEQLNLLKKSQRAWLDFRDKECDLILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSNPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|149910712|ref|ZP_01899348.1| hypothetical protein PE36_01030 [Moritella sp. PE36]
 gi|149806251|gb|EDM66228.1| hypothetical protein PE36_01030 [Moritella sp. PE36]
          Length = 140

 Score = 61.1 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 51/118 (43%), Gaps = 7/118 (5%)

Query: 1   MCRKI-IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEK----LEATYKKVL 55
           M + I    +++ + A  + +++C++     ++N C        + +    L+ +  + +
Sbjct: 1   MVKVITFLIMSVCSFATMAASVDCDKAFNTLEINYCAKVELDQAEAEMKLYLDKSIAQYI 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
              + H  E    +Q AW+ Y  S+C    +   +G+ + ++  +C      +R  +L
Sbjct: 61  A--DTHVVESINIAQSAWQSYSKSQCDSVFTMFRDGSLRVVMTLSCRTKLTQQRTYEL 116


>gi|269121963|ref|YP_003310140.1| hypothetical protein Sterm_3370 [Sebaldella termitidis ATCC 33386]
 gi|268615841|gb|ACZ10209.1| protein of unknown function DUF1311 [Sebaldella termitidis ATCC
           33386]
          Length = 137

 Score = 61.1 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 29/92 (31%), Gaps = 3/92 (3%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           +     A+M      +      +L   YK ++  + K  +     +Q +W   R  +   
Sbjct: 40  DSAQTTAEMINAVSYASNEWDAELNKIYKLLMSSLSKDGQNSLRNAQRSWIKERDKK--- 96

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            A     GT   +   +       +R  +L  
Sbjct: 97  IAGENSGGTIDLVNKNSIFLEETKKRTIELAR 128


>gi|226945132|ref|YP_002800205.1| hypothetical protein Avin_30650 [Azotobacter vinelandii DJ]
 gi|226720059|gb|ACO79230.1| Conserved hypothetical protein DUF1311 [Azotobacter vinelandii DJ]
          Length = 126

 Score = 61.1 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 1/87 (1%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           A M  C G   A    +L A Y+ + + +   +R+  +++Q  W  YR + C F A   +
Sbjct: 40  AGMIDCIGTELATQDRRLNAAYRTLGQNLTPERRQRLQRTQRLWLQYRDANCDFYAD-PD 98

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESY 116
            G+   +    C+     ER  +LE  
Sbjct: 99  GGSLARVAANECVLRETTERAAELERL 125


>gi|269119181|ref|YP_003307358.1| hypothetical protein Sterm_0554 [Sebaldella termitidis ATCC 33386]
 gi|268613059|gb|ACZ07427.1| protein of unknown function DUF1311 [Sebaldella termitidis ATCC
           33386]
          Length = 293

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 35/89 (39%), Gaps = 4/89 (4%)

Query: 27  LMQADMNQCTGNSFALV--KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
              ADM      ++A      +L   YK ++EK+ K ++      Q  W   R S+   A
Sbjct: 200 QSTADMT--AAINYASGAWDTELNIIYKLLMEKLSKEEQISLRDKQRNWIKMRDSKINEA 257

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           A+  E G+   +   +       +R  +L
Sbjct: 258 AAEFEGGSMGRVTGRSVFLEETKKRTLEL 286


>gi|15802289|ref|NP_288314.1| hypothetical protein Z2930 [Escherichia coli O157:H7 EDL933]
 gi|15831841|ref|NP_310614.1| hypothetical protein ECs2587 [Escherichia coli O157:H7 str. Sakai]
 gi|168747907|ref|ZP_02772929.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757914|ref|ZP_02782921.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762326|ref|ZP_02787333.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770863|ref|ZP_02795870.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776573|ref|ZP_02801580.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783180|ref|ZP_02808187.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789745|ref|ZP_02814752.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|168801884|ref|ZP_02826891.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|195939581|ref|ZP_03084963.1| hypothetical protein EscherichcoliO157_24757 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810273|ref|ZP_03252149.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816649|ref|ZP_03257769.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819466|ref|ZP_03259786.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209401004|ref|YP_002270961.1| hypothetical protein ECH74115_2614 [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328998|ref|ZP_03445079.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793501|ref|YP_003078338.1| hypothetical protein ECSP_2451 [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227622|ref|ZP_05941903.1| hypothetical protein EscherichiacoliO157_23931 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258212|ref|ZP_05950745.1| hypothetical protein EscherichiacoliO157EcO_20667 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291283059|ref|YP_003499877.1| hypothetical protein G2583_2329 [Escherichia coli O55:H7 str.
           CB9615]
 gi|12515939|gb|AAG56867.1|AE005410_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13362055|dbj|BAB36010.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187768101|gb|EDU31945.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017438|gb|EDU55560.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999490|gb|EDU68476.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355174|gb|EDU73593.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360261|gb|EDU78680.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367389|gb|EDU85805.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370703|gb|EDU89119.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189376033|gb|EDU94449.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|208724789|gb|EDZ74496.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208730992|gb|EDZ79681.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739589|gb|EDZ87271.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209162404|gb|ACI39837.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4115]
 gi|209748410|gb|ACI72512.1| hypothetical protein ECs2587 [Escherichia coli]
 gi|209748412|gb|ACI72513.1| hypothetical protein ECs2587 [Escherichia coli]
 gi|209748414|gb|ACI72514.1| hypothetical protein ECs2587 [Escherichia coli]
 gi|217318345|gb|EEC26772.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|254592901|gb|ACT72262.1| predicted protein [Escherichia coli O157:H7 str. TW14359]
 gi|290762932|gb|ADD56893.1| hypothetical protein G2583_2329 [Escherichia coli O55:H7 str.
           CB9615]
 gi|320188576|gb|EFW63238.1| hypothetical protein ECoD_05075 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320647091|gb|EFX15924.1| hypothetical protein ECO9389_19250 [Escherichia coli O157:H- str.
           493-89]
 gi|320657975|gb|EFX25737.1| hypothetical protein ECO7815_20135 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658548|gb|EFX26242.1| hypothetical protein ECO5905_21855 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668446|gb|EFX35273.1| hypothetical protein ECOSU61_18979 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326342255|gb|EGD66036.1| hypothetical protein ECoA_03325 [Escherichia coli O157:H7 str.
           1044]
 gi|326343805|gb|EGD67567.1| hypothetical protein ECF_02239 [Escherichia coli O157:H7 str. 1125]
          Length = 162

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 50/153 (32%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q  A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSGDDTDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGAKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSNPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|264678920|ref|YP_003278827.1| hypothetical protein CtCNB1_2785 [Comamonas testosteroni CNB-2]
 gi|262209433|gb|ACY33531.1| hypothetical conserved protein [Comamonas testosteroni CNB-2]
          Length = 155

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 33/104 (31%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A      +C      A  N C    F       +  Y  V+  +  H+R    K Q  W 
Sbjct: 47  ALAQAGADCVPGGTTAQTNACAIKDFQQADTDHQILYGDVMRALSAHERPALRKEQGEWS 106

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             R ++C  A    E        Y  CL      R+  L+ +L 
Sbjct: 107 RQRITQCKQATKAFEAQPDWPSRYHGCLVQQITARDAVLKRWLH 150


>gi|322434481|ref|YP_004216693.1| hypothetical protein AciX9_0845 [Acidobacterium sp. MP5ACTX9]
 gi|321162208|gb|ADW67913.1| hypothetical protein AciX9_0845 [Acidobacterium sp. MP5ACTX9]
          Length = 272

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 39/109 (35%), Gaps = 13/109 (11%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            A +I+A+A  + A +C + +   D   C       +   L   Y  +  ++    +   
Sbjct: 9   IAASILALATVTAAADCTKAITPIDKTVCQTPELTKLDADLNHLYTALRPQLTIGAKARL 68

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              Q  W   R   CA A +              CLQ    +R ++LE+
Sbjct: 69  LTQQRTWLALRDKTCATADAA-------------CLQHQYADRLDQLEA 104


>gi|312969920|ref|ZP_07784103.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|310338205|gb|EFQ03294.1| conserved hypothetical protein [Escherichia coli 1827-70]
          Length = 162

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q  A +              C    +   +D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSDDDSDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---IQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|260432257|ref|ZP_05786228.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416085|gb|EEX09344.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 106

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/105 (17%), Positives = 37/105 (35%), Gaps = 8/105 (7%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATY---KKVLEKVEKHQR-----ELFEKSQMAW 73
            C +   Q ++  C G +   V+  L   +       ++++            E SQ AW
Sbjct: 2   ECTDAGSQVEIGACVGQAETNVEAALVQAFGLAADAAKELDAVTGRTVALPALEASQAAW 61

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           + YR ++C    +    G+   +   +C       R  +L  +  
Sbjct: 62  QAYRDAQCEAVGASYGGGSGTGIAITSCRVELGRARVTELLRFAN 106


>gi|160939115|ref|ZP_02086466.1| hypothetical protein CLOBOL_04009 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438078|gb|EDP15838.1| hypothetical protein CLOBOL_04009 [Clostridium bolteae ATCC
           BAA-613]
          Length = 321

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 30/80 (37%), Gaps = 1/80 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                 L + +L + Y  ++E + +         Q  W   R +  A  +SG   G+ + 
Sbjct: 222 AETELKLWEGELNSIYNALMEMLSQEDAAKLASEQQEWLKNRDARAA-ESSGRNSGSMEG 280

Query: 96  MIYANCLQGHAIERNEKLES 115
           + YA  L     +R  +L  
Sbjct: 281 ISYAATLASLTRDRAYELAG 300


>gi|323937135|gb|EGB33415.1| hypothetical protein ERCG_01703 [Escherichia coli E1520]
          Length = 176

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q  A +              C    +   +D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSDDDSDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|15822614|gb|AAK73300.1| Ypar15 [Pseudomonas alcaligenes]
          Length = 132

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 35/91 (38%), Gaps = 11/91 (12%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQ-----------RELFEKSQMAWEIYRGSECAFA 84
             + +    + L  TY+K++ K++               E   +SQ +W  ++   C+  
Sbjct: 32  AQSEYERADKDLNETYQKIIAKIKSGDFDDGLVSRVEITESLRESQRSWLKFKQDNCSAY 91

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                 GT+++     C     IER   L++
Sbjct: 92  YKLYSGGTSRNGDLMACQSEMTIERTNFLKA 122


>gi|85702811|ref|ZP_01033915.1| hypothetical protein ROS217_18757 [Roseovarius sp. 217]
 gi|85671739|gb|EAQ26596.1| hypothetical protein ROS217_18757 [Roseovarius sp. 217]
          Length = 315

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 38/93 (40%), Gaps = 1/93 (1%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
              Q  MN   G      + +L A   +   K+     +   + Q  W  +  ++    A
Sbjct: 218 PRTQMGMNLSMGGELHDEEAQLAAAMDEAT-KLHGIDLKALTELQNRWIEWADAQANLVA 276

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           S   EG+   M++A+     A ER+E+++  ++
Sbjct: 277 SQVAEGSMYPMVWASERATIARERHEQVKRLIS 309


>gi|157161348|ref|YP_001458666.1| hypothetical protein EcHS_A1972 [Escherichia coli HS]
 gi|188495627|ref|ZP_03002897.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|300822349|ref|ZP_07102490.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|157067028|gb|ABV06283.1| conserved hypothetical protein [Escherichia coli HS]
 gi|188490826|gb|EDU65929.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|300525232|gb|EFK46301.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|309702100|emb|CBJ01415.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
          Length = 162

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 51/153 (33%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q  A +              C    +   +D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSDDDSDINVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|323692007|ref|ZP_08106255.1| hypothetical protein HMPREF9475_01118 [Clostridium symbiosum
           WAL-14673]
 gi|323503930|gb|EGB19744.1| hypothetical protein HMPREF9475_01118 [Clostridium symbiosum
           WAL-14673]
          Length = 302

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 33/95 (34%), Gaps = 4/95 (4%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
            +       + L   +L   Y+ +LE + + + E     +  W   R      AA+    
Sbjct: 207 SLKNVADYEYRLWDTELNRIYQSLLEGMTEEESEALRAEEREWIRTRDLAAKKAAAKYGG 266

Query: 91  GTAQSMIYANCLQGHAIERNEKL----ESYLTCPE 121
           GT +S+ Y   L      R  +L      YL   E
Sbjct: 267 GTMESLEYTASLSASTRSRAYELLDSYGDYLEQEE 301


>gi|323486960|ref|ZP_08092275.1| hypothetical protein HMPREF9474_04026 [Clostridium symbiosum
           WAL-14163]
 gi|323399732|gb|EGA92115.1| hypothetical protein HMPREF9474_04026 [Clostridium symbiosum
           WAL-14163]
          Length = 302

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 33/95 (34%), Gaps = 4/95 (4%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
            +       + L   +L   Y+ +LE + + + E     +  W   R      AA+    
Sbjct: 207 SLKNVADYEYRLWDTELNRIYQSLLEGMTEEESEALRAEEREWIRTRDLAAKKAAAKYGG 266

Query: 91  GTAQSMIYANCLQGHAIERNEKL----ESYLTCPE 121
           GT +S+ Y   L      R  +L      YL   E
Sbjct: 267 GTMESLEYTASLSASTRSRAYELLDSYGDYLEQEE 301


>gi|300715174|ref|YP_003739977.1| exported protein [Erwinia billingiae Eb661]
 gi|299061010|emb|CAX58117.1| exported protein [Erwinia billingiae Eb661]
          Length = 133

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 52/130 (40%), Gaps = 14/130 (10%)

Query: 1   MCRKIIFALTIIAIAFQSMA---LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M +  +F +++ A+     A    NC+   +  +++ C+  +    +  L   Y    ++
Sbjct: 1   MKKFALFLISVTALTVSQFARAEENCSSKTISWEVDNCSVRNKDATEAILNKEYSAAKKR 60

Query: 58  VEKHQR----------ELFEKSQMAWEIYRGSECAFAAS-GAEEGTAQSMIYANCLQGHA 106
           +E+  +          +   ++Q  W  YR  +C   AS   E+ +A   + + C+    
Sbjct: 61  IEEEYKSDSSIVKFQLKTLLETQRNWLKYREGQCKMEASLADEDSSAHLGMVSICINKLD 120

Query: 107 IERNEKLESY 116
            +R  + +  
Sbjct: 121 KQRIAQFKEM 130


>gi|89096590|ref|ZP_01169482.1| hypothetical protein B14911_13157 [Bacillus sp. NRRL B-14911]
 gi|89088605|gb|EAR67714.1| hypothetical protein B14911_13157 [Bacillus sp. NRRL B-14911]
          Length = 202

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           ++ AL   ++     + +   + + +  ++L   Y  + E++   + E   + Q  W   
Sbjct: 101 EADALEAADSST-YALKKVENDRWEIWDDRLNEIYGVLQERLPAEEMESLREEQRDWLKE 159

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
           R +    A+   E GT + + Y   L     ER  +L E+Y+ 
Sbjct: 160 RDARALEASLKYEGGTQEHLEYVAVLADITEERCYELVENYMN 202


>gi|241664260|ref|YP_002982620.1| hypothetical protein Rpic12D_2677 [Ralstonia pickettii 12D]
 gi|240866287|gb|ACS63948.1| protein of unknown function DUF1311 [Ralstonia pickettii 12D]
          Length = 251

 Score = 60.3 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 50/135 (37%), Gaps = 21/135 (15%)

Query: 4   KIIFALTIIAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
            ++   +++A    + A  +C   +  AD+ +C      +  +KL A Y +VL  + K  
Sbjct: 104 PLLLTASVLACGGVAHASTDCGNPVTSADVAECADRENLVTGQKLGAVYSQVLMGLRKVD 163

Query: 63  R---------------ELFEKSQMAWEIYRGSECAFA-----ASGAEEGTAQSMIYANCL 102
           +               E F  +Q AW  +R   C         S    G   ++  A C 
Sbjct: 164 KEYGHSYPNRPPLHAAESFAAAQRAWLNFRRQSCHVEELVVRNSNPSRGDQSAIAVAACE 223

Query: 103 QGHAIERNEKLESYL 117
              +  R  +LES +
Sbjct: 224 SRLSSARVAELESLV 238


>gi|88800326|ref|ZP_01115892.1| hypothetical protein MED297_00450 [Reinekea sp. MED297]
 gi|88776903|gb|EAR08112.1| hypothetical protein MED297_00450 [Reinekea sp. MED297]
          Length = 322

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 46/128 (35%), Gaps = 16/128 (12%)

Query: 3   RKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           + ++  L+ +  +   + + +C   +   +   C  +  + + E+L  +Y++      + 
Sbjct: 12  KSLLIGLSFLVCLDAGAASFDCENAVTSIEKEICRSSELSELDERLAKSYQQARSVSTED 71

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
           +     ++Q+AW   R   C+  ++              CL      R   L  Y     
Sbjct: 72  EALSIREAQIAWINDRDETCSEQSN-----------LNECLIEQYKLRLIDLAVY----N 116

Query: 122 GDLLCPFI 129
           G L  P +
Sbjct: 117 GGLTTPVL 124


>gi|325273160|ref|ZP_08139455.1| hypothetical protein G1E_09177 [Pseudomonas sp. TJI-51]
 gi|324101709|gb|EGB99260.1| hypothetical protein G1E_09177 [Pseudomonas sp. TJI-51]
          Length = 135

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 50/129 (38%), Gaps = 8/129 (6%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE- 64
           + A+   A A +  +  C+          C   +  + + +L++ Y ++  ++     + 
Sbjct: 6   LLAVVSGAQASEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELAARMRDQFGDE 65

Query: 65  -----LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESYLT 118
                  E ++  W   R ++C       + G+ A    + +C+   + ER E L S L 
Sbjct: 66  AGLMSRIEAAEQLWRQLRDADCKVETHAEQPGSKAYQTAWNSCIAQRSDERAEYLRS-LG 124

Query: 119 CPEGDLLCP 127
             +GD   P
Sbjct: 125 LQDGDEPAP 133


>gi|330503500|ref|YP_004380369.1| hypothetical protein MDS_2587 [Pseudomonas mendocina NK-01]
 gi|328917787|gb|AEB58618.1| hypothetical protein MDS_2587 [Pseudomonas mendocina NK-01]
          Length = 129

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 37/87 (42%), Gaps = 8/87 (9%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVE---KHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           C        K+++   Y+++  K++       E  + +Q AW +YR  +C     G   G
Sbjct: 45  CAEGVSETAKKEMNRIYQQLFLKLQKSAPEDAEQLQAAQKAWLVYRNGQCDLQ--GKHIG 102

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
           +   M Y  C     I+R ++L+  L 
Sbjct: 103 S--PM-YYTCPMELNIQRLDELKFLLE 126


>gi|114562839|ref|YP_750352.1| hypothetical protein Sfri_1663 [Shewanella frigidimarina NCIMB 400]
 gi|114334132|gb|ABI71514.1| protein of unknown function DUF1311 [Shewanella frigidimarina NCIMB
           400]
          Length = 137

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 47/120 (39%), Gaps = 12/120 (10%)

Query: 9   LTIIAIAFQSMALN------------CNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           L ++  +F +MA +            C         N C           L+  Y+ +LE
Sbjct: 7   LVLLLFSFTAMAEDDSKQLKKEWNETCRNATSYKHGNYCLLKLEEKAVVLLDKKYQTLLE 66

Query: 57  KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            ++K  ++    +Q  W  Y  ++C F +  ++EG         C   H ++R EKLE Y
Sbjct: 67  YLKKPDKDRLVDAQNKWIKYVTADCLFYSPTSKEGDYSYTYNVGCRLTHKLQRLEKLEDY 126


>gi|194367419|ref|YP_002030029.1| hypothetical protein Smal_3647 [Stenotrophomonas maltophilia
           R551-3]
 gi|194350223|gb|ACF53346.1| protein of unknown function DUF1311 [Stenotrophomonas maltophilia
           R551-3]
          Length = 140

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/135 (14%), Positives = 47/135 (34%), Gaps = 19/135 (14%)

Query: 1   MCRKIIFALTIIAIAFQS--------MALNCNETLMQADMNQCTGNSFALVKEKLEATYK 52
           M  +++ ++ + A    +          ++C       + + C  +  A    +L   Y 
Sbjct: 2   MLPRVLASVVLWAGICGAATAFDRKDEGIDCAHPTTTMESDLCASDVAAAADAELNTVYA 61

Query: 53  KVLEKVE-----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANC 101
           +  +++                +    +Q AW   R  +C    +   +GTA++     C
Sbjct: 62  QARQQLRTPDHGGSCSYCGEAEQQLVLAQRAWMQLRDHDCNAVYALNSDGTARNGAQMRC 121

Query: 102 LQGHAIERNEKLESY 116
           L   A +R  +L  +
Sbjct: 122 LTTLARDRTRQLREF 136


>gi|303245746|ref|ZP_07332029.1| protein of unknown function DUF1311 [Desulfovibrio fructosovorans
           JJ]
 gi|302493009|gb|EFL52874.1| protein of unknown function DUF1311 [Desulfovibrio fructosovorans
           JJ]
          Length = 136

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 40/107 (37%), Gaps = 7/107 (6%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR--ELFEKSQMAWEIYRGSEC 81
                Q +MN    ++      +L A Y  VLEK +         + ++ AW  +R +E 
Sbjct: 21  ARAQTQMEMNVAACDAAKKADAELNAAYAAVLEKNKDDPVFIRKLKVAERAWLAFRDAEL 80

Query: 82  A----FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT-CPEGD 123
           A         A  G+  +  Y N L     +R   L  +    PEGD
Sbjct: 81  AARYPAEDKAAAYGSMYNFCYCNALAELTRKRAAALAPWRDGVPEGD 127


>gi|323143780|ref|ZP_08078448.1| hypothetical protein HMPREF9444_01080 [Succinatimonas hippei YIT
           12066]
 gi|322416493|gb|EFY07159.1| hypothetical protein HMPREF9444_01080 [Succinatimonas hippei YIT
           12066]
          Length = 135

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 49/129 (37%), Gaps = 15/129 (11%)

Query: 5   IIFALTIIAIAFQSMALN--------CNETL--MQADMNQCTGNSFALVKEKLEATYKKV 54
           ++   ++   +F ++A          C      +   M +C  ++F  +  KL   YK+ 
Sbjct: 6   VLAIASVFVFSFTAVADEELSPGYNACMSASGGVTVQMRKCQNDAFIYLDGKLNKIYKQA 65

Query: 55  L-----EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
           +     E   K  +    K Q AW  Y+ +   +      +GT   ++  + +     E+
Sbjct: 66  MLSCNDEGDSKACKNTILKMQRAWIKYKEATVDYLFMALGDGTLTPVVVDDFVNQTTKEQ 125

Query: 110 NEKLESYLT 118
            +KLE  L 
Sbjct: 126 VKKLELMLN 134


>gi|253773166|ref|YP_003035997.1| hypothetical protein ECBD_1761 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161937|ref|YP_003045045.1| hypothetical protein ECB_01848 [Escherichia coli B str. REL606]
 gi|297520009|ref|ZP_06938395.1| hypothetical protein EcolOP_20375 [Escherichia coli OP50]
 gi|300928910|ref|ZP_07144414.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|242377598|emb|CAQ32354.1| predicted protein [Escherichia coli BL21(DE3)]
 gi|253324210|gb|ACT28812.1| protein of unknown function DUF1311 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973838|gb|ACT39509.1| hypothetical protein ECB_01848 [Escherichia coli B str. REL606]
 gi|253978032|gb|ACT43702.1| hypothetical protein ECD_01848 [Escherichia coli BL21(DE3)]
 gi|300463064|gb|EFK26557.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|323961932|gb|EGB57531.1| hypothetical protein ERGG_01617 [Escherichia coli H489]
          Length = 162

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 50/153 (32%), Gaps = 40/153 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q  A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQVYAEDTLIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S  +    Q 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNED---VQD 120

Query: 96  M-------IYANCLQGHAIERNEKLESYLTCPE 121
           +        + +C+      R  +L+ Y    +
Sbjct: 121 LSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 153


>gi|21243336|ref|NP_642918.1| hypothetical protein XAC2605 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108880|gb|AAM37454.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 147

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
           +C    +A    +L A YK++L +    +++  ++ +  W  +R + C  +      G A
Sbjct: 66  ECNSQEYAYQDARLNAAYKRLLNRWPAEKKDRLKQEERDWIKWRDTLCK-SNGALGGGQA 124

Query: 94  QSMIYANCLQGHAIERNEKLES 115
           + +   +C      +R E+LE 
Sbjct: 125 EELEDTSCNLNATAQRAEELEK 146


>gi|157825198|ref|YP_001492918.1| hypothetical protein A1C_00385 [Rickettsia akari str. Hartford]
 gi|157799156|gb|ABV74410.1| hypothetical protein A1C_00385 [Rickettsia akari str. Hartford]
          Length = 70

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 11/37 (29%), Positives = 22/37 (59%)

Query: 27 LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
          ++Q DMN C G  +  V +KL   Y+++L+ +   ++
Sbjct: 1  MIQGDMNYCAGAEYKKVDKKLNQIYQEILKHLSNKKK 37


>gi|240137518|ref|YP_002961989.1| hypothetical protein MexAM1_META1p0789 [Methylobacterium extorquens
           AM1]
 gi|240007486|gb|ACS38712.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 164

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C      +    L   Y++ +   ++  +   +  Q  W  +R   C +       G
Sbjct: 73  MMTCFDREHTVWDTLLNRAYREAMAGFDEAGKTDLKGVQQTWLKFRAQACEWPGRVYPGG 132

Query: 92  TAQSMIYANCLQGHAIERNEKL 113
           T    + A C+      R   L
Sbjct: 133 TIGGPLSAECIMDQTALRALDL 154


>gi|153878247|ref|ZP_02004531.1| hypothetical protein BGP_6090 [Beggiatoa sp. PS]
 gi|152065289|gb|EDN65469.1| hypothetical protein BGP_6090 [Beggiatoa sp. PS]
          Length = 78

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 25/57 (43%)

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            Q++L + +Q  W  +R   CAF       GT  +   + C +    +R   L++ L
Sbjct: 14  EQKQLLKIAQTDWLRFREQHCAFVTFLNRGGTGFTAYESECFEQLTKQRIITLKNAL 70


>gi|163850457|ref|YP_001638500.1| hypothetical protein Mext_1024 [Methylobacterium extorquens PA1]
 gi|163662062|gb|ABY29429.1| protein of unknown function DUF1311 [Methylobacterium extorquens
           PA1]
          Length = 164

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 27/82 (32%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C      +    L   Y++ +   ++  +   +  Q  W  +R   CA+       G
Sbjct: 73  MMTCFDREHTVWDTLLNRAYREAMAGFDEAGKADLKGVQQTWLKFRAQACAWPGRVYPGG 132

Query: 92  TAQSMIYANCLQGHAIERNEKL 113
           T    + A C+      R   L
Sbjct: 133 TIGGPLSAECIMDQTALRALDL 154


>gi|21233231|ref|NP_639148.1| hypothetical protein XCC3803 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66770173|ref|YP_244935.1| hypothetical protein XC_3875 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188993382|ref|YP_001905392.1| hypothetical protein xccb100_3987 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21115074|gb|AAM43049.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575505|gb|AAY50915.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167735142|emb|CAP53354.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 183

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 31/98 (31%), Gaps = 5/98 (5%)

Query: 21  LNC--NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
             C  N       M  C          +L   YK ++ K++  ++      Q  W   R 
Sbjct: 89  DECITNAAGATPAMLDCISAEHEYQDSRLNNVYKALIAKLDGTEQSKLRDQQRQWIADRD 148

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +C +     + G   +   A C       R  +LES 
Sbjct: 149 EKCYYDPDSGQAGRVDA---AECRLDMTASRAAELESL 183


>gi|323948237|gb|EGB44225.1| hypothetical protein EREG_00200 [Escherichia coli H120]
          Length = 136

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 41/118 (34%), Gaps = 24/118 (20%)

Query: 25  ETLMQADMNQ---CTGNSFALVKEKLEATYKKVL-----------EKVEKHQRELFEKSQ 70
            +    D+N    C    + LV  +L   Y +             +K +  Q  L +KSQ
Sbjct: 13  NSDDDTDINVIKSCLRQEYNLVDAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQ 72

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSM-------IYANCLQGHAIERNEKLESYLTCPE 121
            AW  +R  EC    S  +    Q +        + +C+      R  +L+ Y    +
Sbjct: 73  RAWLDFRDKECELILSNED---VQDLSDPYSESEWLSCMIIQTNTRTRQLQLYHNSED 127


>gi|254559990|ref|YP_003067085.1| hypothetical protein METDI1503 [Methylobacterium extorquens DM4]
 gi|254267268|emb|CAX23100.1| hypothetical protein METDI1503 [Methylobacterium extorquens DM4]
          Length = 164

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 27/82 (32%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C      +    L   Y++ +   ++  +   +  Q  W  +R   CA+       G
Sbjct: 73  MMACFDREHTVWDTLLNRAYREAMAGFDEAGKADLKGVQQTWLKFRAQACAWPGRVYPGG 132

Query: 92  TAQSMIYANCLQGHAIERNEKL 113
           T    + A C+      R   L
Sbjct: 133 TIGGPLSAECIMDQTALRALDL 154


>gi|149202684|ref|ZP_01879656.1| hypothetical protein RTM1035_08704 [Roseovarius sp. TM1035]
 gi|149143966|gb|EDM32000.1| hypothetical protein RTM1035_08704 [Roseovarius sp. TM1035]
          Length = 158

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 45/138 (32%), Gaps = 23/138 (16%)

Query: 1   MCRKIIFALTIIAIAFQS---------MALNCNETL----MQADMNQCTGNSFALVKEKL 47
           M + +IF +  +A   QS          A  C            M  CT    A     L
Sbjct: 16  MAQDLIFDIAPVAACLQSGGGEECAGIAAEACINATPGGYSTVGMGACTEYERAAWDGWL 75

Query: 48  EATYKKVLEKVE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
              Y+ +  K +            Q +   + Q AW  +R ++C++ AS    GT     
Sbjct: 76  NEVYQALSTKFKAQDAEAPPYAPKQADALREMQRAWIGFRDAKCSYVASQWGGGTGAGPA 135

Query: 98  YANCLQGHAIERNEKLES 115
             +C       +   L+S
Sbjct: 136 SVSCHLHETARQMLYLQS 153


>gi|302878712|ref|YP_003847276.1| hypothetical protein Galf_1493 [Gallionella capsiferriformans ES-2]
 gi|302581501|gb|ADL55512.1| hypothetical protein Galf_1493 [Gallionella capsiferriformans ES-2]
          Length = 133

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 47/125 (37%), Gaps = 13/125 (10%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMN------QCTGNSFALVKEKLEATYKKVLEKV 58
           ++  L+       + A  C    + +  N           +     ++L   Y+++L + 
Sbjct: 6   VVLCLSSFPFQCHAEAWVC-PPDIASSDNGDFCGAAHAEFNANQADKRLNEVYRQLLSEF 64

Query: 59  E-KHQRELFEKSQMAWEIYRGSECAFAASGAEEG--TAQSMIYANCLQGHAIERNEKLES 115
             K +R+ +  +Q AW  +  + C  A S       T   M ++ C     + R ++LE 
Sbjct: 65  PTKEERQPWITAQRAWLKFSDAHCVAALSKFIGAPFTMAEMEHS-CRAEQILNRTKELER 123

Query: 116 YLTCP 120
           Y  C 
Sbjct: 124 Y--CE 126


>gi|317049724|ref|YP_004117372.1| hypothetical protein Pat9b_3526 [Pantoea sp. At-9b]
 gi|316951341|gb|ADU70816.1| protein of unknown function DUF1311 [Pantoea sp. At-9b]
          Length = 137

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 33/87 (37%), Gaps = 8/87 (9%)

Query: 1  MCRKIIFALTIIAIAFQSMA-------LNC-NETLMQADMNQCTGNSFALVKEKLEATYK 52
          M + +     +++    +           C N       M+QC   +     +++   Y 
Sbjct: 1  MKKWLPVTCLLLSSYATAQGNPIDQSLQQCLNRESSTLGMSQCYDAANKAWDQEMNNQYN 60

Query: 53 KVLEKVEKHQRELFEKSQMAWEIYRGS 79
          ++++K+    +   + +Q AW  YR S
Sbjct: 61 QLMKKLTGEPKAKLKNAQRAWLAYRDS 87


>gi|311104521|ref|YP_003977374.1| hypothetical protein AXYL_01321 [Achromobacter xylosoxidans A8]
 gi|310759210|gb|ADP14659.1| hypothetical protein AXYL_01321 [Achromobacter xylosoxidans A8]
          Length = 275

 Score = 58.8 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/113 (14%), Positives = 40/113 (35%), Gaps = 2/113 (1%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-EKHQ 62
           +++    + A+A  + A++C +     +   C+         +L   Y  +L++  +   
Sbjct: 9   RLLCVAGLFALAAPAYAIDCAKAASAVEKLICSDRKTVSADAELNRAYAALLKQAPDGDI 68

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           R +   +Q  W   R  E             +    A   +    +R  +L++
Sbjct: 69  RAMLAHNQKRWIAARD-EALANLIQDPGAVPEGKTAAAVARELIRDRTAELQT 120


>gi|254490499|ref|ZP_05103685.1| hypothetical protein MDMS009_831 [Methylophaga thiooxidans DMS010]
 gi|224464243|gb|EEF80506.1| hypothetical protein MDMS009_831 [Methylophaga thiooxydans DMS010]
          Length = 92

 Score = 58.8 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 2/85 (2%)

Query: 32  MNQCTGNSFALVKEKL--EATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           MNQC  +       +L       ++    +     + +K+Q AWE YR  +C       E
Sbjct: 1   MNQCLNHKLERAVNELENNLALTRLKFTDDPAMLAMIDKAQEAWEAYRKKQCQSVFLMWE 60

Query: 90  EGTAQSMIYANCLQGHAIERNEKLE 114
            G+ Q ++  +C    A ERN  L 
Sbjct: 61  GGSIQPLMTVSCSIQLARERNTFLR 85


>gi|296273673|ref|YP_003656304.1| hypothetical protein Arnit_2143 [Arcobacter nitrofigilis DSM
          7299]
 gi|296097847|gb|ADG93797.1| protein of unknown function DUF1311 [Arcobacter nitrofigilis DSM
          7299]
          Length = 288

 Score = 58.8 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 34/92 (36%), Gaps = 8/92 (8%)

Query: 2  CRKIIFALTIIAIAFQSM-------ALNCNE-TLMQADMNQCTGNSFALVKEKLEATYKK 53
           + I   L   +    +        + +CN      A+   C     +   ++L   Y +
Sbjct: 1  MKNIFLILIFFSSLIFAENVKFYKPSFDCNNVKKGTAEYIICANEYLSKDDKELNNLYSQ 60

Query: 54 VLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
          +L+ V K + EL ++SQ  W   R   C   +
Sbjct: 61 LLKNVSKEKIELIKESQYKWIRERQRNCNTES 92


>gi|51244878|ref|YP_064762.1| hypothetical protein DP1026 [Desulfotalea psychrophila LSv54]
 gi|50875915|emb|CAG35755.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 137

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 45/131 (34%), Gaps = 16/131 (12%)

Query: 1   MCRKIIFALTIIAIAFQSMALN---------------CNETLMQADMNQCTGNSFALVKE 45
           M ++I+     +  A  + A                  +       M      +   +  
Sbjct: 1   MKKRILLC-IFLLFALPAQAEELITVPPAEKQDWQNFIDGAEDNYSMQARAAEAMHSLDS 59

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
           +++    K+   +++    L + +Q AWE    ++C F A     G+ + + Y +C+   
Sbjct: 60  RIDEVVIKINRDLDQQAITLLKSNQTAWEKQICTKCIFLADSYRGGSHKGLAYGDCVIQE 119

Query: 106 AIERNEKLESY 116
              R  +L+  
Sbjct: 120 QKVRIAELKQM 130


>gi|218529151|ref|YP_002419967.1| hypothetical protein Mchl_1151 [Methylobacterium chloromethanicum
           CM4]
 gi|218521454|gb|ACK82039.1| protein of unknown function DUF1311 [Methylobacterium
           chloromethanicum CM4]
          Length = 170

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C      +    L   Y++ +   ++  +   +  Q  W  +R   CA+       G
Sbjct: 79  MMACFDREHTVWDTLLNRAYREAMAGFDEAGKADLKGVQQTWLKFRAQACAWPGRVYPGG 138

Query: 92  TAQSMIYANCLQGHAIERNEKL 113
           T    +   C+      R   L
Sbjct: 139 TIGGPLSGECIMDQTALRALDL 160


>gi|291087653|ref|ZP_06347044.2| conserved hypothetical protein [Clostridium sp. M62/1]
 gi|291074355|gb|EFE11719.1| conserved hypothetical protein [Clostridium sp. M62/1]
          Length = 455

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 37/85 (43%), Gaps = 1/85 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                 L  ++L   YK ++ +++  + E  +K +  W   +  +   AAS  + GT + 
Sbjct: 364 ADYELKLWDDELNVIYKDIMSRLDTEEAEKLKKEERTWIRQKDEDARKAASRYKGGTLEG 423

Query: 96  MIYANCLQGHAIERN-EKLESYLTC 119
           + +   L     ER    L+SY +C
Sbjct: 424 LEHTASLAKSTRERAYALLDSYGSC 448


>gi|26987049|ref|NP_742474.1| hypothetical protein PP_0307 [Pseudomonas putida KT2440]
 gi|24981670|gb|AAN65938.1|AE016221_10 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 143

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 48/120 (40%), Gaps = 12/120 (10%)

Query: 9   LTIIAIAFQSMALN-----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           L ++AI   + A       C+          C   +  + + +L++ Y +++E++     
Sbjct: 12  LVLLAIVSGAQADEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERMRDQFG 71

Query: 64  E------LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESY 116
           +        E ++  W   R ++C       + G+ A  + + +C+   + ER E L S 
Sbjct: 72  DEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYLRSL 131


>gi|268679360|ref|YP_003303791.1| hypothetical protein Sdel_0722 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617391|gb|ACZ11756.1| Uncharacterized protein putative lipoprotein- like protein
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 877

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 45/113 (39%), Gaps = 12/113 (10%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE-KVEKHQR 63
           +   + +I I   + + +C       +   CT N  +L+ E+L   YK+  +  +   QR
Sbjct: 15  LSLGILLIPIITNAASFDCARASTFVEKTICTDNQLSLMDEELNTLYKEGQQNSIYATQR 74

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
              +K+Q+ W I R   C    S   + +        C+      R + L++ 
Sbjct: 75  ---KKTQLLWLIERDK-CNTEFSNDYQKS-------KCVSNAYESRIKDLKTL 116


>gi|317127975|ref|YP_004094257.1| hypothetical protein Bcell_1261 [Bacillus cellulosilyticus DSM
           2522]
 gi|315472923|gb|ADU29526.1| hypothetical protein Bcell_1261 [Bacillus cellulosilyticus DSM
           2522]
          Length = 214

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 32/76 (42%), Gaps = 1/76 (1%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
            + L   Y  + E++   + +   + Q +W  YR      A+   + GT + + Y + L 
Sbjct: 139 DQLLNEIYGVIQEQLTVEEMDQLREKQRSWIKYRDDRALEASEIYKGGTQEHLEYVSVLA 198

Query: 104 GHAIERNEKL-ESYLT 118
               ER  +L E Y+ 
Sbjct: 199 NLTEERCYELVEGYMK 214


>gi|298290650|ref|YP_003692589.1| hypothetical protein Snov_0637 [Starkeya novella DSM 506]
 gi|296927161|gb|ADH87970.1| protein of unknown function DUF1311 [Starkeya novella DSM 506]
          Length = 126

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 10/83 (12%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ---------RELFEKSQMA 72
           NC++ L    M  C     A   + L A Y+K+L  +++           R+    +Q A
Sbjct: 34  NCDK-LDGYAMEDCLTKEAAEADKALNAAYQKMLAAIDQDATPSDPKATWRDNLVAAQRA 92

Query: 73  WEIYRGSECAFAASGAEEGTAQS 95
           W  YR + C F  S     +A +
Sbjct: 93  WIAYRDANCKFDLSVRNGISAAA 115


>gi|148545583|ref|YP_001265685.1| hypothetical protein Pput_0328 [Pseudomonas putida F1]
 gi|148509641|gb|ABQ76501.1| protein of unknown function DUF1311 [Pseudomonas putida F1]
          Length = 138

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 48/123 (39%), Gaps = 7/123 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   ++ A+   A A +  +  C+          C   +  + + +L++ Y  ++ ++  
Sbjct: 4   MAWLVLLAIVSGAQASEDESTPCDNVETDQQTFACAAFNKQVAERELQSAYDDLVARMRD 63

Query: 61  HQRE------LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
              +        E ++  W   R ++C       + G+ A  + + +C+   + ER E L
Sbjct: 64  QFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSRAYQIAWNSCIAQRSDERAEYL 123

Query: 114 ESY 116
            S 
Sbjct: 124 RSL 126


>gi|187923080|ref|YP_001894722.1| hypothetical protein Bphyt_1079 [Burkholderia phytofirmans PsJN]
 gi|187714274|gb|ACD15498.1| protein of unknown function DUF1311 [Burkholderia phytofirmans
           PsJN]
          Length = 167

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 11/103 (10%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-----------FEKSQMA 72
            E    AD+  C+   + ++  KL++  K + +  +K   EL           FEK Q A
Sbjct: 62  GEHASTADIAACSQRDYEIIFAKLKSKIKSLEDGFKKDDAELKAEDNPIASPYFEKGQNA 121

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           W  +R ++C        E + + M + +C+     ER + L+S
Sbjct: 122 WIEFRDNQCYAETYSLGEASMRYMTFWDCMARITRERLDDLDS 164


>gi|294140893|ref|YP_003556871.1| hypothetical protein SVI_2122 [Shewanella violacea DSS12]
 gi|293327362|dbj|BAJ02093.1| hypothetical protein [Shewanella violacea DSS12]
          Length = 350

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 41/121 (33%), Gaps = 13/121 (10%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH- 61
           R  IF    +     +  +NC +++ + +   C      L  ++L+  Y  + E    + 
Sbjct: 17  RLAIFVALCLPFKGFAAGINCEKSVTEIEKLICADQELLLQDDRLDVIYWTLQE-DNPNF 75

Query: 62  --QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
              R    + Q  W   R  EC          +   +    CL+    +R   L S L  
Sbjct: 76  NFYRTRLRQEQREWLKTRDLECK---------SLDKVKLKYCLEEQYQQRITVLSSLLDA 126

Query: 120 P 120
           P
Sbjct: 127 P 127


>gi|206563095|ref|YP_002233858.1| hypothetical protein BCAM1242A [Burkholderia cenocepacia J2315]
 gi|198039135|emb|CAR55098.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 146

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 53/128 (41%), Gaps = 12/128 (9%)

Query: 3   RKIIFALTIIAIAF--QSMALNCNETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVE 59
           R ++    ++  +    + A +C    +  + + Q + +      ++L  TY+KVL+ + 
Sbjct: 16  RAMLGVSMVLTFSGVAAAQAQSCAPDSVAPECLLQRSQDELQQADDELNRTYRKVLKSLS 75

Query: 60  KHQ---------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           + +         +  F ++Q  W  +  +EC+      E G  +++    C      +R 
Sbjct: 76  RPRDEYVNYPALKAKFIEAQRQWLRFIDNECSAWYLINEAGADRNLDLLTCEIERTRDRT 135

Query: 111 EKLESYLT 118
            +L ++L 
Sbjct: 136 RQLNTWLK 143


>gi|269120619|ref|YP_003308796.1| hypothetical protein Sterm_2010 [Sebaldella termitidis ATCC 33386]
 gi|268614497|gb|ACZ08865.1| hypothetical protein Sterm_2010 [Sebaldella termitidis ATCC 33386]
          Length = 501

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 19/46 (41%)

Query: 41  ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
               E+L   Y+ +   +   Q+     SQ AW  YR SE  F  S
Sbjct: 322 EKADEELNKVYQHLTGILNDDQKSKLTSSQKAWLDYRDSEFKFLNS 367


>gi|313496672|gb|ADR58038.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 138

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 48/123 (39%), Gaps = 7/123 (5%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   ++ A+   A A +  +  C+          C   +  + + +L++ Y  ++ ++  
Sbjct: 4   MAWLVLLAIVSGAQAGEEESTPCDNVENDQQTFACAAFNKQVAERELQSAYDDLVARMRD 63

Query: 61  HQRE------LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
              +        E ++  W   R ++C       + G+ A  + + +C+   + ER E L
Sbjct: 64  QFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYL 123

Query: 114 ESY 116
            S 
Sbjct: 124 RSL 126


>gi|237808508|ref|YP_002892948.1| hypothetical protein Tola_1752 [Tolumonas auensis DSM 9187]
 gi|237500769|gb|ACQ93362.1| protein of unknown function DUF1311 [Tolumonas auensis DSM 9187]
          Length = 183

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 43/118 (36%), Gaps = 6/118 (5%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +KI++ L++    + + A  C     Q  M +    +      +L   Y ++   ++  
Sbjct: 1   MKKILYILSVF--IYNANAGEC--VATQCIMAK-AIENQHNEDGQLNKNYAELKLHLKSD 55

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLT 118
              + +  Q  W   R   C+      E+ G   S+    CL      RN +LE+   
Sbjct: 56  DFSVLKAVQKKWIKLRDLVCSDEIYNKEDLGNEASIEKQLCLYNQTKARNIELEALAN 113


>gi|317405442|gb|EFV85754.1| hypothetical protein HMPREF0005_01558 [Achromobacter xylosoxidans
          C54]
          Length = 227

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 35/94 (37%), Gaps = 5/94 (5%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M       L ++    Q+ + +CN+     +   C+    + +  KL+  YK  L   + 
Sbjct: 1  MKLLFTLGLAMLGTYAQAASFDCNKAASTTEKLICSDAETSALDGKLQGAYKAALAATDA 60

Query: 61 HQRELFEKSQMAWEIY-----RGSECAFAASGAE 89
          + ++   + Q  W  Y     + S C   A  + 
Sbjct: 61 YGKKALAEEQRNWIKYARGICQDSACLRQAYTSR 94


>gi|260776771|ref|ZP_05885665.1| hypothetical protein VIC_002159 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606437|gb|EEX32711.1| hypothetical protein VIC_002159 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 364

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 32/84 (38%), Gaps = 15/84 (17%)

Query: 40  FALVKEKLEATYKKVLEKVE---------KHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
            A    +L ATY++V++ ++         K Q     + Q  W  +R + C   A+    
Sbjct: 282 LAETDRRLNATYQEVMDYLKLPSPEYALPKPQSLELREVQRQWIKHRDATCRLVAAP--- 338

Query: 91  GTAQSMIYANCLQGHAIERNEKLE 114
                 +   CL     +R ++L 
Sbjct: 339 ---HPSLKEQCLNWLTAQREQQLR 359


>gi|291619059|ref|YP_003521801.1| Hypothetical Protein PANA_3506 [Pantoea ananatis LMG 20103]
 gi|291154089|gb|ADD78673.1| Hypothetical Protein PANA_3506 [Pantoea ananatis LMG 20103]
          Length = 145

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 37/96 (38%), Gaps = 1/96 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           N+      + QC   +     +++   Y  +++K+    RE    +Q AW  YR +  A 
Sbjct: 41  NQADTTLALMQCQDAATQEWDKEMNTQYSALMKKLSGQPREKLRAAQRAWMKYREAWLAA 100

Query: 84  AASGA-EEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           + S    +GT   +  A         +  +L+S   
Sbjct: 101 SRSQLNTQGTLGPVALAAQSTALVRNQTLQLQSLAN 136


>gi|188991085|ref|YP_001903095.1| hypothetical protein xccb100_1689 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732845|emb|CAP51039.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 196

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 44/101 (43%), Gaps = 2/101 (1%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A  +  +   + +M A M+ C    +A    +L   Y ++L+ V   ++   ++ +  W 
Sbjct: 97  ASYAQCVKNADAVMPALMD-CNHQEYAYQDARLNKAYVRLLKSVPAEKKASLKQEERDWI 155

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +R + C  +      G A+ +  ++C      +R E+LE 
Sbjct: 156 KWRDTLCQ-SNGALGGGQAEELEDSSCELNATSKRAEELEK 195


>gi|317401349|gb|EFV81985.1| hypothetical protein HMPREF0005_01030 [Achromobacter xylosoxidans
          C54]
          Length = 282

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 26/65 (40%), Gaps = 1/65 (1%)

Query: 15 AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQMAW 73
          +  + A++C++    A+   C+         +L   Y  +L++    Q R +   SQ  W
Sbjct: 20 SAPAWAIDCHKAGTPAEKLICSDRGAVAADAELNRAYAALLKQAPDAQIRAMLVDSQRRW 79

Query: 74 EIYRG 78
             R 
Sbjct: 80 VEARN 84


>gi|310765203|gb|ADP10153.1| hypothetical protein EJP617_04720 [Erwinia sp. Ejp617]
          Length = 136

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/117 (16%), Positives = 42/117 (35%), Gaps = 14/117 (11%)

Query: 12  IAIAFQSMA-LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK---------- 60
           + I+  + A  +C +      +  C   +    ++ L   Y    ++++           
Sbjct: 17  LQISCSAYAIDDCAKETSDPAVFTCAEKNKDTAEKNLNHEYLAAKKRIDDVFSSEADVKK 76

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY--ANCLQGHAIERNEKLES 115
                  +SQ  W  YR  +C   A  A++ +    I    NC+      R+++L+ 
Sbjct: 77  EYLATLIESQRGWLKYRDGQCKLFAHVADKNS-NPYIVFTNNCIAELDENRSKQLKE 132


>gi|313650081|gb|EFS14494.1| hypothetical protein SF2457T_1388 [Shigella flexneri 2a str. 2457T]
          Length = 115

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 38/105 (36%), Gaps = 21/105 (20%)

Query: 35  CTGNSFALVKEKLEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAF 83
           C    + LV  +L   Y +             +K++  Q  L +KSQ AW  +R  EC  
Sbjct: 5   CLRQEYNLVDAQLNKAYGEAYRYIEQVPRTGAKKLDTEQLNLLKKSQRAWLDFRDKECEL 64

Query: 84  AASGAEEGTAQSM-------IYANCLQGHAIERNEKLESYLTCPE 121
             S  +    Q +        + +C+      R  +L+ Y    +
Sbjct: 65  ILSNED---VQDLSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 106


>gi|227328032|ref|ZP_03832056.1| hypothetical protein PcarcW_12150 [Pectobacterium carotovorum
          subsp. carotovorum WPP14]
          Length = 309

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 9/74 (12%), Positives = 24/74 (32%), Gaps = 3/74 (4%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +  +  +        A++C++     +   C  +    +   L   Y+  ++K     + 
Sbjct: 6  LAVSSLLFFFTSSVWAMDCSKASTDTEKMICASSRLQQLDAVLNKAYQGYVKK---EDKA 62

Query: 65 LFEKSQMAWEIYRG 78
             + Q  W   R 
Sbjct: 63 QARQEQRTWLAERD 76


>gi|50119078|ref|YP_048245.1| hypothetical protein ECA0117 [Pectobacterium atrosepticum
          SCRI1043]
 gi|49609604|emb|CAG73037.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 309

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 9/74 (12%), Positives = 25/74 (33%), Gaps = 3/74 (4%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +  +  +        A++C++     +   C  +    +   L   Y+  ++K +   + 
Sbjct: 6  LAVSSLLFFFTSSVWAMDCSKASTDTEKMICASSRLQQLDAVLNKAYQGYVKKAD---KA 62

Query: 65 LFEKSQMAWEIYRG 78
             + Q  W   R 
Sbjct: 63 QARQEQRTWLAERD 76


>gi|326536480|ref|YP_004300911.1| hypothetical protein 65p072 [Aeromonas phage 65]
 gi|312262826|gb|ADQ53082.1| conserved hypothetical protein [Aeromonas phage 65]
          Length = 91

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 29/79 (36%), Gaps = 5/79 (6%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M + +I  +    +   + + +C       ++  C     + + E+L   YK  L ++  
Sbjct: 1  MKKLMIAVMFAFPMFSHAASFDCANASTTVELTICDDEKLSKLDEELNKVYK--LARIHD 58

Query: 61 HQRELFEKSQMAWEIYRGS 79
                 KSQ+ W   R  
Sbjct: 59 PS---IVKSQIDWVKIRNK 74


>gi|291086876|ref|ZP_06571709.1| putative lipoprotein [Clostridium sp. M62/1]
 gi|291077251|gb|EFE14615.1| putative lipoprotein [Clostridium sp. M62/1]
          Length = 367

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 36/95 (37%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           + +L QA++N+ + N ++L    L   +  + +   + + E     Q  W   +      
Sbjct: 271 DASLDQAELNETSMNLYSLWDFALNQLWDALGKVKTESEMEQLTVRQREWIKEKEEAVRA 330

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           A +  E GT + +           +R  +L   L 
Sbjct: 331 AGAEYEGGTMKPLAANTEAAELTQKRVYELMEELK 365


>gi|308188239|ref|YP_003932370.1| hypothetical protein Pvag_2762 [Pantoea vagans C9-1]
 gi|308058749|gb|ADO10921.1| hypothetical protein Pvag_2762 [Pantoea vagans C9-1]
          Length = 136

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 11/122 (9%)

Query: 1   MCRKIIFALTIIAIAFQS------MALN-C-NETLMQADMNQCTGNSFALVKEKLEATYK 52
           M   ++  L  ++ A  +       AL+ C N+     +MNQC   +  +  +++   Y 
Sbjct: 1   MKSGLLLMLLFVSTATIAKDLPSDAALDRCLNDASATLEMNQCYAAATTIWDQQMNQQYN 60

Query: 53  KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG-AEEGTAQSMIYANCLQGHAIERNE 111
            +++ +    +     +Q AW  YR S  A + S  A +GT  S+  +   QG ++ RN+
Sbjct: 61  TLMKTLNGDAKNRLRIAQRAWLSYRDSWLAASHSQLATQGTLGSVALSA--QGLSLVRNQ 118

Query: 112 KL 113
            L
Sbjct: 119 AL 120


>gi|254523720|ref|ZP_05135775.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
 gi|219721311|gb|EED39836.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
          Length = 141

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 48/135 (35%), Gaps = 19/135 (14%)

Query: 1   MCRKIIFALTIIAIAF--------QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYK 52
           M  +++ +L + A            +  ++C       + + C  +  A    +L A Y 
Sbjct: 3   MLPRVLASLALCASLCGVAHAGDRSAEGIDCAHPTTTMESDLCASDVAAAADAELNAVYA 62

Query: 53  KVLEKVEKHQR-----------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANC 101
              +++    +           +    +Q AW   R  +C    +   +GTA++     C
Sbjct: 63  LARQQLRTPAKGGGCSYCGDAEQQLVLAQRAWMQLRDHDCNAVYALNSDGTARNGAQMRC 122

Query: 102 LQGHAIERNEKLESY 116
           L   A +R  +L  +
Sbjct: 123 LITLARDRTRQLREF 137


>gi|70733028|ref|YP_262801.1| hypothetical protein PFL_5743 [Pseudomonas fluorescens Pf-5]
 gi|68347327|gb|AAY94933.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 133

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 52/132 (39%), Gaps = 15/132 (11%)

Query: 2   CRKIIFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + I  AL ++A   Q+        C+         +C   +    ++ L    + +LE+
Sbjct: 1   MKPIFLALVLMATGVQAAEETDSSPCDGVENDVQTLECATYNRTTAEQLLGDNVQSLLER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           +                  + +Q  W+  R ++CA  +  A+ GT A ++   +CL   +
Sbjct: 61  LGTLYGSDKGQLADISAKVKNAQQLWQKQRDADCAMESFPAKPGTKAYTIATNDCLARMS 120

Query: 107 IERNEKLESYLT 118
            ER+E +ES   
Sbjct: 121 DERSEFIESIAQ 132


>gi|54308436|ref|YP_129456.1| hypothetical protein PBPRA1243 [Photobacterium profundum SS9]
 gi|46912865|emb|CAG19654.1| hypothetical protein PBPRA1243 [Photobacterium profundum SS9]
          Length = 512

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M   ++   +    A  S + +C++   Q +   CT ++ A++  K+E  Y++ L+ +  
Sbjct: 7  MLVTVLSIFSPFLWATTSPSFDCDKASSQIEERICTDDALAVLDMKMEKVYEQALQNIPD 66

Query: 61 HQRELFEKSQMAWEIYRGSEC 81
           +R + +  Q  W   R  EC
Sbjct: 67 SERSIMKSMQRGWIKGRN-EC 86


>gi|269104399|ref|ZP_06157095.1| lipoprotein putative [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268161039|gb|EEZ39536.1| lipoprotein putative [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 192

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 43/119 (36%), Gaps = 15/119 (12%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           + +L  +     + + +C +     +   C+ N  A +   L   YK+ +      +++ 
Sbjct: 10  LLSLFALPTLAATPSFDCTKASSSVEELICSNNELATLDNTLNTVYKQAMANYPSTEKKQ 69

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE---SYLTCPE 121
            +  Q  W   R  EC  ++              +C+  +  +R  +L+     L  PE
Sbjct: 70  QKAMQRGWIKGRN-ECWKSSD-----------VLSCVADNYRDRILELQITGGLLKAPE 116


>gi|224438643|ref|ZP_03659540.1| hypothetical protein HcinC1_11525 [Helicobacter cinaedi CCUG 18818]
          Length = 371

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 47/127 (37%), Gaps = 27/127 (21%)

Query: 1   MCRKIIF--ALTIIAIAFQSMA-------LNCNETLMQADMNQCTGN--SFALVKEKLEA 49
           M + +I      +++I+  + +        +C +   + +   C  +      +  ++  
Sbjct: 1   MQKILIVLGVFLMLSISVNAQSPQEAKPSFDCAKATTKVEKMICEDSSGELQNLDRQISQ 60

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
           +Y+    K++K+ ++    SQ +W   R   C                   CL+     R
Sbjct: 61  SYQDTKAKLDKNAKKALLDSQKSWLKTRE-RCE---------------SKECLKESLQSR 104

Query: 110 NEKLESY 116
            ++L+SY
Sbjct: 105 IKELQSY 111


>gi|237742340|ref|ZP_04572821.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
 gi|229429988|gb|EEO40200.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
          Length = 141

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 37/86 (43%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           ADM + T       + +L   Y  ++EK+ K ++   E  Q  W   R  +    A  AE
Sbjct: 47  ADMREATTELSETWENELNTVYSLLMEKLPKAEKVKLENEQKKWLKNRNIKAKKDAKEAE 106

Query: 90  EGTAQSMIYANCLQGHAIERNEKLES 115
            GT + +++ + ++     R  +L  
Sbjct: 107 GGTMEPLLFTSSIKDLNEARAIELAK 132


>gi|325578894|ref|ZP_08148912.1| hypothetical protein HMPREF9417_1653 [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159541|gb|EGC71674.1| hypothetical protein HMPREF9417_1653 [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 115

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 58/121 (47%), Gaps = 13/121 (10%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            +K + AL  I I   +   NC++         C  N+    K++L  ++++++ +V+++
Sbjct: 1   MKKFLIALCSI-ILLTAANKNCDDIE-------CHKNNIEEYKKELNKSFQELV-RVDEN 51

Query: 62  Q--RELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +   + F++SQM W  +   +C F  S     +G    ++Y  CL+ +   R +++   +
Sbjct: 52  KLVVDSFKESQMLWNKFIKEDCKFMNSPMSFTQGDGYIIVYYECLEDYYNIRIKQINKMI 111

Query: 118 T 118
            
Sbjct: 112 N 112


>gi|78060361|ref|YP_366936.1| hypothetical protein Bcep18194_C7248 [Burkholderia sp. 383]
 gi|77964911|gb|ABB06292.1| protein of unknown function DUF1311 [Burkholderia sp. 383]
          Length = 153

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 46/113 (40%), Gaps = 10/113 (8%)

Query: 16  FQSMALNCNETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEKHQ---------REL 65
             + A +C    +  + + Q + + F    ++L  TY+KVL  + + +         +  
Sbjct: 36  TAAQARSCTPDSVAPECLLQRSQDEFQQADDELNRTYQKVLTSMSRPRDEYVNYPALKVK 95

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           F ++Q  W  +  +EC       E G  +++    C      +R  +L ++L 
Sbjct: 96  FVEAQRQWVRFLDNECTAWYLINEAGADRNLDLLTCEIDRTRDRTRELNAWLK 148


>gi|34762232|ref|ZP_00143238.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|256845668|ref|ZP_05551126.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|294785085|ref|ZP_06750373.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
 gi|27888090|gb|EAA25150.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|256719227|gb|EEU32782.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|294486799|gb|EFG34161.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
          Length = 141

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 37/86 (43%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           ADM + T       + +L   Y  ++EK+ K ++   E  Q  W   R  +    A  AE
Sbjct: 47  ADMREATTELSETWENELNTVYSLLMEKLPKAEKVKLENEQKKWLKNRNIKAKKDAKEAE 106

Query: 90  EGTAQSMIYANCLQGHAIERNEKLES 115
            GT + +++ + ++     R  +L  
Sbjct: 107 GGTMEPLLFTSSIKDLNEARAIELAK 132


>gi|313669553|ref|YP_004049978.1| hypothetical protein Sulku_2776 [Sulfuricurvum kujiense DSM 16994]
 gi|313156750|gb|ADR35425.1| hypothetical protein Sulku_2776 [Sulfuricurvum kujiense DSM 16994]
          Length = 319

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 4/104 (3%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF---EKSQMAWEIYRGSE 80
           ++ L Q DMN    +      + +EA   +++ ++     E     +++  +W+ Y    
Sbjct: 214 DQPLTQMDMNMSACDDLTKTLDSIEAIDSEIVRQISDKWIERLEYYKRAHESWKKYMEDN 273

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT-CPEGD 123
             F AS    G+  ++I A+     A+ER + L+  L    E D
Sbjct: 274 SEFEASSFIGGSMWTLIKASSANRIALEREKDLKLLLNQLEEND 317


>gi|238790028|ref|ZP_04633806.1| hypothetical protein yfred0001_19040 [Yersinia frederiksenii ATCC
          33641]
 gi|238721841|gb|EEQ13503.1| hypothetical protein yfred0001_19040 [Yersinia frederiksenii ATCC
          33641]
          Length = 307

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 32/74 (43%), Gaps = 3/74 (4%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          ++  L I   +    A++C++     + N C+ +    +   L   Y+     +++  + 
Sbjct: 6  LLLFLPISLFSNAIFAMDCSKATTVTEKNICSSSQLLQLDAVLNKDYQ---AHIKQQDKV 62

Query: 65 LFEKSQMAWEIYRG 78
          + ++ Q+AW   R 
Sbjct: 63 VAKQQQLAWLKERD 76


>gi|163738103|ref|ZP_02145519.1| hypothetical protein RGBS107_06814 [Phaeobacter gallaeciensis
           BS107]
 gi|161388719|gb|EDQ13072.1| hypothetical protein RGBS107_06814 [Phaeobacter gallaeciensis
           BS107]
          Length = 53

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 21/48 (43%)

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            E +Q +WE +R + C F  +    G+   +   +C      +R E L
Sbjct: 1   METAQKSWEAFRDAHCDFVGATFGGGSGTGIAILSCRITLTRDRVEAL 48


>gi|239623765|ref|ZP_04666796.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239521796|gb|EEQ61662.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 297

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 30/80 (37%), Gaps = 1/80 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                 + + +L + Y  +LE + +         Q  W   R ++ A   +G   G+ + 
Sbjct: 196 AETELKMWEGELNSIYNALLELLPQEDAARLAAEQQEWLKTRETKAA-ENTGKSGGSVER 254

Query: 96  MIYANCLQGHAIERNEKLES 115
           + YA  L     +R  +L  
Sbjct: 255 IGYAATLASLTRDRAYELAG 274


>gi|237749665|ref|ZP_04580145.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
 gi|229374739|gb|EEO25130.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
          Length = 123

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 48/127 (37%), Gaps = 27/127 (21%)

Query: 1   MCRKIIFALTIIAIAFQSMAL---------NCNETLMQADMNQCTGN--SFALVKEKLEA 49
           M +     LT++ ++    A          +C +   + +   C+ +      + ++L  
Sbjct: 1   MTKTFFIILTMVFLSQSINAQSPKEAKPSFDCAKATTRVEKMICSDSSGELQNLDKQLFE 60

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
           +Y+ +  K++K+ ++    SQ +W   R   C                   CL+     R
Sbjct: 61  SYQAIKAKLDKNDKKALLDSQKSWLKTREK-CE---------------SKECLKELLQHR 104

Query: 110 NEKLESY 116
            ++L++Y
Sbjct: 105 IKELQNY 111


>gi|291535308|emb|CBL08420.1| Protein of unknown function (DUF1311) [Roseburia intestinalis
           M50/1]
          Length = 330

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 34/101 (33%), Gaps = 1/101 (0%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS-ECA 82
                Q +MN  +   F +   +L   + +  +  +   +E     Q  W   +      
Sbjct: 123 QAAQTQTEMNLSSRWFFDIWDTELNNLWSRFSDLADPQTKEKILAEQRNWIAMKEEVTLL 182

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
              S  E G+   ++  + L+     R   + + L   +G+
Sbjct: 183 HIGSYEENGSMYPLLQNSYLEEITKNRAYVIANELAKIKGE 223


>gi|240144973|ref|ZP_04743574.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
 gi|257202964|gb|EEV01249.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
          Length = 336

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 34/101 (33%), Gaps = 1/101 (0%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS-ECA 82
                Q +MN  +   F +   +L   + +  +  +   +E     Q  W   +      
Sbjct: 129 QAAQTQTEMNLSSRWFFDIWDTELNNLWSRFSDLADPQTKEKILAEQRNWIAMKEEVTLL 188

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
              S  E G+   ++  + L+     R   + + L   +G+
Sbjct: 189 HIGSYEENGSMYPLLQNSYLEEITKNRAYVIANELAKIKGE 229


>gi|197294950|ref|YP_002153491.1| hypothetical protein BCAS0098 [Burkholderia cenocepacia J2315]
 gi|195944429|emb|CAR57031.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 348

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 34/97 (35%), Gaps = 17/97 (17%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            +   +C +     +   C   + + +  +L   +K+ L   +       +++Q+ W   
Sbjct: 34  HAAGFDCAKAASPTEKTICANPALSKLDGELSTAWKRALA--QGGDTAALKQAQLKWLKQ 91

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           R  +C         G       A+CL+    ER   L
Sbjct: 92  RD-QC--------GGD------ASCLRDRYRERLASL 113


>gi|292489482|ref|YP_003532370.1| putative type VI secretion system-associated protein [Erwinia
           amylovora CFBP1430]
 gi|292898305|ref|YP_003537674.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291198153|emb|CBJ45258.1| putative exported protein [Erwinia amylovora ATCC 49946]
 gi|291554917|emb|CBA22864.1| putative type VI secretion system-associated hypothetical protein
           [Erwinia amylovora CFBP1430]
          Length = 135

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 58/129 (44%), Gaps = 14/129 (10%)

Query: 1   MCRKIIFALTI--IAIAFQSMAL-NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R +  ++ I  +  +F + A+ +C++      +  C  N+  + ++ L   Y    ++
Sbjct: 3   MNRLLSLSIYIITLQASFSAYAINDCSKETSDPAVFTCAENNKDVAEKNLNHEYLAAKKR 62

Query: 58  VEK-------HQRELF---EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN-CLQGHA 106
           +E         ++E      +SQ  W  YR  +C   A  A++ +   +++ N C+    
Sbjct: 63  IEDLFSHEADVKKEYLTNFIESQRGWLKYRDGQCKLYAHVADKNSNPYIVFTNHCIAQLD 122

Query: 107 IERNEKLES 115
            +R+++L+ 
Sbjct: 123 EDRSKQLKE 131


>gi|323496279|ref|ZP_08101337.1| hypothetical protein VISI1226_12021 [Vibrio sinaloensis DSM 21326]
 gi|323318556|gb|EGA71509.1| hypothetical protein VISI1226_12021 [Vibrio sinaloensis DSM 21326]
          Length = 410

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 36/98 (36%), Gaps = 16/98 (16%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKV---------EKHQRELFEKSQMAWEIYRGS 79
           Q DM        +    +L ATYKK++  +          K + +   + Q  W  +R +
Sbjct: 317 QGDMETV-STPLSKTDSQLNATYKKLMIALKQPSEDYAMSKPEVDDVREVQRRWIKHRDA 375

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
            C          + +  +   CL     +R ++L+  +
Sbjct: 376 TCNLIV------SVEPKLKEQCLNWLTAQREQELQGII 407


>gi|253690494|ref|YP_003019684.1| hypothetical protein PC1_4134 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|251757072|gb|ACT15148.1| conserved hypothetical protein [Pectobacterium carotovorum subsp.
          carotovorum PC1]
          Length = 309

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 9/74 (12%), Positives = 27/74 (36%), Gaps = 3/74 (4%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +  +  +        A++C++    ++   C  +    +   L   Y+  +++ +   + 
Sbjct: 6  LAVSSLLCLFTSSVWAMDCSKASTDSEKMICASSRLQQLDAVLNKAYQGYVKQAD---KA 62

Query: 65 LFEKSQMAWEIYRG 78
             + Q AW   R 
Sbjct: 63 QARQEQRAWLAERD 76


>gi|293603871|ref|ZP_06686286.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
 gi|292817708|gb|EFF76774.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
          Length = 276

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 27/74 (36%), Gaps = 1/74 (1%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-EKHQRE 64
          +  L+++  +  + A+ C++     +   C          +L   Y  +L+   +   + 
Sbjct: 11 MLLLSLVVASAPAFAIQCSKAASAVEKLICADKQTVAADTQLNRAYNAILKAAPDVDIQA 70

Query: 65 LFEKSQMAWEIYRG 78
          +   SQ  W   R 
Sbjct: 71 MLVASQKRWIEARD 84


>gi|58040101|ref|YP_192065.1| hypothetical protein GOX1668 [Gluconobacter oxydans 621H]
 gi|58002515|gb|AAW61409.1| Hypothetical protein GOX1668 [Gluconobacter oxydans 621H]
          Length = 131

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 44/107 (41%), Gaps = 5/107 (4%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-----RELF 66
           + +A  ++A          ++  C  +  A  + +L+   +  L +++        +  F
Sbjct: 1   MLLAQSALAAPVCSGKTTPEIQSCFSSRLAQAEAQLKRYTEAALRRMQGPGITARTQADF 60

Query: 67  EKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            K + AW  +R +EC   A    +GT ++ +  +C      ER  +L
Sbjct: 61  RKGESAWRAFREAECKAVAGRWSDGTIRTSMELSCRLKLTEERTYEL 107


>gi|146307989|ref|YP_001188454.1| hypothetical protein Pmen_2967 [Pseudomonas mendocina ymp]
 gi|145576190|gb|ABP85722.1| protein of unknown function DUF1311 [Pseudomonas mendocina ymp]
          Length = 125

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL---FEK 68
           +AI+       C +    A  N C G ++   +++L+ +Y ++L   ++++ EL      
Sbjct: 13  MAISAAESEDPCQQGSAMAA-NLCHGPAWQAAEDELQRSYDRLLSHFKEYEPELVVELRD 71

Query: 69  SQMAWEIYRGSECA-FAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +Q +W   R   C+ +A S  +         A C+   A  R   L++ L 
Sbjct: 72  AQRSWIRQREQSCSLYARSRVQGSPWTGFWAAQCMAEQARARAAWLKTMLE 122


>gi|315637378|ref|ZP_07892592.1| conserved hypothetical protein [Arcobacter butzleri JV22]
 gi|315478325|gb|EFU69044.1| conserved hypothetical protein [Arcobacter butzleri JV22]
          Length = 159

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 26/47 (55%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
           S+ L  ++L   Y+K++ K+   ++EL ++SQ  W  +R     F +
Sbjct: 66  SYELWDKELNIYYRKLMSKLTAKEKELLKESQKKWLEFRDKTIEFNS 112


>gi|167624844|ref|YP_001675138.1| hypothetical protein Shal_2930 [Shewanella halifaxensis HAW-EB4]
 gi|167354866|gb|ABZ77479.1| protein of unknown function DUF1176 [Shewanella halifaxensis
           HAW-EB4]
          Length = 491

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 36/113 (31%), Gaps = 6/113 (5%)

Query: 8   ALTIIAIAFQSMALNCNE--TLMQADMNQCTGNSFALVKEKLEATYKKVLE----KVEKH 61
             T+I     +  ++C          M +C     A V+ KL    + +           
Sbjct: 368 VSTVIVGDDPAAGIDCRSEHAYSTEGMTKCALRELASVELKLTEVIESINALESVTANAE 427

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
               F ++Q +W  YR   C        EGT    +   C      +R  +L+
Sbjct: 428 LTAAFSQAQASWLTYRNDVCMAERLTYAEGTMGLPVLIGCKLELTEKRLRELQ 480


>gi|254519766|ref|ZP_05131822.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
 gi|226913515|gb|EEH98716.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
          Length = 209

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 35/90 (38%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++  +   M    G S+ +  + L   Y  + E++     +  +  Q+ W   + +    
Sbjct: 113 SDAGITNAMRSFYGISYDMYDKALNEIYALLKEQLSPETMQNLQSEQIKWIEKKEATATN 172

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            A   + G+ + + Y + L G    R  +L
Sbjct: 173 EAEKYKGGSFEFVAYNSSLYGTTKNRCYEL 202


>gi|209515942|ref|ZP_03264803.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209503600|gb|EEA03595.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 161

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 45/108 (41%), Gaps = 11/108 (10%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-----------FEKSQ 70
           +  E    +D+ QC+   F     +L+ + +    K+E + + L           F KSQ
Sbjct: 53  DTGEHASNSDLAQCSHRKFDHAARELDKSLQSAKSKIESNDKSLKEEGEPLALPYFLKSQ 112

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            AW  YR +EC        E T + + +  C+     +R ++L+  L 
Sbjct: 113 DAWTQYRDNECYTETYMMGEATERYIFFWECMANITQDRVKELQEVLK 160


>gi|259907304|ref|YP_002647660.1| hypothetical protein EpC_06280 [Erwinia pyrifoliae Ep1/96]
 gi|224962926|emb|CAX54407.1| Putative exported protein [Erwinia pyrifoliae Ep1/96]
 gi|283477123|emb|CAY73023.1| putative type VI secretion system-associated hypothetical protein
           [Erwinia pyrifoliae DSM 12163]
          Length = 133

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 42/117 (35%), Gaps = 14/117 (11%)

Query: 12  IAIAFQSMA-LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK---------- 60
           + I+  + A  +C +      +  C   +    ++ L   Y     +++           
Sbjct: 14  LQISCSAYAIDDCAKETSDPAVFTCAEKNKDTAEKNLNHEYLAAKTRIDDLFSHEADVKK 73

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY--ANCLQGHAIERNEKLES 115
                F +SQ  W  YR  +C   A  A++ +    I    NC+      R+++L+ 
Sbjct: 74  EYLTTFIESQRGWLKYRDGQCKLFAHIADKNS-NPYIVFTNNCIAELDENRSKQLKE 129


>gi|257126362|ref|YP_003164476.1| hypothetical protein Lebu_1613 [Leptotrichia buccalis C-1013-b]
 gi|257050301|gb|ACV39485.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 146

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 26/75 (34%), Gaps = 2/75 (2%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS--ECAFAASGAEEGTAQSMIYANC 101
            ++L   Y+K+++      +     +Q AW   R      ++     E G+   +   N 
Sbjct: 65  DKELNIVYQKIMKIANTKTKNNLRNAQRAWLKSRDKKVHDSYYFENPEGGSMGVLFSLNT 124

Query: 102 LQGHAIERNEKLESY 116
                 +R  +L   
Sbjct: 125 NVKLLEQRTLELAEM 139


>gi|254510903|ref|ZP_05122970.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221534614|gb|EEE37602.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 106

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/105 (16%), Positives = 34/105 (32%), Gaps = 8/105 (7%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE--------KHQRELFEKSQMAW 73
            C +   Q ++  C  +    V   ++++Y   +   +               E SQ  W
Sbjct: 2   ECLDAGSQVEIGTCVSDMETRVNAAIKSSYSLAIGAAQELDDVTGRAVAVPALEASQTTW 61

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             YR ++C    +    G+   +    C       R ++L  Y  
Sbjct: 62  AAYRDAQCEAVGASFGGGSGTGIAITACRVDLGRARVDELLRYAN 106


>gi|323165332|gb|EFZ51120.1| hypothetical protein SS53G_4432 [Shigella sonnei 53G]
          Length = 115

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 37/105 (35%), Gaps = 21/105 (20%)

Query: 35  CTGNSFALVKEKLEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAF 83
           C    + LV  +L   Y +             +K +  Q  L +KSQ AW  +R  EC  
Sbjct: 5   CLRQEYNLVDAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECEL 64

Query: 84  AASGAEEGTAQSM-------IYANCLQGHAIERNEKLESYLTCPE 121
             S  +    Q +        + +C+      R  +L+ Y    +
Sbjct: 65  ILSNED---VQDLSDPYSESEWLSCMIIQTNTRTRQLQLYRNSED 106


>gi|311030934|ref|ZP_07709024.1| hypothetical protein Bm3-1_10376 [Bacillus sp. m3-13]
          Length = 200

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 27/70 (38%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
            E L   Y  + E++   +     + Q  W  +R      A+   + GT + + Y   L 
Sbjct: 125 DELLNEIYGVLEEQLSAEEMSQLREEQRNWIKFRDDSALEASHKFKGGTQEHLEYVAVLA 184

Query: 104 GHAIERNEKL 113
            H  ER  +L
Sbjct: 185 NHTEERCYEL 194


>gi|289806841|ref|ZP_06537470.1| putative secreted protein [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
          Length = 48

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 10/48 (20%), Positives = 20/48 (41%)

Query: 2  CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEA 49
           ++I      +  + Q++A  C     Q +MN+C    +    +KL  
Sbjct: 1  MKRIFLTCAALLFSSQALADECASASTQLEMNRCAAAQYQAADKKLNE 48


>gi|237744098|ref|ZP_04574579.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|229431327|gb|EEO41539.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
          Length = 141

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 52/132 (39%), Gaps = 18/132 (13%)

Query: 2   CRKIIFALTII----AIAFQSMALNC--------NETLM------QADMNQCTGNSFALV 43
            +KI+F + I+    A +  S   +          +          ADM+  T       
Sbjct: 1   MKKILFTMMILFGISAFSSNSYETDLVGRMKVLEEKAQTKLDSGVTADMSNATTELSEAW 60

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   EK Q  W   R  +   AA  AE GT + +++   ++
Sbjct: 61  ENELNTVYSLLMEKLPKAEKNRLEKEQKVWLKNRNIKAKEAAKEAEGGTMEPLLFGASIK 120

Query: 104 GHAIERNEKLES 115
               +R  +L  
Sbjct: 121 DLNEKRAIELAK 132


>gi|289665238|ref|ZP_06486819.1| hypothetical protein XcampvN_19750 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 196

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
           C    +A    +L   Y ++L+ +   +    ++ +  W  +R + C  +      G A+
Sbjct: 116 CNHQEYAYQDARLNKVYARLLKSLPAEKTASLKQEERDWIKWRDTLCQ-SKGALGGGQAE 174

Query: 95  SMIYANCLQGHAIERNEKLES 115
            +  ++C      +R E+LE 
Sbjct: 175 ELEDSSCELNATSKRAEELEK 195


>gi|256028082|ref|ZP_05441916.1| hypothetical protein PrD11_08834 [Fusobacterium sp. D11]
 gi|289766026|ref|ZP_06525404.1| conserved hypothetical protein [Fusobacterium sp. D11]
 gi|289717581|gb|EFD81593.1| conserved hypothetical protein [Fusobacterium sp. D11]
          Length = 141

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 52/132 (39%), Gaps = 18/132 (13%)

Query: 2   CRKIIFALTII----AIAFQSMALNC--------NETLM------QADMNQCTGNSFALV 43
            +KI+F + I+    A +  S   +          +          ADM+  T       
Sbjct: 1   MKKILFTMMILFGISAFSSNSYETDLVGRMKVLEEKAQTKLDSGVTADMSNATTELSEAW 60

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   EK Q  W   R  +   AA  AE GT + +++   ++
Sbjct: 61  ENELNTVYSLLMEKLPKAEKNKLEKEQKVWLKNRNIKAKEAAKEAEGGTMEPLLFGASIK 120

Query: 104 GHAIERNEKLES 115
               +R  +L  
Sbjct: 121 DLNEKRAIELAK 132


>gi|15807203|ref|NP_295932.1| hypothetical protein DR_2210 [Deinococcus radiodurans R1]
 gi|6460018|gb|AAF11763.1|AE002054_8 hypothetical protein DR_2210 [Deinococcus radiodurans R1]
          Length = 127

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 34/91 (37%), Gaps = 10/91 (10%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           CN  +   D   C          ++   Y+K+L K+    ++   ++Q AW   R ++C 
Sbjct: 29  CNYPVGTFDQVYCVNKVTLQADTEMNTAYQKLLRKLPVSAQQTLRQTQRAWMAKRDNDC- 87

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                 +  T    +Y NC     + R   L
Sbjct: 88  -----VDGYT----VYVNCTHDMTVSRLNFL 109


>gi|157372684|ref|YP_001480673.1| hypothetical protein Spro_4451 [Serratia proteamaculans 568]
 gi|157324448|gb|ABV43545.1| protein of unknown function DUF1311 [Serratia proteamaculans 568]
          Length = 143

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 3/82 (3%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
            C    F L   +L   YK+ L+       + + ++Q  W  ++ S+C    +    G+ 
Sbjct: 59  ACIEAEFKLWDARLNKAYKESLKFKAAP--KAWREAQRNWLKFKDSQCLALVAAPH-GSG 115

Query: 94  QSMIYANCLQGHAIERNEKLES 115
            ++  A+C     I+R  +LES
Sbjct: 116 DALDSASCQLNMTIDRTLQLES 137


>gi|325525409|gb|EGD03237.1| hypothetical protein B1M_17465 [Burkholderia sp. TJI49]
          Length = 332

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 31/72 (43%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          + AL  + +A ++ + +C+      +   CT    + + E+L+ TY+  L   +      
Sbjct: 15 LVALGCLPVAARAASFDCHAARTSIEQAICTDAELSRLDEQLDDTYRVALGVADGDAATD 74

Query: 66 FEKSQMAWEIYR 77
             +Q AW   R
Sbjct: 75 LRTTQRAWLKAR 86


>gi|91777730|ref|YP_552938.1| hypothetical protein Bxe_B2403 [Burkholderia xenovorans LB400]
 gi|91690390|gb|ABE33588.1| hypothetical protein Bxe_B2403 [Burkholderia xenovorans LB400]
          Length = 229

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/103 (15%), Positives = 42/103 (40%), Gaps = 12/103 (11%)

Query: 23  CNE-TLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----------EKHQRELFEKSQ 70
           C +      D++ C    F  V ++L+  ++++ +++           E       +K+Q
Sbjct: 121 CEKVASATIDLSVCAQFRFEGVAQELDRKFREIEKEIVIGDKDRRAIGEPEATPYLKKAQ 180

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             W+ YR ++C        + + + + + +C+      R  +L
Sbjct: 181 ANWKRYRDNQCYARTYEVGQASLRFVEFWDCMARVTRNRLNEL 223


>gi|188580223|ref|YP_001923668.1| hypothetical protein Mpop_0956 [Methylobacterium populi BJ001]
 gi|179343721|gb|ACB79133.1| protein of unknown function DUF1311 [Methylobacterium populi BJ001]
          Length = 164

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 23/87 (26%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
                M  C           L   Y++ +   ++  +   +  Q  W  +R   C +   
Sbjct: 68  SSTMGMMACFDRENTAWDALLNRAYREAMSAFDEGGKAYLKGVQHTWLKFRAQACDWPGR 127

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL 113
               GT    +   C       R   L
Sbjct: 128 VYPGGTIGGPLSGECSMEQTALRALDL 154


>gi|77461447|ref|YP_350954.1| hypothetical protein Pfl01_5226 [Pseudomonas fluorescens Pf0-1]
 gi|77385450|gb|ABA76963.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 133

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 52/129 (40%), Gaps = 15/129 (11%)

Query: 2   CRKIIFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + I  AL +IA    +   +    C+         +C+  S    ++ L+  Y  + E+
Sbjct: 1   MKSIFLALALIATGVHAAEESDNNPCDAVENDIQTLECSTYSRTTAEDLLKDNYASLNER 60

Query: 58  VE----------KHQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           ++                 + +Q  W   R ++CA  A  A +G+ A  +   +C+   +
Sbjct: 61  MQTTYGKNPAQLADITARLKAAQQQWLKTRDADCAVEAFPATDGSKAFKIAQNDCVARMS 120

Query: 107 IERNEKLES 115
            ER+E LES
Sbjct: 121 DERSEFLES 129


>gi|239904891|ref|YP_002951629.1| hypothetical protein DMR_02520 [Desulfovibrio magneticus RS-1]
 gi|239794754|dbj|BAH73743.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 145

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 46  KLEATYKKVLEKVEKHQR--ELFEKSQMAWEIYRGSECAF---AASGAEEGTAQSMIYAN 100
           +L A Y  VL+K    +   +  + +Q AW  +R +E A    A    E G+A  + + N
Sbjct: 53  ELNAVYTAVLKKNADDKNFIDKLKVAQRAWVAFRDAEMAARYPARDKGEYGSAFDLCWCN 112

Query: 101 CLQGHAIERNEKLESYLT-CPEGDL 124
            L     +R E+L+ +    PEGD+
Sbjct: 113 GLAALTQQRTEQLKPWRDGIPEGDV 137


>gi|320198572|gb|EFW73172.1| hypothetical protein ECoL_03996 [Escherichia coli EC4100B]
          Length = 120

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 38/112 (33%), Gaps = 30/112 (26%)

Query: 6   IFALTIIAIAFQSMALN--------------C--NETLMQADMNQ---CTGNSFALVKEK 46
              LT+  I+ Q+ A +              C    +    D+N    C    + LV  +
Sbjct: 4   FLVLTLGIISCQAYAEDTVIVNDHDISAIKDCWQKNSDDDTDVNVIKSCLRQEYNLVDAQ 63

Query: 47  LEATYKKVL-----------EKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
           L   Y +             +K +  Q  L +KSQ AW  +R  EC    S 
Sbjct: 64  LNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSN 115


>gi|95930907|ref|ZP_01313637.1| hypothetical protein Dace_0667 [Desulfuromonas acetoxidans DSM 684]
 gi|95133033|gb|EAT14702.1| hypothetical protein Dace_0667 [Desulfuromonas acetoxidans DSM 684]
          Length = 165

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 30/85 (35%), Gaps = 10/85 (11%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF------AASGAEEGTAQSMI 97
             +L   Y  +   ++K  +E  ++SQ AW   R     F             GT   ++
Sbjct: 76  DRELNDYYHALYNTLDKQGQEALKQSQRAWLKERDLSIDFNTLLLNQKYSTRSGTMFLLM 135

Query: 98  YANCLQGHA----IERNEKLESYLT 118
            A   +        +R  +L+ +L 
Sbjct: 136 RAGDAEELTQDIVKQRALQLKKWLE 160


>gi|78060738|ref|YP_367313.1| hypothetical protein Bcep18194_C7625 [Burkholderia sp. 383]
 gi|77965288|gb|ABB06669.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 334

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 30/97 (30%), Gaps = 17/97 (17%)

Query: 17  QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            +   +C +     +   C   + + +   L AT+K+ L K         + +Q+ W   
Sbjct: 20  HAAGFDCAKAASPTEKAICADATLSKLDGDLAATWKQALAK--GGDTAALKAAQLKWLKQ 77

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           R   C         G         CL     ER   L
Sbjct: 78  RD-RC--------GGD------EQCLGDRYRERLASL 99


>gi|190571988|ref|YP_001967713.1| hypothetical protein pCNB_p69 [Comamonas testosteroni CNB-1]
 gi|119943726|gb|ABM06240.1| hypothetical protein [Comamonas testosteroni CNB-1]
          Length = 274

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 42/114 (36%), Gaps = 4/114 (3%)

Query: 4   KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-EKHQ 62
           +++   ++ A+A  + A++C +     +   C+         +L   Y  +L++  +   
Sbjct: 9   RLLCLASLYALAAPAYAIDCAKAATAVEKLICSDRKTVAADAELNRAYAAILKQAPDGDI 68

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTA-QSMIYANCLQGHAIERNEKLES 115
           R +   SQ  W + R    A      + G+       A   +     R  +L+ 
Sbjct: 69  RAMLAHSQKRWIVARDG--ALMNLIEDPGSVPAGKTVAGVARDLIQSRTAQLKE 120


>gi|260494308|ref|ZP_05814439.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|260198454|gb|EEW95970.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
          Length = 141

 Score = 54.1 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 52/132 (39%), Gaps = 18/132 (13%)

Query: 2   CRKIIFALTII----AIAFQSMALNC--------NETLM------QADMNQCTGNSFALV 43
            +KI+F + I+    A +  S   +          +          ADM+  T       
Sbjct: 1   MKKILFTMMILFGISAFSSNSYETDLVGRMKVLEEKAQTKLDSGVTADMSNATTELSEAW 60

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   EK Q  W   R  +   AA  AE GT + +++   ++
Sbjct: 61  ENELNTVYSLLMEKLPKVEKIKLEKEQKTWLKSRNIKAKEAAKEAEGGTMEPLLFGASIK 120

Query: 104 GHAIERNEKLES 115
               +R  +L  
Sbjct: 121 DLNEKRAVELAK 132


>gi|330504907|ref|YP_004381776.1| hypothetical protein MDS_3993 [Pseudomonas mendocina NK-01]
 gi|328919193|gb|AEB60024.1| protein of unknown function DUF1311 [Pseudomonas mendocina NK-01]
          Length = 242

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 10/73 (13%), Positives = 24/73 (32%), Gaps = 3/73 (4%)

Query: 43  VKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA-FAASGAEEGTAQSMIYANC 101
               L   Y++   ++         ++Q  W   R +EC  +        +       +C
Sbjct: 165 ADALLNTAYRERQRQLSDEAGTALRQAQRNWIAMRDAECKPYGEEQPY--SVFGEFSYDC 222

Query: 102 LQGHAIERNEKLE 114
           +    ++R  +L 
Sbjct: 223 MVRLTLDRARQLA 235


>gi|291538106|emb|CBL11217.1| Protein of unknown function (DUF1311) [Roseburia intestinalis
           XB6B4]
          Length = 333

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 34/101 (33%), Gaps = 1/101 (0%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
                Q +MN  +   F +   +L   + +  +  +   +E     Q  W   +      
Sbjct: 126 QAAQTQTEMNLSSRWFFDIWDTELNNLWSRFSDLADPQTKEKILTEQRNWIDMKEEVTLL 185

Query: 84  -AASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGD 123
              S  E G+   ++  + L+     R   + + L   +G+
Sbjct: 186 DIGSYEENGSMYPLLQNSYLEEITKNRAYVIANELAKIKGE 226


>gi|254249136|ref|ZP_04942456.1| hypothetical protein BCPG_03996 [Burkholderia cenocepacia PC184]
 gi|124875637|gb|EAY65627.1| hypothetical protein BCPG_03996 [Burkholderia cenocepacia PC184]
          Length = 106

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 42/109 (38%), Gaps = 17/109 (15%)

Query: 19  MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ---------RELFEKS 69
           MA  C     Q ++          V ++L  TY+KVL+ + + +         +  F  +
Sbjct: 1   MAPECLLQRSQDEL--------QRVDDELNRTYQKVLKSLSRPRDEYVDYPALKVKFVAA 52

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           Q  W  +   EC+      E G  +++    C      +R  +L ++L 
Sbjct: 53  QRQWLRFIDDECSAWYLINEAGADRNLDLLTCEIDRTRDRTRELNAWLK 101


>gi|167031348|ref|YP_001666579.1| hypothetical protein PputGB1_0330 [Pseudomonas putida GB-1]
 gi|166857836|gb|ABY96243.1| protein of unknown function DUF1311 [Pseudomonas putida GB-1]
          Length = 133

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 47/122 (38%), Gaps = 11/122 (9%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ A+   A A +  +  C+          C   +    + +L+A Y  +++++     E
Sbjct: 8   VLLAVVSGAQAGEEESTPCDNVETDQQTYACAAFNKQTAERELKAAYDDLIQRIRDQYAE 67

Query: 65  ----------LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKL 113
                       + ++  W   R ++C       + G+ A    +  C+   + +R+E L
Sbjct: 68  EGDQATALIGRMDAAEKLWTQLRDADCKAETYAEKPGSKAFQAAWDTCVAQRSDDRSEYL 127

Query: 114 ES 115
           +S
Sbjct: 128 QS 129


>gi|92118330|ref|YP_578059.1| hypothetical protein Nham_2828 [Nitrobacter hamburgensis X14]
 gi|91801224|gb|ABE63599.1| hypothetical protein Nham_2828 [Nitrobacter hamburgensis X14]
          Length = 557

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 40/119 (33%), Gaps = 10/119 (8%)

Query: 5   IIFALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATY-KKVLEKVE 59
           ++    ++     + A     +C +   Q D   C  ++   +  ++   Y K +    +
Sbjct: 10  VMCCALMLLPTALANASGPGFDCAKATRQIDKAICAWDTVGSLDGRMATAYTKAIAAHND 69

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI-----YANCLQGHAIERNEKL 113
           +      +  Q AW   R   CA      +EG+   +         CLQ     R  +L
Sbjct: 70  EAAIASVKADQKAWLSERDRRCALKTVKPKEGSEDGLSPQQFGQLMCLQSIYPPRIAQL 128


>gi|157962642|ref|YP_001502676.1| hypothetical protein Spea_2822 [Shewanella pealeana ATCC 700345]
 gi|157847642|gb|ABV88141.1| protein of unknown function DUF1176 [Shewanella pealeana ATCC
           700345]
          Length = 485

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 37/113 (32%), Gaps = 6/113 (5%)

Query: 8   ALTIIAIAFQSMALNCNE--TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
             T+I     +  ++C          M +C     A V+ KL    K +           
Sbjct: 362 VSTVILGDDPAAGIDCQSEQAYNTEGMTKCGQLELANVEWKLTEVIKSISALEHVANNSE 421

Query: 66  FE----KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                 ++Q +W  YR   C       E+G+    +   C      +R ++L+
Sbjct: 422 LSTAYGQAQSSWLSYRNDACRAEMLTYEQGSMAIPVLIGCKLDLTEKRLKELQ 474


>gi|226192748|pdb|3GI7|A Chain A, Crystal Structure Of A Duf1311 Family Protein (Pp0307)
           From Pseudomonas Putida Kt2440 At 1.85 A Resolution
 gi|226192749|pdb|3GI7|B Chain B, Crystal Structure Of A Duf1311 Family Protein (Pp0307)
           From Pseudomonas Putida Kt2440 At 1.85 A Resolution
          Length = 122

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 40/101 (39%), Gaps = 7/101 (6%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK------VEKHQRELFEKSQMAWEIY 76
           C+          C   +  + + +L++ Y +++E+       E       E ++  W   
Sbjct: 10  CDNVETDQQTFACAAFNKQVAERELQSAYDELIERXRDQFGDEAGLXSRIEAAEKVWSQL 69

Query: 77  RGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESY 116
           R ++C       + G+ A  + + +C+   + ER E L S 
Sbjct: 70  RDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYLRSL 110


>gi|83942683|ref|ZP_00955144.1| hypothetical protein EE36_16622 [Sulfitobacter sp. EE-36]
 gi|83846776|gb|EAP84652.1| hypothetical protein EE36_16622 [Sulfitobacter sp. EE-36]
          Length = 163

 Score = 53.7 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 38/118 (32%), Gaps = 13/118 (11%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL---EKVEKHQ--- 62
           +  + ++      +         M  C         ++L   Y  V+   ++++      
Sbjct: 41  MACVGVSANQCMEDSPGGSSTYGMGGCLDRELQFWDQRLNDNYAAVMVQAKRMDADAIPG 100

Query: 63  -------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                   +   + Q AW ++R   C + AS  + GT +     NCL      +   L
Sbjct: 101 PEGSPGVADALREMQRAWIVFRDKACTYEASLWQGGTGRGPAAINCLMQQTARQALSL 158


>gi|313145035|ref|ZP_07807228.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313130066|gb|EFR47683.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 359

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 43/115 (37%), Gaps = 25/115 (21%)

Query: 11  IIAIAFQSMA-------LNCNETLMQADMNQCTGN--SFALVKEKLEATYKKVLEKVEKH 61
           +++I+  + +        +C +   + +   C  +      +  ++  +Y+    K++K+
Sbjct: 1   MLSISVNAQSPQEAKPSFDCAKATTKVEKMICEDSSGELQNLDRQISQSYQDTKAKLDKN 60

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            ++    SQ +W   R   C                   CL+     R ++L+SY
Sbjct: 61  AKKALLDSQKSWLKTRE-RCE---------------SKECLKESLQSRIKELQSY 99


>gi|170747880|ref|YP_001754140.1| hypothetical protein Mrad2831_1462 [Methylobacterium
          radiotolerans JCM 2831]
 gi|170654402|gb|ACB23457.1| conserved hypothetical protein [Methylobacterium radiotolerans
          JCM 2831]
          Length = 314

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 11/66 (16%), Positives = 23/66 (34%), Gaps = 1/66 (1%)

Query: 15 AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQMAW 73
             + A++C +     +   C   +       L + Y  +L   +  + R +   SQ  W
Sbjct: 29 PSPARAIDCRKAASPLERMICADAALRKADAALGSAYGGLLRGTDDAEIRAMLVASQKRW 88

Query: 74 EIYRGS 79
             R +
Sbjct: 89 VAARDT 94


>gi|330821653|ref|YP_004350515.1| hypothetical protein bgla_2g25750 [Burkholderia gladioli BSR3]
 gi|327373648|gb|AEA65003.1| hypothetical protein bgla_2g25750 [Burkholderia gladioli BSR3]
          Length = 347

 Score = 53.7 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 29/77 (37%), Gaps = 6/77 (7%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          + +I  L I++ A Q+   +C +     +   C     +   E L+A Y +V        
Sbjct: 13 KLLIATLAILSSAAQAAGFDCAKASSPTEQRICADAQLSKQDETLQALYAQV------PA 66

Query: 63 RELFEKSQMAWEIYRGS 79
             +   Q AW   R +
Sbjct: 67 SPDWRADQRAWLARRDA 83


>gi|83953922|ref|ZP_00962643.1| hypothetical protein NAS141_06843 [Sulfitobacter sp. NAS-14.1]
 gi|83841867|gb|EAP81036.1| hypothetical protein NAS141_06843 [Sulfitobacter sp. NAS-14.1]
          Length = 163

 Score = 53.4 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 38/118 (32%), Gaps = 13/118 (11%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL---EKVEKHQ--- 62
           +  + ++      +         M  C         ++L   Y  V+   ++++      
Sbjct: 41  MACVGVSANQCMEDSPGGSSTYGMGGCLDRELQFWDQRLNDNYAAVMVQAKRMDADAIPG 100

Query: 63  -------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                   +   + Q AW ++R   C + AS  + GT +     NCL      +   L
Sbjct: 101 PEGSPGVADALREMQRAWIVFRDKACTYEASLWQGGTGRGPAAINCLMQQTARQALSL 158


>gi|254487428|ref|ZP_05100633.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214044297|gb|EEB84935.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 162

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 30/97 (30%), Gaps = 13/97 (13%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVE-------------KHQRELFEKSQMAWEIYRG 78
           M  C     A     L + YK  + + +                       Q AW  +R 
Sbjct: 64  MGGCLERELAYWDGLLNSHYKAAMAQAKSLDADRPASMKDLPGAATALRDMQRAWIPFRD 123

Query: 79  SECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             CA+ AS    GT Q     +CL     ++   LE 
Sbjct: 124 KACAYEASLWSGGTGQGPAALSCLLQQTAKQALTLEP 160


>gi|78061672|ref|YP_371580.1| hypothetical protein Bcep18194_B0822 [Burkholderia sp. 383]
 gi|77969557|gb|ABB10936.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 262

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/111 (12%), Positives = 36/111 (32%), Gaps = 18/111 (16%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           +  A   ++++  + +++C+    + D   C+  +       L + Y   +       ++
Sbjct: 8   LTLAAIGLSLSAHADSIDCSRAKTRTDRLICSDKALVSADSALSSAYYDAVGI--AADQQ 65

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              +SQ  W   R +                   A C+     +R   L+ 
Sbjct: 66  AVIQSQRTWLKQRDACGD----------------AACVATAYRDRTAALKQ 100


>gi|119386342|ref|YP_917397.1| hypothetical protein Pden_3634 [Paracoccus denitrificans PD1222]
 gi|119376937|gb|ABL71701.1| protein of unknown function DUF1311 [Paracoccus denitrificans
           PD1222]
          Length = 179

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 39/115 (33%), Gaps = 16/115 (13%)

Query: 18  SMALNCNETL---MQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-------------H 61
           + A  C ++        M+ C GN   L   +L  TY++V+ + E               
Sbjct: 60  AAADPCMDSQGGSTTVGMSACLGNELDLWDARLNETYREVMAQSEATDGNMAELGSAAEK 119

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           +  L    Q  W  +R + C F  S    GT       +C       +   L+ Y
Sbjct: 120 ESPLLRDMQRNWIAFRDTACGFERSRWGGGTDGGPAGLHCALTLTARQYLWLDQY 174


>gi|310815110|ref|YP_003963074.1| hypothetical protein EIO_0613 [Ketogulonicigenium vulgare Y25]
 gi|308753845|gb|ADO41774.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 123

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 41/96 (42%), Gaps = 1/96 (1%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE-KVEKHQRELFEKSQMAWEIYRGSE 80
           +C +    +++  C    ++  + +++     ++      ++      +Q  W+ +R  E
Sbjct: 24  DCPDASSTSEIVVCLNELYSTAQLEMQVRLDGLVAGMASSNRVAALNAAQAVWKAFRQLE 83

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           C   A  AE GT  +++ A+C      +R   L +Y
Sbjct: 84  CESQALIAEGGTLANVLGASCYLHMTRDRIVALNAY 119


>gi|83954438|ref|ZP_00963158.1| hypothetical protein NAS141_19069 [Sulfitobacter sp. NAS-14.1]
 gi|83841475|gb|EAP80645.1| hypothetical protein NAS141_19069 [Sulfitobacter sp. NAS-14.1]
          Length = 148

 Score = 53.0 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
            ++   +  L A  +    K +     L + SQ+A+E YR   CAF       GTA   +
Sbjct: 66  RAYLDAQAALAAFDQAFSRKADASASALLQSSQIAFEEYRKYHCAFPERLMLGGTAAINV 125

Query: 98  YANCLQGHAIERNEKLESY 116
              C       R E+L+ Y
Sbjct: 126 TLGCRIDLTRSRIEQLQDY 144


>gi|126725440|ref|ZP_01741282.1| hypothetical protein RB2150_04528 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704644|gb|EBA03735.1| hypothetical protein RB2150_04528 [Rhodobacterales bacterium
           HTCC2150]
          Length = 133

 Score = 53.0 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 51/125 (40%), Gaps = 10/125 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV---LEK 57
           M R ++     I ++    A      +  A+ + C  +    +++++ A Y  +   + +
Sbjct: 1   MKRMLVTFFAAIFLSGGVSADENCSGMSNAEKSYCLVDLADFLEKQMVAAYISLDREIAR 60

Query: 58  VEKHQ-------RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           +E          R+  + SQ+ +E +R   C+F  + A  G    +I   C+     +R 
Sbjct: 61  LEGKSNAFALELRKNLQPSQIGFEAFREPYCSFEIASAMGGNGSGLIRQMCINDMTTQRT 120

Query: 111 EKLES 115
           + L +
Sbjct: 121 KYLRT 125


>gi|317405175|gb|EFV85516.1| hypothetical protein HMPREF0005_04025 [Achromobacter xylosoxidans
           C54]
          Length = 129

 Score = 53.0 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 33/86 (38%), Gaps = 8/86 (9%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVE---KHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
            C     A  K ++   Y +V  ++           E++Q AW  YR   CA   +GA  
Sbjct: 46  ACAEGVSAAAKREINTLYARVQARLATDYPDDAAKLEQTQKAWLAYRNGHCAL--AGAHV 103

Query: 91  GTAQSMIYANCLQGHAIERNEKLESY 116
           G+   M Y  C     I R ++L   
Sbjct: 104 GS--PM-YEYCPMLLNINRADELREL 126


>gi|227114494|ref|ZP_03828150.1| hypothetical protein PcarbP_16113 [Pectobacterium carotovorum
          subsp. brasiliensis PBR1692]
          Length = 309

 Score = 53.0 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 22/59 (37%), Gaps = 3/59 (5%)

Query: 20 ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
          A++C++     +   C  +    +   L   Y+   +K     +    ++Q AW   R 
Sbjct: 21 AIDCSKASADTEKMICASSRLQQLDTVLNKAYQGYAKK---EDKAQALQAQRAWLAERD 76


>gi|167580980|ref|ZP_02373854.1| hypothetical protein BthaT_22707 [Burkholderia thailandensis TXDOH]
          Length = 141

 Score = 53.0 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 39/107 (36%), Gaps = 6/107 (5%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATY-KKVLEKVEKHQRELFEKS 69
           + A    ++  +C+    Q  MN C      + + +L+    ++V E     ++   E  
Sbjct: 32  LPASEVSALLADCDSN--QTSMNFCAWRDRIVAERELQQVVDRQVSEH--PDRKSALEAK 87

Query: 70  QMAWEIYRGSECAFAASGAEE-GTAQSMIYANCLQGHAIERNEKLES 115
              W+  R + C  AA      G+ +      C      +  +KL +
Sbjct: 88  IAKWKKARDASCEKAARKEWGDGSMRPTAQTVCQTESTKKMTKKLSA 134


>gi|170725337|ref|YP_001759363.1| hypothetical protein Swoo_0975 [Shewanella woodyi ATCC 51908]
 gi|169810684|gb|ACA85268.1| hypothetical protein Swoo_0975 [Shewanella woodyi ATCC 51908]
          Length = 137

 Score = 53.0 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 52/133 (39%), Gaps = 9/133 (6%)

Query: 2   CRKIIFALTIIAIAFQSMALN----CNET-LMQADMNQCTGNSFALVKEKLEATYKKVLE 56
            +K +  L  +     +        C+E     ++M QC   +    ++++ A    +  
Sbjct: 1   MKKYLAPLIFLMFVNMAYGQQTFIGCDELWQTMSEMVQCQMKANQAKEQEISALINTIQS 60

Query: 57  KVEKHQRELFE-KSQMAWEIYRGSECAFAA-SGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             +  +R L   KSQ  W  Y  SEC     SGA  GT+ +  Y  C       R ++L+
Sbjct: 61  SFKVKKRSLSVLKSQEHWVNYVESECRSRMISGALSGTSNAARYHICRNEKLSSRLDELQ 120

Query: 115 SYLTCPEGDLLCP 127
            Y  C   D  CP
Sbjct: 121 KYHYCD--DNGCP 131


>gi|325522788|gb|EGD01268.1| hypothetical protein B1M_27421 [Burkholderia sp. TJI49]
          Length = 371

 Score = 53.0 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 33/106 (31%), Gaps = 17/106 (16%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL  + IA  +   +C +     +   C   + + +  +L   +K  L K         +
Sbjct: 36  ALLGLPIAAHAAGFDCAKAASPTEKAICADAALSRLDGELATAWKAALAK--GGDTGALK 93

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            SQ+ W   R   C                  +CL     ER   L
Sbjct: 94  ASQLKWLKQRD-RCGADR--------------DCLGDRYRERLASL 124


>gi|328766173|gb|EGF76231.1| hypothetical protein BATDEDRAFT_28709 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 245

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 30/82 (36%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M    G S+ +  ++L   Y  + +++     E  +  Q+ W   +             G
Sbjct: 157 MKNYYGRSYEMYDKELNEIYALLKKELSPETMEDLKTEQIKWIEQKEETANEERLKYNGG 216

Query: 92  TAQSMIYANCLQGHAIERNEKL 113
           T +++ Y   L     ER  +L
Sbjct: 217 TFENVAYYISLYESTKERCYEL 238


>gi|302186151|ref|ZP_07262824.1| hypothetical protein Psyrps6_07392 [Pseudomonas syringae pv.
           syringae 642]
          Length = 136

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 51/135 (37%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A  +        A  C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMTTAVTAVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|149913592|ref|ZP_01902125.1| hypothetical protein RAZWK3B_09826 [Roseobacter sp. AzwK-3b]
 gi|149812712|gb|EDM72541.1| hypothetical protein RAZWK3B_09826 [Roseobacter sp. AzwK-3b]
          Length = 1040

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/108 (14%), Positives = 35/108 (32%), Gaps = 15/108 (13%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
             T  A    + + +C       +   C+  S A    ++  ++    ++++    +   
Sbjct: 131 GTTPTASNTPNPSFDCARAGTSTEKAICSSASLATYDREIARSFSTARDRLDASAADDLL 190

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + Q AW   R + C         G         CL+    +R   L+ 
Sbjct: 191 QGQRAWLRERNA-C--------GGN------RACLESTMRDRAAYLQR 223


>gi|289805909|ref|ZP_06536538.1| putative secreted protein [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
          Length = 41

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 26/39 (66%)

Query: 45 EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
          ++L  TY+  +++ +  QREL +K+Q+AW   R ++CA 
Sbjct: 3  KRLNETYQSAIKRAQPPQRELLQKAQVAWIALRDADCAL 41


>gi|90413313|ref|ZP_01221307.1| hypothetical protein P3TCK_17099 [Photobacterium profundum 3TCK]
 gi|90325714|gb|EAS42177.1| hypothetical protein P3TCK_17099 [Photobacterium profundum 3TCK]
          Length = 510

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 40/86 (46%), Gaps = 6/86 (6%)

Query: 1  MCRKIIFALTIIAIA-----FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
          M  K+    T+++I        S + +C++   Q +   CT ++ A++  K++  Y++ L
Sbjct: 1  MQLKLTMLATVLSIFSPFLWATSPSFDCDKASSQVEERICTDDALAVLDIKMKKVYEQAL 60

Query: 56 EKVEKHQRELFEKSQMAWEIYRGSEC 81
          + +   +R   +  Q  W   R  EC
Sbjct: 61 QNIPDSERSTMKAMQRGWIKGRN-EC 85


>gi|257126512|ref|YP_003164626.1| hypothetical protein Lebu_1768 [Leptotrichia buccalis C-1013-b]
 gi|257050451|gb|ACV39635.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 144

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 31/91 (34%), Gaps = 8/91 (8%)

Query: 31  DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE--IYRGSE------CA 82
           +M +     F     +L   YK ++ K+ K ++      + AW     R +E      C 
Sbjct: 46  EMKEAAVAIFKGWDNELNKVYKLLMSKLSKKEQLKLRNEEKAWIKRKERAAEEAADRFCE 105

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                   GT   + Y   L     +R  +L
Sbjct: 106 TVNGNKLCGTGYGLEYTGSLINSTKDRAIEL 136


>gi|169836425|ref|ZP_02869613.1| hypothetical protein cdivTM_04870 [candidate division TM7
           single-cell isolate TM7a]
          Length = 135

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 5/74 (6%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS--MIYANC 101
             +L   YK ++ K+   Q+      +  W   R  +     S  E GT     ++Y + 
Sbjct: 59  DNELNKVYKLLMSKLSSTQKTKLRNEEREWLKRRERK---VNSETEGGTGMGFRIVYYSI 115

Query: 102 LQGHAIERNEKLES 115
           +     +R  +L  
Sbjct: 116 MTEWTRDRAIELAR 129


>gi|19703731|ref|NP_603293.1| hypothetical protein FN0389 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|19713861|gb|AAL94592.1| Hypothetical protein FN0389 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 133

 Score = 52.2 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 30/72 (41%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   E  Q  W   R  +    A   E GT Q ++    ++
Sbjct: 53  ENELNTVYSLLMEKLPKEEKIKLENEQKEWLKNRNIKAKKEAKQVEGGTLQPVLLEGSVR 112

Query: 104 GHAIERNEKLES 115
               ER  +L  
Sbjct: 113 AQNKERAIELAK 124


>gi|23097713|ref|NP_691179.1| hypothetical protein OB0258 [Oceanobacillus iheyensis HTE831]
 gi|22775936|dbj|BAC12214.1| hypothetical protein [Oceanobacillus iheyensis HTE831]
          Length = 211

 Score = 52.2 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 1/76 (1%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
              L   Y  +++++   + E     Q  W  YR +    A+   E GT + + Y     
Sbjct: 136 DGLLNEIYGVLVDQLSSEEMEALRVEQREWLEYRDNTAKEASLVYENGTMEQLEYVTVQN 195

Query: 104 GHAIERNEKL-ESYLT 118
               ER  +L E Y+ 
Sbjct: 196 NLTEERCFQLVEEYMK 211


>gi|296327967|ref|ZP_06870502.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296154923|gb|EFG95705.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 146

 Score = 52.2 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 30/72 (41%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
           + +L   Y  ++EK+ K ++   E  Q  W   R  +    A   E GT Q ++    ++
Sbjct: 66  ENELNTVYSLLMEKLPKEEKIKLENEQKEWLKNRNIKAKKEAKQVEGGTLQPVLLEGSVR 125

Query: 104 GHAIERNEKLES 115
               ER  +L  
Sbjct: 126 AQNKERAIELAK 137


>gi|289624280|ref|ZP_06457234.1| hypothetical protein PsyrpaN_03891 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646907|ref|ZP_06478250.1| hypothetical protein Psyrpa2_04022 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330869846|gb|EGH04555.1| hypothetical protein PSYAE_21879 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 136

 Score = 52.2 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 53/135 (39%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQ----SMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A      +   +   C+         +C+  S    +E L+  +K +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDVSPCDGVDDDKQTLECSVYSRTTAEELLKENFKNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|284009131|emb|CBA76144.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 138

 Score = 52.2 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/130 (18%), Positives = 46/130 (35%), Gaps = 14/130 (10%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQ----------ADMNQCTGNSFALVKEKLEAT 50
           M +  I  +  I+    + ++N ++TL Q           D   C  N+  L   +L   
Sbjct: 1   MKKLTIVIMLFISKLVLADSINIDQTLEQCLAKPTTVSTLDSVDCYQNALKLWDNELNKQ 60

Query: 51  YKKVLE--KVEKHQRELFEKSQMAWEIYRGSECAFAA--SGAEEGTAQSMIYANCLQGHA 106
           Y+ ++   K+    +   +KSQ+AW  YR             ++GT   +          
Sbjct: 61  YQLLIADKKLSSRFKTALKKSQLAWIKYRDLNLEAINRFYDTQQGTYWGIAAMANKIELT 120

Query: 107 IERNEKLESY 116
             +  +L   
Sbjct: 121 KNKALELTKL 130


>gi|296102635|ref|YP_003612781.1| hypothetical protein ECL_02284 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057094|gb|ADF61832.1| hypothetical protein ECL_02284 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 189

 Score = 52.2 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 25/78 (32%), Gaps = 19/78 (24%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
           +S+    EKL + +K     +    R+    SQ  W  +  S C                
Sbjct: 127 HSYKASDEKLNSVWKS----LSPETRKRLLPSQREWIKH-KSGCNNE------------- 168

Query: 98  YANCLQGHAIERNEKLES 115
              CL      R  +LES
Sbjct: 169 -QKCLTDMTNNRIRELES 185


>gi|325528903|gb|EGD05938.1| hypothetical protein B1M_03894 [Burkholderia sp. TJI49]
          Length = 270

 Score = 52.2 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 35/106 (33%), Gaps = 12/106 (11%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQ 70
           I +A    A++C +     +   C          ++ A Y  VL+       R++  +SQ
Sbjct: 15  IGVAGPGFAMDCAKATQAIEKRICGNAGLRAADTRMNAAYADVLKIAPDAAIRDMLVRSQ 74

Query: 71  MAWEIYRGS--ECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             W   R +  +  +          + MI          +R  +L 
Sbjct: 75  RRWLAARNNRLDADYEGRPLAVAEVRKMI---------DQRTAELA 111


>gi|269119003|ref|YP_003307180.1| hypothetical protein Sterm_0365 [Sebaldella termitidis ATCC 33386]
 gi|268612881|gb|ACZ07249.1| protein of unknown function DUF1311 [Sebaldella termitidis ATCC
           33386]
          Length = 194

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQ 103
            ++L A Y+ +++K+   Q+E     Q  W   R +      SG        ++ A+   
Sbjct: 125 DDELNAVYQALMKKLTPSQQEELRTEQRKWIKQRDA--KLNESGDH------LVNADLFY 176

Query: 104 GHAIERNEKLESY 116
              ++R  +L   
Sbjct: 177 NLTMDRTYELAEL 189


>gi|158321018|ref|YP_001513525.1| putative lipoprotein [Alkaliphilus oremlandii OhILAs]
 gi|158141217|gb|ABW19529.1| lipoprotein, putative [Alkaliphilus oremlandii OhILAs]
          Length = 202

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 35/90 (38%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++  +   M    G S+ +  + L   Y  + +++     +  +  Q+ W   + +    
Sbjct: 106 SDAGVTNAMKNYYGKSYDMYDQALNEIYSLLKKELSPEIMKNLQTEQVKWIEQKEAAADK 165

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            AS  + GT + + Y   L     +R  +L
Sbjct: 166 EASQYKGGTFEFVAYKVSLYESTKKRCYEL 195


>gi|238764418|ref|ZP_04625367.1| hypothetical protein ykris0001_27400 [Yersinia kristensenii ATCC
           33638]
 gi|238697334|gb|EEP90102.1| hypothetical protein ykris0001_27400 [Yersinia kristensenii ATCC
           33638]
          Length = 90

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 33/91 (36%), Gaps = 9/91 (9%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVE----KHQRELFEKSQMAWEIYRGSECAFAASG 87
           M  C        K+ +   Y+K+ + +E     +  + FE +Q +W   R + C      
Sbjct: 1   MMGCADLVSDTAKKDINIVYQKIYKIIEVRDLPYVTKNFETAQKSWLTLRENWCDVQGFI 60

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                   M Y+ C     I R  +L  +L 
Sbjct: 61  I----GTPM-YSICRMDMNISRVNELNGFLE 86


>gi|115360821|ref|YP_777958.1| hypothetical protein Bamb_6080 [Burkholderia ambifaria AMMD]
 gi|115286149|gb|ABI91624.1| conserved hypothetical protein [Burkholderia ambifaria AMMD]
          Length = 341

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 29/74 (39%), Gaps = 2/74 (2%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          I+  LTI  +A  +   +C +     +   C   + + +  +L   +KK L K       
Sbjct: 16 ILAVLTIAPMAAHAAGFDCAKAASPTEKAICADPALSSLDGQLAGAWKKALAK--GGDTA 73

Query: 65 LFEKSQMAWEIYRG 78
            + +Q+ W   R 
Sbjct: 74 ALKAAQLQWLKQRD 87


>gi|330504161|ref|YP_004381030.1| hypothetical protein MDS_3247 [Pseudomonas mendocina NK-01]
 gi|328918447|gb|AEB59278.1| hypothetical protein MDS_3247 [Pseudomonas mendocina NK-01]
          Length = 124

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 44/120 (36%), Gaps = 10/120 (8%)

Query: 6   IFALTIIAIAFQSMALN-----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-- 58
           + AL        + A       C +    A    C G  +   +++L+ TY +V+  +  
Sbjct: 4   LLALGAAVGFSSAQAAEDTEDPCQQGSAMAAF-MCQGPVWKAAEQELQGTYDRVMASLKQ 62

Query: 59  -EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ-SMIYANCLQGHAIERNEKLESY 116
            +         +Q  W   R  +C+  A    +G+       + C    A ER E L+S+
Sbjct: 63  YDPTFATELRDAQRLWVKLREQDCSLYARNRVQGSPWTGFWESECQAQQARERTEWLKSF 122


>gi|50119710|ref|YP_048877.1| hypothetical protein ECA0765 [Pectobacterium atrosepticum SCRI1043]
 gi|49610236|emb|CAG73679.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 148

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 33/91 (36%), Gaps = 12/91 (13%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
            C          +L A YK +L K     ++   +++ AW  +  +   F +S     T 
Sbjct: 59  ACQSAEKKRQDARLNAAYKALLSKQSGTAKDNLIRAERAWLDFHSASKTFESSLYGSETV 118

Query: 94  QSM------IYANCLQGHAIERNEKLESYLT 118
            S       I+  C      ER   LE YL+
Sbjct: 119 SSFEVMQREIFRLC------ERTNVLEEYLS 143


>gi|330812255|ref|YP_004356717.1| hypothetical protein PSEBR_a5229 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380363|gb|AEA71713.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 133

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 52/129 (40%), Gaps = 15/129 (11%)

Query: 2   CRKIIFALTIIAIAFQSMALN----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
            + +  AL +I+    +        C+E         C+       ++ L    + + E+
Sbjct: 1   MKSLFLALALISTVAHATEDTEPNPCDEVENDVQTLACSVYGKTAAEQLLGENLQSLFER 60

Query: 58  VE---KHQRELF-------EKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHA 106
           ++      +          + +Q  W+  R ++CA AA  A+ G+ A  +   +C+   +
Sbjct: 61  LQTRYASDKAQLNDITTKVKTAQQLWQKQRDADCAIAAFPAKPGSEAYKIAENDCMAQVS 120

Query: 107 IERNEKLES 115
            +R+E LES
Sbjct: 121 DDRSEFLES 129


>gi|317492209|ref|ZP_07950638.1| hypothetical protein HMPREF0864_01402 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919548|gb|EFV40878.1| hypothetical protein HMPREF0864_01402 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 314

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 46/111 (41%), Gaps = 18/111 (16%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++F +  + +   ++A++C++  ++ D+  C   +   +   L   Y    +  +   ++
Sbjct: 7   VLFIVVAVGLPASALAMDCSKATLKDDVAICGDTTLMQLDAVLNKNYLSARQHSD---KD 63

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + +  Q++W   R  +C     G + G         CL    +ER + L  
Sbjct: 64  ILKTQQLSWLKQR-QQC-----GDDTG---------CLGNSYVERIKTLAE 99


>gi|237802315|ref|ZP_04590776.1| hypothetical protein POR16_26104 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025172|gb|EGI05228.1| hypothetical protein POR16_26104 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 136

 Score = 51.4 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 53/135 (39%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A           A  C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDATPCDGVDDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+ A S+   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFSISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|229020922|ref|ZP_04177613.1| hypothetical protein bcere0030_53730 [Bacillus cereus AH1273]
 gi|229026895|ref|ZP_04183219.1| hypothetical protein bcere0029_51600 [Bacillus cereus AH1272]
 gi|228734398|gb|EEL85068.1| hypothetical protein bcere0029_51600 [Bacillus cereus AH1272]
 gi|228740373|gb|EEL90680.1| hypothetical protein bcere0030_53730 [Bacillus cereus AH1273]
          Length = 309

 Score = 51.4 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 35/95 (36%), Gaps = 1/95 (1%)

Query: 25  ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFA 84
           E  +  +M +     +    + L   Y  + +++   +     + Q  W  YR  +   A
Sbjct: 215 ENGITTEMKEGEVKRYDAWDQALNEIYGVLKKQLSTSEMNTLREKQREWIKYRDRKAEEA 274

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKL-ESYLT 118
            + + +GT   +   +       ER  +L E Y+ 
Sbjct: 275 WNESGQGTLSGIATISSKATSTRERCYQLVEQYMK 309


>gi|307826027|ref|ZP_07656240.1| Uncharacterized protein putative lipoprotein-like protein
          [Methylobacter tundripaludum SV96]
 gi|307732866|gb|EFO03730.1| Uncharacterized protein putative lipoprotein-like protein
          [Methylobacter tundripaludum SV96]
          Length = 333

 Score = 51.4 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 33/77 (42%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          IFAL   A    + + +C +  +  +   C+    + + ++L   +++ +EK    ++  
Sbjct: 19 IFALFCAASTVNAASFDCTKAAIDVEKIICSDTFISKLDDRLNINFREEIEKASDEEKTN 78

Query: 66 FEKSQMAWEIYRGSECA 82
            K Q  W  +  + C 
Sbjct: 79 LIKHQKHWLKFTRNRCE 95


>gi|53720180|ref|YP_109166.1| hypothetical protein BPSL2569 [Burkholderia pseudomallei K96243]
 gi|167816932|ref|ZP_02448612.1| hypothetical protein Bpse9_17474 [Burkholderia pseudomallei 91]
 gi|167823585|ref|ZP_02455056.1| hypothetical protein Bpseu9_07892 [Burkholderia pseudomallei 9]
 gi|52210594|emb|CAH36577.1| putative exported protein [Burkholderia pseudomallei K96243]
          Length = 141

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 41/106 (38%), Gaps = 4/106 (3%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + A    ++  +C+    Q  MN C      + + +L+    + + +    ++   E   
Sbjct: 32  LPASEVSALLADCDSN--QTSMNFCAWRDQLVAERELQQVVDQQISE-HPERKTALEAKV 88

Query: 71  MAWEIYRGSECAFAASGA-EEGTAQSMIYANCLQGHAIERNEKLES 115
             W+  R + C  +A    ++G+ +    A C      +  +KL +
Sbjct: 89  AKWKKARDASCEKSARKEWDDGSMRPAAQAICATASTKKMTKKLSA 134


>gi|330955014|gb|EGH55274.1| hypothetical protein PSYCIT7_27410 [Pseudomonas syringae Cit 7]
          Length = 142

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 50/135 (37%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A           A  C+         +C+  S    ++ L+  +  +
Sbjct: 7   MKTFLLTLALMTTAVTGVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 66

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 67  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 126

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 127 RMSDERSEYLESIAQ 141


>gi|120602355|ref|YP_966755.1| hypothetical protein Dvul_1310 [Desulfovibrio vulgaris DP4]
 gi|120562584|gb|ABM28328.1| conserved hypothetical protein [Desulfovibrio vulgaris DP4]
          Length = 230

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 44/123 (35%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIAIAFQ-----SMALNCN--ETLMQADMNQCTGNSFALVKEKLEATYKK 53
           +C++++ A+  + I        + + +C   E     + + C  +  A++  +++  Y++
Sbjct: 37  VCKRLLLAIATLGIPAHVHAGVAPSFDCTHVEAGS-IEADICASDDLAILDRQMDEVYRQ 95

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +K            Q  W   R  EC  +                C++     R  +L
Sbjct: 96  ARQKATDQHPPTLAAEQRGWIKGRN-ECWKSPDRMA-----------CIRDQYQLRIAEL 143

Query: 114 ESY 116
           ++ 
Sbjct: 144 QAL 146


>gi|66048009|ref|YP_237850.1| hypothetical protein Psyr_4785 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258716|gb|AAY39812.1| Protein of unknown function DUF1311 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330972935|gb|EGH73001.1| hypothetical protein PSYAR_20842 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 136

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 50/135 (37%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A           A  C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMTTAVTGVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|156935155|ref|YP_001439071.1| hypothetical protein ESA_03006 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533409|gb|ABU78235.1| hypothetical protein ESA_03006 [Cronobacter sakazakii ATCC BAA-894]
          Length = 147

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/139 (16%), Positives = 51/139 (36%), Gaps = 26/139 (18%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFA-----------LVKEKLEAT 50
            ++I+  + ++ IA  S+A +  +      ++QC    +              + +L+  
Sbjct: 1   MKRIMAIIPLLMIATASLAADEKDITSDNAVDQCLDKYYEFSSECLEDLNDKTEAELKKA 60

Query: 51  YKKVLEKVEK-----------HQREL----FEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           Y+  L+ +E+            +++     F KSQ  W  YR   C  A + A+      
Sbjct: 61  YETKLKSLERVDYTKWWMGDEDRKKRMIEAFRKSQRDWLTYRDGYCDVATTAAQGTHFLG 120

Query: 96  MIYANCLQGHAIERNEKLE 114
                C       R ++++
Sbjct: 121 AASVGCNINMNKRRIKEIQ 139


>gi|126736654|ref|ZP_01752393.1| hypothetical protein RCCS2_02575 [Roseobacter sp. CCS2]
 gi|126713769|gb|EBA10641.1| hypothetical protein RCCS2_02575 [Roseobacter sp. CCS2]
          Length = 168

 Score = 51.1 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 31/102 (30%), Gaps = 13/102 (12%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVE-------------KHQRELFEKSQMAWE 74
               M  C  +   +  + L   Y +     +               +     ++Q AW 
Sbjct: 62  TTTGMMFCLSDEAGVWDDLLNEEYAQSRAFAQRWDESDLSTSPQFAVRDNQVLQAQRAWI 121

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +R + C  A      GT + +  A C      ER  +L  Y
Sbjct: 122 AFRDANCTMAYGRHGAGTLRQVSGAACQMRMTAERVFELARY 163


>gi|317493779|ref|ZP_07952196.1| hypothetical protein HMPREF0864_02964 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918106|gb|EFV39448.1| hypothetical protein HMPREF0864_02964 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 384

 Score = 51.1 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 31/98 (31%), Gaps = 11/98 (11%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + + +C       +   C   S + +   L  +Y+  +  +   Q      +Q  W   R
Sbjct: 8   AASFDCENAGNSIEHAICDTTSLSALDSSLNESYQIAMSNLPTTQANELRTAQRNWIKQR 67

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                          A      +CLQ    +R+ +L+ 
Sbjct: 68  N-----------GCAANPERLESCLQKSMAQRDRELQE 94


>gi|296135783|ref|YP_003643025.1| hypothetical protein Tint_1307 [Thiomonas intermedia K12]
 gi|295795905|gb|ADG30695.1| hypothetical protein Tint_1307 [Thiomonas intermedia K12]
          Length = 135

 Score = 51.1 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 39/95 (41%), Gaps = 4/95 (4%)

Query: 35  CTGNSFALVKEKLEATYK-KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE-EGT 92
           C   +   + E++   Y+ ++ + +  +     + +Q  W  +  +EC F     + +  
Sbjct: 41  CAAQTRRALNERMTHLYRLELQKVMGTYTERRLDHAQNLWRRWANAECEFRNGPPDWQNA 100

Query: 93  AQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           A S    +CL G    R  +L+ +L C      CP
Sbjct: 101 AWSTRQDDCLSGMIRSRIAQLDGFLHCS--GATCP 133


>gi|46580261|ref|YP_011069.1| hypothetical protein DVU1852 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449678|gb|AAS96328.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311233754|gb|ADP86608.1| protein of unknown function DUF1311 [Desulfovibrio vulgaris RCH1]
          Length = 203

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 44/123 (35%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIAIAFQ-----SMALNCN--ETLMQADMNQCTGNSFALVKEKLEATYKK 53
           +C++++ A+  + I        + + +C   E     + + C  +  A++  +++  Y++
Sbjct: 10  VCKRLLLAIATLGIPAHVHAGVAPSFDCTHVEAGS-IEADICASDDLAILDRQMDEVYRQ 68

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +K            Q  W   R  EC  +                C++     R  +L
Sbjct: 69  ARQKATDQHPPTLAAEQRGWIKGRN-ECWKSPDRMA-----------CIRDQYQLRIAEL 116

Query: 114 ESY 116
           ++ 
Sbjct: 117 QAL 119


>gi|320178257|gb|EFW53231.1| hypothetical protein SGB_04582 [Shigella boydii ATCC 9905]
          Length = 141

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 47/131 (35%), Gaps = 18/131 (13%)

Query: 2   CRKIIFALTIIAIAFQSMALN---------C-NETLMQADMNQ--CTGNSFALVKEKLEA 49
            +KI+  + +  ++  ++A           C N   + +DM    C   +     + L  
Sbjct: 1   MKKIL--VLLSLVSTTALAKEFSIDVALQQCKNNPAIVSDMAIADCYQVAIKSWDKMLNT 58

Query: 50  TYKKVLE--KVEKHQRELFEKSQMAWEIYRGSECAFAASGA--EEGTAQSMIYANCLQGH 105
            YK+++   +  K  ++  +KSQ+ W  YR             E G+   ++    +   
Sbjct: 59  EYKQLMSDSESSKEFKDSLKKSQLVWIKYRDLYTDTIKKYYNNEHGSDWGIVGTENIMNI 118

Query: 106 AIERNEKLESY 116
              +  +L   
Sbjct: 119 TKNKAIELHKL 129


>gi|282896046|ref|ZP_06304074.1| hypothetical protein CRD_00426 [Raphidiopsis brookii D9]
 gi|281199061|gb|EFA73934.1| hypothetical protein CRD_00426 [Raphidiopsis brookii D9]
          Length = 75

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 9  LTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
            +I     ++A   +C + + QA +NQC   +     +KL   Y KVL   +  +
Sbjct: 20 ALLIGTGTSAIAQFSDCQKAVTQAQLNQCAAINAKTADQKLNDAYNKVLAIYKGKR 75


>gi|32265800|ref|NP_859832.1| hypothetical protein HH0301 [Helicobacter hepaticus ATCC 51449]
 gi|32261848|gb|AAP76898.1| hypothetical protein HH_0301 [Helicobacter hepaticus ATCC 51449]
          Length = 237

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 44/120 (36%), Gaps = 25/120 (20%)

Query: 6   IFALTIIAIAFQSMA-------LNCNETLMQADMNQCTGNS--FALVKEKLEATYKKVLE 56
           +    ++ I   + +        +C +   + +   C   S     +  ++  +Y++   
Sbjct: 8   LGVCIVLGIYLNAQSPQESKPSFDCAKATTKVEKMICNDESGNLQNLDRQIFKSYQETKA 67

Query: 57  KVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           K++K+ ++ F  SQ +W   R   C                   CL+     R ++L++Y
Sbjct: 68  KLDKNGKKAFLDSQKSWLKTRE-RCE---------------SKECLKELLQSRIKELQTY 111


>gi|330898990|gb|EGH30409.1| hypothetical protein PSYJA_16102 [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330980078|gb|EGH78314.1| hypothetical protein PSYAP_16813 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 142

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 50/135 (37%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A           A  C+         +C+  S    ++ L+  +  +
Sbjct: 7   MKTFLLTLALMTTAVTGVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 66

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 67  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCVA 126

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 127 RMSDERSEYLESIAQ 141


>gi|104784091|ref|YP_610589.1| hypothetical protein PSEEN5179 [Pseudomonas entomophila L48]
 gi|95113078|emb|CAK17806.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 133

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 48/126 (38%), Gaps = 11/126 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M   ++ A+   A A +  +  C+          C   +    + +L+A Y  +++++  
Sbjct: 4   MAWLVLLAVACGAQAAEEESTPCDNVESDQQGYACAAYNKQTAERELKAAYDDLIQRIRD 63

Query: 61  HQRE----------LFEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIER 109
              +            E ++  W   R ++C       + G+ A    +  C+   + ER
Sbjct: 64  QYADESDKAAALSAKMEAAEKLWAQLRDADCKVETYAEKPGSKAFEAAWNTCVAQRSDER 123

Query: 110 NEKLES 115
           +E L+S
Sbjct: 124 SEYLQS 129


>gi|289672501|ref|ZP_06493391.1| hypothetical protein PsyrpsF_04610 [Pseudomonas syringae pv.
           syringae FF5]
 gi|330943177|gb|EGH45588.1| hypothetical protein PSYPI_26114 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 136

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 50/135 (37%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++  A           A  C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMTTAVTGVHAAQNPDASPCDGVEDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCVA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|295700022|ref|YP_003607915.1| hypothetical protein BC1002_4424 [Burkholderia sp. CCGE1002]
 gi|295439235|gb|ADG18404.1| protein of unknown function DUF1311 [Burkholderia sp. CCGE1002]
          Length = 161

 Score = 50.7 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 40/109 (36%), Gaps = 13/109 (11%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-----------FEKSQ 70
           +  +     D+ QC+   F      L+   +    K+  + R L           F KSQ
Sbjct: 53  DTGDHATNDDLAQCSHRKFDHAGRALDKILRSAKIKIGSNDRSLKAEGEPLALPYFLKSQ 112

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYA-NCLQGHAIERNEKLESYLT 118
            +W  YR +EC           A+  IY   C+     +R ++L+  L 
Sbjct: 113 DSWAQYRDNECYTETY-MMGEAAERYIYFWECMANITQDRVKELQEVLK 160


>gi|170698251|ref|ZP_02889328.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
 gi|170136832|gb|EDT05083.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
          Length = 341

 Score = 50.7 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 29/74 (39%), Gaps = 2/74 (2%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          ++  LT+ ++A  +   +C +     +   C     + +  +L   +KK L K       
Sbjct: 16 MLAVLTMASMAAHAAGFDCTKAASPTEKAICADPGLSSLDGQLATAWKKALAK--GGDTA 73

Query: 65 LFEKSQMAWEIYRG 78
            + +Q+ W   R 
Sbjct: 74 ALKAAQLQWLKQRD 87


>gi|330961978|gb|EGH62238.1| hypothetical protein PMA4326_25827 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 136

 Score = 50.7 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 51/135 (37%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A           A  C+         +C+  S    ++ L+  +  +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDATPCDGVDDDKQTLECSAYSRTTAEQLLKENFDNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|167586195|ref|ZP_02378583.1| hypothetical protein BuboB_12699 [Burkholderia ubonensis Bu]
          Length = 340

 Score = 50.7 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 27/70 (38%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          + AL+ +     + + +C       +   C     + + EKL+ TY+  L   E   R  
Sbjct: 22 VAALSWLPAHAVAASFDCRAARTDVEHAICGDAELSRLDEKLDDTYRVALGLTEGETRNG 81

Query: 66 FEKSQMAWEI 75
             +Q AW  
Sbjct: 82 VRTTQRAWLK 91


>gi|169634586|ref|YP_001708322.1| hypothetical protein ABSDF3233 [Acinetobacter baumannii SDF]
 gi|169153378|emb|CAP02503.1| conserved hypothetical protein; putative exported protein
           [Acinetobacter baumannii]
          Length = 118

 Score = 50.7 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 44/113 (38%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +F+      + Q+ + +CN      +++ C   S      K+  TY+ VL  +    R+ 
Sbjct: 12  LFSGLAFTHSLQAASFSCNAAKTTTELSICKNRSLNDADVKMATTYQIVLHALPMGGRDN 71

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +Q  W   R + CA   S              C+     +R ++L++ L 
Sbjct: 72  QKDTQQQWLKKRNA-CAANVS--------------CISKAYQQRQKQLDTILQ 109


>gi|21232505|ref|NP_638422.1| hypothetical protein XCC3075 [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66767411|ref|YP_242173.1| hypothetical protein XC_1083 [Xanthomonas campestris pv.
          campestris str. 8004]
 gi|21114294|gb|AAM42346.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66572743|gb|AAY48153.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. 8004]
          Length = 388

 Score = 50.7 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 32/75 (42%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +  A  + +    S + +C       +   C   +  L+ E+L+A+Y+++L+   +    
Sbjct: 12 LAGAALLASGGAWSASFDCARASTAVEQRLCAVKALGLLDERLDASYQELLQTTPRSAVA 71

Query: 65 LFEKSQMAWEIYRGS 79
             + Q AW   R +
Sbjct: 72 AVREQQRAWLRQRNA 86


>gi|85703225|ref|ZP_01034329.1| hypothetical protein ROS217_20827 [Roseovarius sp. 217]
 gi|85672153|gb|EAQ27010.1| hypothetical protein ROS217_20827 [Roseovarius sp. 217]
          Length = 146

 Score = 50.3 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 49  ATYKKVLEKVEKHQREL---FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
           A Y   +E +++ +R L      +Q AW  YR +EC        +G+ +++I A C    
Sbjct: 72  AAYAAQVEALDEGERNLEAQLAVAQDAWNAYREAECGLRYGYWIDGSIRTIIAAACHLEK 131

Query: 106 AIERNEKLESY 116
              R  +L S 
Sbjct: 132 TAARTRELRSL 142


>gi|83944451|ref|ZP_00956904.1| hypothetical protein EE36_13998 [Sulfitobacter sp. EE-36]
 gi|83844653|gb|EAP82537.1| hypothetical protein EE36_13998 [Sulfitobacter sp. EE-36]
          Length = 140

 Score = 50.3 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 29/136 (21%), Positives = 51/136 (37%), Gaps = 20/136 (14%)

Query: 1   MCRKIIFALTIIAIAFQSMAL--------NCNETLMQAD-MNQC-----------TGNSF 40
           M + + F+L +I     +  L        +C       D +++C              ++
Sbjct: 1   MLKCMFFSLLLIPAMATAEKLPPASELLSDCTAPQTDPDAVHRCLFAMGDQVERDMVRAY 60

Query: 41  ALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
              +  L A  +    K +     L + SQ+A+E YR   CAF    +  GTA   +  +
Sbjct: 61  LDAQAALAAFDQAFSRKADASASALLQNSQIAFEDYRKYHCAFPERLSLGGTAAINVTLS 120

Query: 101 CLQGHAIERNEKLESY 116
           C       R E+L+ Y
Sbjct: 121 CRIVLTRSRIEQLQDY 136


>gi|91790660|ref|YP_551612.1| hypothetical protein Bpro_4838 [Polaromonas sp. JS666]
 gi|91699885|gb|ABE46714.1| hypothetical protein Bpro_4838 [Polaromonas sp. JS666]
          Length = 172

 Score = 50.3 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 28/69 (40%), Gaps = 3/69 (4%)

Query: 51  YKKVLEKVEKHQR---ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAI 107
           Y+++L  +++  R        SQ  W  +R S C                 A CL+  A 
Sbjct: 102 YRQLLAMLQQQGRIRTNSLVLSQRTWAKFRESHCTLEVERVMGNYRSPHRLAACLEAEAR 161

Query: 108 ERNEKLESY 116
           +R+E L+ +
Sbjct: 162 KRSEYLKGF 170


>gi|262280720|ref|ZP_06058503.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257620|gb|EEY76355.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 117

 Score = 50.3 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 50/123 (40%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIAI-----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M +K+   L + +      + Q+ + +C+    + + + C   S      K+  TY+ VL
Sbjct: 1   MNKKLAMCLALFSGIAFTQSLQAASFSCDAAKTKTEKSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + C   A+G            +C+     +R ++L++
Sbjct: 61  HALPMGGRDNQKDAQQQWLKKRNA-C---AAGV-----------SCIAKAYQQRQKQLDT 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|330891369|gb|EGH24030.1| hypothetical protein PSYMO_22213 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 142

 Score = 50.3 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 52/135 (38%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQ----SMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A      +   +   C+         +C+  S    +E L+  +  +
Sbjct: 7   MKTFLLTLALMATAVTGVQAAQNPDVSPCDGVDDDKQTLECSVYSRTTAEELLKENFNNL 66

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 67  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 126

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 127 RMSDERSEYLESIAQ 141


>gi|260556337|ref|ZP_05828556.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|332873037|ref|ZP_08440994.1| hypothetical protein HMPREF0022_00594 [Acinetobacter baumannii
           6014059]
 gi|260410392|gb|EEX03691.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|322506518|gb|ADX01972.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323516397|gb|ADX90778.1| hypothetical protein ABTW07_0341 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332738549|gb|EGJ69419.1| hypothetical protein HMPREF0022_00594 [Acinetobacter baumannii
           6014059]
          Length = 118

 Score = 50.3 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 45/113 (39%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +F+      + Q+ + +CN    + +++ C   S      K+  TY+ VL  +    R+ 
Sbjct: 12  LFSGLAFTHSLQAASFSCNAAKTKTELSICKNRSLNDADVKMATTYQIVLHALPMGGRDN 71

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +Q  W   R + CA   S              C+     +R ++L++ L 
Sbjct: 72  QKDTQQQWLKKRNA-CAANVS--------------CISKAYQQRQKQLDTILQ 109


>gi|71735833|ref|YP_276912.1| hypothetical protein PSPPH_4814 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257482954|ref|ZP_05636995.1| hypothetical protein PsyrptA_06846 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|298485225|ref|ZP_07003318.1| hypothetical protein PSA3335_0637 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71556386|gb|AAZ35597.1| Protein of unknown function (DUF1311) subfamily, putative
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298160213|gb|EFI01241.1| hypothetical protein PSA3335_0637 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326338|gb|EFW82391.1| hypothetical protein PsgB076_01976 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331671|gb|EFW87609.1| hypothetical protein PsgRace4_01295 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330882846|gb|EGH16995.1| hypothetical protein Pgy4_28655 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330989480|gb|EGH87583.1| hypothetical protein PLA107_30969 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011801|gb|EGH91857.1| hypothetical protein PSYTB_19381 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 136

 Score = 50.3 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 52/135 (38%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQ----SMALN---CNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A      +   +   C+         +C+  S    +E L+  +  +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDVSPCDGVDDDKQTLECSVYSRTTAEELLKENFNNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 61  LKRVQSQFVANKTQFNDFTSKLKTAQQAWEKLRDADCAVEVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|184156631|ref|YP_001844970.1| hypothetical protein ACICU_00311 [Acinetobacter baumannii ACICU]
 gi|239500970|ref|ZP_04660280.1| hypothetical protein AbauAB_01525 [Acinetobacter baumannii AB900]
 gi|183208225|gb|ACC55623.1| uncharacterized protein conserved in bacteria, putative lipoprotein
           [Acinetobacter baumannii ACICU]
 gi|193076151|gb|ABO10763.2| putative signal peptide [Acinetobacter baumannii ATCC 17978]
          Length = 117

 Score = 50.3 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 45/113 (39%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +F+      + Q+ + +CN    + +++ C   S      K+  TY+ VL  +    R+ 
Sbjct: 11  LFSGLAFTHSLQAASFSCNAAKTKTELSICKNRSLNDADVKMATTYQIVLHALPMGGRDN 70

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +Q  W   R + CA   S              C+     +R ++L++ L 
Sbjct: 71  QKDTQQQWLKKRNA-CAANVS--------------CISKAYQQRQKQLDTILQ 108


>gi|257125525|ref|YP_003163639.1| hypothetical protein Lebu_0740 [Leptotrichia buccalis C-1013-b]
 gi|257049464|gb|ACV38648.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 172

 Score = 49.9 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 32/86 (37%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           ADMN        L++ +++  Y  +  K+   ++   +K Q  W+         A    E
Sbjct: 79  ADMNNAVSKQEELLEAEMKKVYGLLEAKLSDSEKAKLKKEQEDWKKEVEKNVDEATKEVE 138

Query: 90  EGTAQSMIYANCLQGHAIERNEKLES 115
            GT   ++  N       ER  +L  
Sbjct: 139 GGTISGVMGGNAWVTKTEERALELAK 164


>gi|78066557|ref|YP_369326.1| hypothetical protein Bcep18194_A5088 [Burkholderia sp. 383]
 gi|77967302|gb|ABB08682.1| hypothetical protein Bcep18194_A5088 [Burkholderia sp. 383]
          Length = 276

 Score = 49.9 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/76 (14%), Positives = 28/76 (36%), Gaps = 3/76 (3%)

Query: 12 IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQ 70
          + +A  + A++C + +   +   C          ++ + Y   L+       R++  +SQ
Sbjct: 18 VGVAVPAFAIDCAKAVQPIEKRICASPVLRAADTRMNSAYTGALKAAPDTAIRDMLVRSQ 77

Query: 71 MAWEIYRGS--ECAFA 84
            W   R    +  + 
Sbjct: 78 RRWIDARNKRLDADYE 93


>gi|332185598|ref|ZP_08387346.1| hypothetical protein SUS17_667 [Sphingomonas sp. S17]
 gi|332014576|gb|EGI56633.1| hypothetical protein SUS17_667 [Sphingomonas sp. S17]
          Length = 125

 Score = 49.9 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 36/115 (31%), Gaps = 13/115 (11%)

Query: 8   ALTIIAIAFQSMALNC--NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV--EKHQR 63
           A+  I+    +   NC             CT    A+  ++L   Y++V+ ++      +
Sbjct: 19  AVAQISPNISAAYTNCMDRAGSNTVQSGVCTQREAAVQDDRLNKAYQQVMRQLASRPAAK 78

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                 Q  W   R   C       + G         C+      R ++LE  + 
Sbjct: 79  TALRDQQRRWIRERDYSCKINGDTIDTG---------CIVTKTALRADELERQVR 124


>gi|260427471|ref|ZP_05781450.1| conserved hypothetical protein, putative [Citreicella sp. SE45]
 gi|260421963|gb|EEX15214.1| conserved hypothetical protein, putative [Citreicella sp. SE45]
          Length = 149

 Score = 49.9 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 30/87 (34%), Gaps = 1/87 (1%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-ELFEKSQMAWEIYRGSECAFAAS 86
               + +C         E L A +  +  + + +   +    +Q  W   R +ECA    
Sbjct: 57  TTIGIAECIMREQRGWDELLNAWWTPMKARAQANGSWDSLLAAQRQWIKDRDAECARRYE 116

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL 113
            A  G+ + +  A C +     R  + 
Sbjct: 117 EAGGGSIRVIYGAECQRDLTAARAVEF 143


>gi|119773641|ref|YP_926381.1| hypothetical protein Sama_0501 [Shewanella amazonensis SB2B]
 gi|119766141|gb|ABL98711.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 196

 Score = 49.9 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 37/102 (36%), Gaps = 15/102 (14%)

Query: 17  QSMALNCNE---TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           Q  + +C +       A+   CT    A +  +L   Y+ ++ +       LF+  Q  W
Sbjct: 21  QPPSFDCGKLPGNAPSAEKLVCTDLELAALDRQLNEVYQTIVARAGDGLPPLFKAEQRGW 80

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R  EC      +E+        A C+      R  +L++
Sbjct: 81  IKGRN-EC----WKSED-------LAACVAKSYRSRTAELQA 110


>gi|261823608|ref|YP_003261714.1| hypothetical protein Pecwa_4415 [Pectobacterium wasabiae WPP163]
 gi|261607621|gb|ACX90107.1| conserved hypothetical protein [Pectobacterium wasabiae WPP163]
          Length = 307

 Score = 49.5 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 9/74 (12%), Positives = 25/74 (33%), Gaps = 3/74 (4%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +  +  +        A++C++     +   C  +    +   L    +  ++K +  Q  
Sbjct: 6  LAVSSLLFFFTSSVWAMDCSKASTDTEKMICASSRLQQLDAVLNQANQGYVKKADSAQ-- 63

Query: 65 LFEKSQMAWEIYRG 78
             + Q  W + R 
Sbjct: 64 -VRQEQHTWLVERD 76


>gi|323191114|gb|EFZ76379.1| hypothetical protein ECRN5871_0691 [Escherichia coli RN587/1]
          Length = 241

 Score = 49.5 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 28/77 (36%), Gaps = 1/77 (1%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M   ++ +L + +    + + +C +     +   C     + + E+L + Y   L+    
Sbjct: 10 MKNILLASLLVASPGAFAASFDCQKASTAIEHKICDNERLSKLDEQLSSAYSSALKG-NP 68

Query: 61 HQRELFEKSQMAWEIYR 77
             +  +  Q  W   R
Sbjct: 69 ENADTLKMVQRQWVNMR 85


>gi|190572348|ref|YP_001970193.1| hypothetical protein Smlt0274 [Stenotrophomonas maltophilia K279a]
 gi|190010270|emb|CAQ43878.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 143

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/109 (16%), Positives = 40/109 (36%), Gaps = 7/109 (6%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71
           ++  F +        + QA    C  +  A   ++L   Y+++  K+   ++     +Q 
Sbjct: 37  LSPTFTTCRDKAQGAIEQA---ACLTSESARQDQRLNQAYRQLQAKLSGAKKTKLVNAQR 93

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAI--ERNEKLESYLT 118
           AW   R  +     +  ++  +Q       L        R ++L+ YL 
Sbjct: 94  AWLQSRSRDSELDTALYDD--SQPGNLQGELNDVMRLSARADQLQKYLQ 140


>gi|146301124|ref|YP_001195715.1| hypothetical protein Fjoh_3382 [Flavobacterium johnsoniae UW101]
 gi|146155542|gb|ABQ06396.1| hypothetical lipoprotein [Flavobacterium johnsoniae UW101]
          Length = 134

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 42/131 (32%), Gaps = 20/131 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALN-----------CNETLMQADMNQCTGNSFALVKEKLEA 49
           M + I+    + ++   S  L            C       +M  C    +      L  
Sbjct: 2   MQKSILLVFVLASMYCNSQTLETVYKMKSDYQKCLNKG--QNMRNCALEYYNQSDSLLNV 59

Query: 50  TYKKVLEKVEKHQRELFEKSQMAWEIYRGS--ECAFAASGAEEGTAQS-----MIYANCL 102
           +YK +  K+   ++   +K Q+ W   R    +  ++ +  E    +      MI  +  
Sbjct: 60  SYKNLKSKISSKEQSKLKKEQLEWLKKRDQFFQKVYSDTKKEGNFIEGTQDFEMIIYDEQ 119

Query: 103 QGHAIERNEKL 113
                 R ++L
Sbjct: 120 AKFVFGRVKEL 130


>gi|226310314|ref|YP_002770208.1| hypothetical protein BBR47_07270 [Brevibacillus brevis NBRC 100599]
 gi|226093262|dbj|BAH41704.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 217

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            ++L   YKK+L K+++  RE   +SQ  W  Y
Sbjct: 125 DKELNQIYKKLLSKLDREPREALIESQKEWLQY 157


>gi|77459785|ref|YP_349292.1| hypothetical protein Pfl01_3563 [Pseudomonas fluorescens Pf0-1]
 gi|77383788|gb|ABA75301.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 339

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 31/80 (38%), Gaps = 3/80 (3%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
              + A A  + + +C       +   C     + + EKL A ++  L +V   Q    
Sbjct: 12 LTCLVFATASHAASFDCAGASSPVEKAVCADPYTSSLDEKLGALWQTTLAQVADPQ--AL 69

Query: 67 EKSQMAWEIYRGSECAFAAS 86
          +  Q +W   R  +CA  +S
Sbjct: 70 KADQRSWLKQRN-QCAANSS 88


>gi|331682200|ref|ZP_08382822.1| hypothetical protein ECOG_05170 [Escherichia coli H299]
 gi|331080624|gb|EGI51800.1| hypothetical protein ECOG_05170 [Escherichia coli H299]
          Length = 232

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 28/77 (36%), Gaps = 1/77 (1%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          M   ++ +L + +    + + +C +     +   C     + + E+L + Y   L+    
Sbjct: 1  MKNILLASLLVASPGAFAASFDCQKASTAIEHKICDNERLSKLDEQLSSAYSSALKG-NP 59

Query: 61 HQRELFEKSQMAWEIYR 77
             +  +  Q  W   R
Sbjct: 60 ENADTLKMVQRQWVNMR 76


>gi|15891993|ref|NP_359707.1| hypothetical protein RC0070 [Rickettsia conorii str. Malish 7]
 gi|34222966|sp|Q92JJ7|Y070_RICCN RecName: Full=Uncharacterized protein RC0070
 gi|15619107|gb|AAL02608.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 51

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 96  MIYANCLQGHAIERN---EKLESYLTCPEGDLLCPFI 129
           MI   CL  +   R    ++ E+ L C EGDL CPFI
Sbjct: 1   MILLMCLTSYRKNRRAYKKEFEAMLKCEEGDLSCPFI 37


>gi|298207245|ref|YP_003715424.1| putative periplasmic protein [Croceibacter atlanticus HTCC2559]
 gi|83849881|gb|EAP87749.1| putative periplasmic protein [Croceibacter atlanticus HTCC2559]
          Length = 124

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 45/123 (36%), Gaps = 13/123 (10%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE--KVE 59
            + I+  ++I   +          +  QA++ +   + +    ++L++ +  +L+     
Sbjct: 1   MKHILLVVSICFFSLTY-------SQNQAELEKVAYSEYLQSDKELKSLFNSILKGHNEN 53

Query: 60  KHQRELFEKSQMAWEIYR--GSECAFAASGAEEGT--AQSMIYANCLQGHAIERNEKLES 115
               +  ++SQ  W  +R    E  F  S     +     +  +  L    ++R +   +
Sbjct: 54  PEFSKRLKQSQELWLGFRNFELESRFPNSEVNRSSNNNYGICESMFLTEFTLDRIKYFNT 113

Query: 116 YLT 118
           +  
Sbjct: 114 WFN 116


>gi|288957058|ref|YP_003447399.1| hypothetical protein AZL_002170 [Azospirillum sp. B510]
 gi|288909366|dbj|BAI70855.1| hypothetical protein AZL_002170 [Azospirillum sp. B510]
          Length = 497

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 30/86 (34%), Gaps = 4/86 (4%)

Query: 4  KIIFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           I   +  I  A  + A    +C       +   C         +++  +YK + +    
Sbjct: 8  TISMMVAGIVGAGTARAEPSFDCKAASTPVEKAICADPKLGDADKEIADSYKALQDLSGA 67

Query: 61 HQRELFEKSQMAWEIYRGSECAFAAS 86
            R+     Q AW   R  +CA A+S
Sbjct: 68 ADRDRLRAEQRAWLGQRN-QCATASS 92


>gi|299771822|ref|YP_003733848.1| hypothetical protein AOLE_17955 [Acinetobacter sp. DR1]
 gi|298701910|gb|ADI92475.1| hypothetical protein AOLE_17955 [Acinetobacter sp. DR1]
          Length = 117

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 50/123 (40%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIAI-----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M +K+   L + +      + Q+ + +C+    + + + C   S      K+  TY+ VL
Sbjct: 1   MNKKLAMCLVVFSGIAFTQSLQAASFSCDAAKTKTEKSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R + C   A+G            +C+     +R ++L++
Sbjct: 61  HALPMGGRDNQKDAQQQWLKKRNA-C---AAGV-----------SCISKAYQQRQQQLDA 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|296447322|ref|ZP_06889250.1| hypothetical protein MettrDRAFT_2966 [Methylosinus trichosporium
          OB3b]
 gi|296255187|gb|EFH02286.1| hypothetical protein MettrDRAFT_2966 [Methylosinus trichosporium
          OB3b]
          Length = 463

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 20/67 (29%), Gaps = 1/67 (1%)

Query: 15 AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
             + + +C       +   C       +  +L A  K  L      + E   ++   W 
Sbjct: 16 PVHAQSFDCAAARTMVERLVCADRRLGALDAELGAAVKASLAADPAKRAERLAEA-RRWI 74

Query: 75 IYRGSEC 81
          I R   C
Sbjct: 75 IERDRLC 81


>gi|301347361|ref|ZP_07228102.1| hypothetical protein AbauAB0_13958 [Acinetobacter baumannii AB056]
 gi|301512321|ref|ZP_07237558.1| hypothetical protein AbauAB05_12087 [Acinetobacter baumannii AB058]
 gi|301597228|ref|ZP_07242236.1| hypothetical protein AbauAB059_15457 [Acinetobacter baumannii
           AB059]
          Length = 117

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 45/113 (39%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +F+      + Q+ + +C+    + +++ C   S      K+  TY+ VL  +    R+ 
Sbjct: 11  LFSGLAFTHSLQAASFSCSAAKTKTELSICKNRSLNDADVKMATTYQIVLHALPMGGRDN 70

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +Q  W   R + CA   S              C+     +R ++L++ L 
Sbjct: 71  QKDTQQQWLKKRNA-CAANVS--------------CISKAYQQRQKQLDTILQ 108


>gi|169797445|ref|YP_001715238.1| hypothetical protein ABAYE3481 [Acinetobacter baumannii AYE]
 gi|213155741|ref|YP_002317786.1| hypothetical protein AB57_0377 [Acinetobacter baumannii AB0057]
 gi|215484882|ref|YP_002327121.1| hypothetical protein ABBFA_003240 [Acinetobacter baumannii
           AB307-0294]
 gi|332854361|ref|ZP_08435313.1| hypothetical protein HMPREF0021_02897 [Acinetobacter baumannii
           6013150]
 gi|332867576|ref|ZP_08437724.1| hypothetical protein HMPREF0020_01337 [Acinetobacter baumannii
           6013113]
 gi|169150372|emb|CAM88269.1| conserved hypothetical protein; putative exported protein
           [Acinetobacter baumannii AYE]
 gi|213054901|gb|ACJ39803.1| hypothetical protein AB57_0377 [Acinetobacter baumannii AB0057]
 gi|213987585|gb|ACJ57884.1| hypothetical protein ABBFA_003240 [Acinetobacter baumannii
           AB307-0294]
 gi|332728037|gb|EGJ59428.1| hypothetical protein HMPREF0021_02897 [Acinetobacter baumannii
           6013150]
 gi|332733850|gb|EGJ64996.1| hypothetical protein HMPREF0020_01337 [Acinetobacter baumannii
           6013113]
          Length = 118

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 45/113 (39%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +F+      + Q+ + +C+    + +++ C   S      K+  TY+ VL  +    R+ 
Sbjct: 12  LFSGLAFTHSLQAASFSCSAAKTKTELSICKNRSLNDADVKMATTYQIVLHALPMGGRDN 71

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +Q  W   R + CA   S              C+     +R ++L++ L 
Sbjct: 72  QKDTQQQWLKKRNA-CAANVS--------------CISKAYQQRQKQLDTILQ 109


>gi|294339946|emb|CAZ88309.1| hypothetical protein; putative exported protein [Thiomonas sp. 3As]
          Length = 135

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 37/95 (38%), Gaps = 4/95 (4%)

Query: 35  CTGNSFALVKEKLEATYK-KVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE-EGT 92
           C   +   + E++   Y  ++ + +  +     + +Q  W  +  +EC F     +    
Sbjct: 41  CAAQTRRALNERMTHLYHLELQKVMGTYTERRLDHAQNLWRRWANAECEFRNGPPDWPNA 100

Query: 93  AQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           A S    +CL G    R  +L+ +L C      CP
Sbjct: 101 AWSTRQDDCLSGMIRRRIAQLDGFLHCS--GATCP 133


>gi|260550484|ref|ZP_05824694.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260406399|gb|EEW99881.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 117

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 46/113 (40%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +F+   +A   Q+ + +CN    + +++ C   S      K+  TY+ VL  +    R+ 
Sbjct: 11  LFSGITLAHNAQAASFSCNAAKTKTELSICKNRSLNDADVKMATTYQIVLHALPMGGRDN 70

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            + +Q  W   R + CA   S              C+     +R ++L+S L 
Sbjct: 71  QKDTQQQWLKKRNA-CAANVS--------------CISKAYQQRQQQLDSILQ 108


>gi|218529924|ref|YP_002420740.1| hypothetical protein Mchl_1949 [Methylobacterium chloromethanicum
           CM4]
 gi|218522227|gb|ACK82812.1| protein of unknown function DUF1311 [Methylobacterium
           chloromethanicum CM4]
          Length = 463

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 29/92 (31%), Gaps = 15/92 (16%)

Query: 23  CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           C      ++   C+ +S A +  +L   Y + ++ +    R     +Q  W   R  +C 
Sbjct: 387 CARASTSSERTICSDSSLARLDRQLTVLYSRAVDNLSNSSRRALIVAQKQWIQERD-QC- 444

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                    +        C+     +R   L 
Sbjct: 445 -------GSSV------GCIARAYTQRIGALR 463


>gi|70730700|ref|YP_260441.1| hypothetical protein PFL_3336 [Pseudomonas fluorescens Pf-5]
 gi|68344999|gb|AAY92605.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 343

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 32/78 (41%), Gaps = 3/78 (3%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          ++FA+   +   Q+ + +C +    ++   C     A +  +L   +K  L K +  +  
Sbjct: 14 LLFAVLACSQGVQASSFDCAKAASSSEKALCADPYTASLDSQLGKAWKATLAKAKDPKAL 73

Query: 65 LFEKSQMAWEIYRGSECA 82
            +  Q  W   R  +CA
Sbjct: 74 RLD--QREWLKERD-QCA 88


>gi|302062097|ref|ZP_07253638.1| hypothetical protein PsyrptK_19096 [Pseudomonas syringae pv. tomato
           K40]
          Length = 142

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 51/135 (37%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A           A  C+         +C+  S    +E L+  +  +
Sbjct: 7   MKTFLLTLALMATAVTGVQAAQNPDASPCDGVDDDKQTLECSVYSRTTAEELLKENFNNL 66

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 67  LKRVQSQFVANKTQYNDFTSKLKTAQQAWEKLRDADCAVDVFPSAAGSKAFTISENDCIA 126

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 127 RMSDERSEYLESIAQ 141


>gi|156935157|ref|YP_001439073.1| hypothetical protein ESA_03008 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533411|gb|ABU78237.1| hypothetical protein ESA_03008 [Cronobacter sakazakii ATCC BAA-894]
          Length = 147

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/139 (19%), Positives = 52/139 (37%), Gaps = 26/139 (18%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFA-----------LVKEKLEAT 50
            RKI+F ++ + I+   MA +  +      ++QC    +              + +L+  
Sbjct: 1   MRKIVFLVSTLLISHNLMAADQKDINADNAVDQCLDKYYEFSSECLEDLNDKTEAELKQA 60

Query: 51  YKKVLEKVEK-----------HQREL----FEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           Y+  L+ +E+            +++     F KSQ  W  YR S C  A  G +E     
Sbjct: 61  YETKLKSLERVDYTKWWMGDEDRKKRMIEAFRKSQRDWLTYRDSYCEVATIGEQETHFIG 120

Query: 96  MIYANCLQGHAIERNEKLE 114
                C       R ++++
Sbjct: 121 AASVGCNINMNKRRIKEIQ 139


>gi|28867623|ref|NP_790242.1| hypothetical protein PSPTO_0393 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|301382471|ref|ZP_07230889.1| hypothetical protein PsyrptM_07547 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302132905|ref|ZP_07258895.1| hypothetical protein PsyrptN_16014 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28850858|gb|AAO53937.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|331014930|gb|EGH94986.1| hypothetical protein PLA106_03337 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 136

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 51/135 (37%), Gaps = 18/135 (13%)

Query: 2   CRKIIFALTIIAIAFQS-------MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
            +  +  L ++A A           A  C+         +C+  S    +E L+  +  +
Sbjct: 1   MKTFLLTLALMATAVTGVQAAQNPDASPCDGVDDDKQTLECSVYSRTTAEELLKENFNNL 60

Query: 55  LEKVEK----------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQ 103
           L++V+                 + +Q AWE  R ++CA     +  G+    I   +C+ 
Sbjct: 61  LKRVQSQFVANKTQYNDFTSKLKTAQQAWEKLRDADCAVDVFPSAAGSKAFTISENDCIA 120

Query: 104 GHAIERNEKLESYLT 118
             + ER+E LES   
Sbjct: 121 RMSDERSEYLESIAQ 135


>gi|294650832|ref|ZP_06728179.1| hypothetical protein HMP0015_2388 [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823250|gb|EFF82106.1| hypothetical protein HMP0015_2388 [Acinetobacter haemolyticus ATCC
           19194]
          Length = 110

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 49/118 (41%), Gaps = 10/118 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
            ++++F + I+A+   ++A N +  L + D           +K +L   YK+   + E  
Sbjct: 1   MKRLLF-IPILALCGLAIAGNADSDLQKLD------KEIKNLKTELNTVYKEASSQTEA- 52

Query: 62  QRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            ++    SQ +W  ++  +C  F  + A+  +A       C      +R + L+    
Sbjct: 53  -KQELAASQESWLKFKELQCGDFVVADAQGSSATISYDLTCQSILYKQRIDFLKEMFN 109


>gi|240144821|ref|ZP_04743422.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
 gi|257203125|gb|EEV01410.1| conserved hypothetical protein [Roseburia intestinalis L1-82]
          Length = 373

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 44/104 (42%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           +++      ++   Q+++N  +   + ++ E L   +  +    +++  +   + Q  W 
Sbjct: 270 SYEYWTDEIDKAESQSEINDDSQKRYEVMDECLNYIWNLIKNDTDENAYQKILEEQRTWI 329

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
             + ++   A+    +G+A +  Y +      + R E+L  YL 
Sbjct: 330 ADKEAKAKAASDEYGDGSAGTAAYYDKSAELTMTRCEELIEYLK 373


>gi|212704893|ref|ZP_03313021.1| hypothetical protein DESPIG_02960 [Desulfovibrio piger ATCC 29098]
 gi|212671664|gb|EEB32147.1| hypothetical protein DESPIG_02960 [Desulfovibrio piger ATCC 29098]
          Length = 160

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 32/92 (34%), Gaps = 5/92 (5%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLE-----KVEKHQRELFEKSQMAWEIYRGSECAFA 84
            +M  C  +++     +L A YKK  +        K   +   K Q AW  Y+       
Sbjct: 66  MEMMGCFQHAYDYWDARLNANYKKARQACQNSSDPKGWSDKLLKGQRAWVQYKELFADLV 125

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               E G+   +   + L G   ++   LE  
Sbjct: 126 QLPNEGGSMARLSAMSFLTGETRKQALLLEQL 157


>gi|254258725|ref|ZP_04949779.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254217414|gb|EET06798.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 240

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 37/84 (44%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E  F  +  E  +G
Sbjct: 59  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHFVRAVYETTQG 118

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 119 TMYAMANADMRLQPVRERALALRG 142



 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 176 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 222

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 223 IGARVATLKRF 233


>gi|329927807|ref|ZP_08281868.1| hypothetical protein HMPREF9412_5970 [Paenibacillus sp. HGF5]
 gi|328938208|gb|EGG34603.1| hypothetical protein HMPREF9412_5970 [Paenibacillus sp. HGF5]
          Length = 148

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 10/88 (11%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY--RGS---ECAFAASGAEE--GTAQSM 96
            ++L+  YKK+L K+++  RE   +SQ  W  Y  R +   E  F  +G     G+    
Sbjct: 56  DDELDHIYKKLLSKLDREPREALIESQKEWLQYHLRETKFVEKTFINNGYLGSQGSVS-- 113

Query: 97  IYANCLQGHAIERNEKLESYLTCPEGDL 124
                ++    ER  +L  Y    +G++
Sbjct: 114 -LGRVIKERIRERTMQLFEYRYLRDGEV 140


>gi|261406383|ref|YP_003242624.1| hypothetical protein GYMC10_2542 [Paenibacillus sp. Y412MC10]
 gi|261282846|gb|ACX64817.1| conserved hypothetical protein [Paenibacillus sp. Y412MC10]
          Length = 217

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 10/88 (11%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY--RGS---ECAFAASGAEE--GTAQSM 96
            ++L+  YKK+L K+++  RE   +SQ  W  Y  R +   E  F  +G     G+    
Sbjct: 125 DDELDHIYKKLLSKLDREPREALIESQKEWLQYHLRETKFVEKTFINNGYLGSQGSVS-- 182

Query: 97  IYANCLQGHAIERNEKLESYLTCPEGDL 124
                ++    ER  +L  Y    +G++
Sbjct: 183 -LGRVIKERIRERTMQLFEYRYLRDGEV 209


>gi|188990514|ref|YP_001902524.1| hypothetical protein xccb100_1118 [Xanthomonas campestris pv.
          campestris str. B100]
 gi|167732274|emb|CAP50466.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 388

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/75 (17%), Positives = 31/75 (41%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +  A  + +    S + +C       +   C   +  L+ E+L+A+Y+++L+   +    
Sbjct: 12 LAGAALLASGGAWSASFDCARASTAVEQRLCAVKALGLLDERLDASYQELLQTTPRSAVA 71

Query: 65 LFEKSQMAWEIYRGS 79
             + Q  W   R +
Sbjct: 72 AVREQQRGWLRQRNA 86


>gi|117926070|ref|YP_866687.1| hypothetical protein Mmc1_2788 [Magnetococcus sp. MC-1]
 gi|117609826|gb|ABK45281.1| protein of unknown function DUF323 [Magnetococcus sp. MC-1]
          Length = 446

 Score = 48.4 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 35/111 (31%), Gaps = 3/111 (2%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ A  +   A ++ + +C+E     +   C+         +L   Y  ++ +      +
Sbjct: 14  VLAAGMMGVQASEAASFDCSEARAPIEKLICSDTKLFEYDGRLGDAY--LIARKSSDTPD 71

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                Q  W   R   C          +    I   CL  H   R  +LE 
Sbjct: 72  KVRDGQREWIKTRNKACPVLT-EDLGDSRLKRILVGCLVPHYEARIGELEK 121


>gi|302873357|ref|YP_003841990.1| hypothetical protein Clocel_0450 [Clostridium cellulovorans 743B]
 gi|307688473|ref|ZP_07630919.1| hypothetical protein Ccel74_09953 [Clostridium cellulovorans 743B]
 gi|302576214|gb|ADL50226.1| hypothetical protein Clocel_0450 [Clostridium cellulovorans 743B]
          Length = 328

 Score = 48.4 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 36/90 (40%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           ++  +   M    G+S+    + L   Y  + E++ +   +  E  ++ W   + +    
Sbjct: 104 SDAGITISMKSFYGDSYRCYDDALNEIYNLLKEQLSQDIMKNLEAEEINWITQKENAANA 163

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           AAS  + GT + + Y   L      R  +L
Sbjct: 164 AASEFKGGTFEPVAYNTSLYNSTKARCYEL 193



 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 12/91 (13%), Positives = 27/91 (29%), Gaps = 1/91 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-A 82
             +     M       +    E+L   Y  + +++   +     K ++ W   + ++   
Sbjct: 232 AGSGTTNSMFTYADKKYIKWDEQLNKIYSLLKQQLPSDEMSKLNKEELQWITQKETKAKK 291

Query: 83  FAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
              S        S+ Y   L      R  +L
Sbjct: 292 SEESQGVGSQLGSVAYQASLAFVTESRCYEL 322


>gi|33620676|ref|NP_891833.1| hypothetical protein RB49p262 [Enterobacteria phage RB49]
 gi|33348143|gb|AAQ15486.1| hypothetical protein RB49ORF260c [Enterobacteria phage RB49]
          Length = 252

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 46/123 (37%), Gaps = 21/123 (17%)

Query: 2   CRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            + II A+ + A AF + A   +C +   +++   C   S + +  KL   Y K + K++
Sbjct: 1   MKNIIAAIVLSATAFGANAASFDCAKATTKSEKFICANESISALDSKLHEVYVKAV-KID 59

Query: 60  KHQRELFEKSQMAW-EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                  ++ Q  W +  R +           G  Q       L+     + + L + L 
Sbjct: 60  PS----LKQEQRNWNKTVRDTMINI-------GQIQP------LEAVYNAQIQNLMNVLP 102

Query: 119 CPE 121
             E
Sbjct: 103 KEE 105


>gi|262370124|ref|ZP_06063451.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262315163|gb|EEY96203.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 114

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 37/113 (32%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           +      ++  Q+ + NC++     +   C          K+  TY  +   V    R +
Sbjct: 9   LVCSLAWSMHAQAASFNCDKAKTTTEHTICEHLKINDADVKMATTYSILKRLVPMGTRGM 68

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +  Q+ W   R   C  + S              CL      R ++LE +L 
Sbjct: 69  IQDEQVKWLSLRD-RCGASQS--------------CLMDVYKMRQQQLELHLD 106


>gi|332871425|ref|ZP_08439942.1| hypothetical protein HMPREF0020_03597 [Acinetobacter baumannii
           6013113]
 gi|332731462|gb|EGJ62752.1| hypothetical protein HMPREF0020_03597 [Acinetobacter baumannii
           6013113]
          Length = 248

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 11/94 (11%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQREL--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
           ++  + +L + Y  +   +  ++ E+     +Q  W   R  +C F    A  G      
Sbjct: 40  YSNSEHELNSVYSDIKGYISDNKNEVKYLVDTQRFWLKNRNLKCNFNGKEANSGN----- 94

Query: 98  YANCLQGHAIERNEKLE-SYLTCP--EGDLLCPF 128
              CL      + + L+ SYL     EG L+ PF
Sbjct: 95  -YKCLSDFNNSKIKDLKNSYLDLDNLEGKLIKPF 127


>gi|213159103|ref|YP_002321101.1| hypothetical protein AB57_3813 [Acinetobacter baumannii AB0057]
 gi|215481879|ref|YP_002324061.1| hypothetical protein ABBFA_000120 [Acinetobacter baumannii
           AB307-0294]
 gi|332850127|ref|ZP_08432514.1| hypothetical protein HMPREF0021_00083 [Acinetobacter baumannii
           6013150]
 gi|213058263|gb|ACJ43165.1| hypothetical protein AB57_3813 [Acinetobacter baumannii AB0057]
 gi|213985972|gb|ACJ56271.1| hypothetical protein ABBFA_000120 [Acinetobacter baumannii
           AB307-0294]
 gi|332730976|gb|EGJ62282.1| hypothetical protein HMPREF0021_00083 [Acinetobacter baumannii
           6013150]
          Length = 245

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 11/94 (11%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQREL--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
           ++  + +L + Y  +   +  ++ E+     +Q  W   R  +C F    A  G      
Sbjct: 37  YSNSEHELNSVYSDIKGYISDNKNEVKYLVDTQRFWLKNRNLKCNFNGKEANSGN----- 91

Query: 98  YANCLQGHAIERNEKLE-SYLTCP--EGDLLCPF 128
              CL      + + L+ SYL     EG L+ PF
Sbjct: 92  -YKCLSDFNNSKIKDLKNSYLDLDNLEGKLIKPF 124


>gi|169794322|ref|YP_001712115.1| hypothetical protein ABAYE0122 [Acinetobacter baumannii AYE]
 gi|169147249|emb|CAM85108.1| hypothetical protein ABAYE0122 [Acinetobacter baumannii AYE]
          Length = 267

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 11/94 (11%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQREL--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
           ++  + +L + Y  +   +  ++ E+     +Q  W   R  +C F    A  G      
Sbjct: 59  YSNSEHELNSVYSDIKGYISDNKNEVKYLVDTQRFWLKNRNLKCNFNGKEANSGN----- 113

Query: 98  YANCLQGHAIERNEKLE-SYLTCP--EGDLLCPF 128
              CL      + + L+ SYL     EG L+ PF
Sbjct: 114 -YKCLSDFNNSKIKDLKNSYLDLDNLEGKLIKPF 146


>gi|288960108|ref|YP_003450448.1| hypothetical protein AZL_a03730 [Azospirillum sp. B510]
 gi|288912416|dbj|BAI73904.1| hypothetical protein AZL_a03730 [Azospirillum sp. B510]
          Length = 317

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 39/111 (35%), Gaps = 8/111 (7%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ--RELFEK 68
            +A   ++ + +C +     +   C+          + + YK +L  +   +  R     
Sbjct: 16  AVAGPAEAASFDCAQARSAEEKLICSTPPLDAADAAMGSAYKALLGDLAADEAGRGFARA 75

Query: 69  SQMAWEIYRGSECAFA-ASGAEEGTAQ--SMIYANCLQGHAIERNEKLESY 116
            Q AW   R   C F   +G E  +        A+CL+     R  +L + 
Sbjct: 76  EQRAWSQRRNRACGFGLPAGVEPESGYDNP---ADCLRAETERRAGQLAAL 123


>gi|302382021|ref|YP_003817844.1| hypothetical protein Bresu_0908 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192649|gb|ADL00221.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 122

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 36/111 (32%), Gaps = 15/111 (13%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL  +    Q+ + +C       ++  C   +      ++  TY  VL+ V    R    
Sbjct: 19  ALVPVGPGAQAASFDCTRARRADEVAICGNRALEDADVRMSTTYTLVLQLVGMGMRGDLR 78

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            SQ AW   R         G   G         C+      R ++LE+   
Sbjct: 79  DSQTAWLRER---------GRCGGNV------TCIARSYRARTQRLEAVFQ 114


>gi|238695143|ref|YP_002922337.1| hypothetical protein EpJSE_00265 [Enterobacteria phage JSE]
 gi|220029279|gb|ACL78214.1| hypothetical protein EpJSE_00265 [Enterobacteria phage JSE]
          Length = 272

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 46/123 (37%), Gaps = 21/123 (17%)

Query: 2   CRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            + II A+ + A AF + A   +C +   +++   C   S + +  KL   Y K + K++
Sbjct: 1   MKNIIAAIVLSATAFGANAASFDCAKATTKSEKFICANESISALDSKLHEVYVKAV-KID 59

Query: 60  KHQRELFEKSQMAW-EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                  ++ Q  W +  R +           G  Q       L+     + + L + L 
Sbjct: 60  PS----LKQEQRNWNKTVRDTMINI-------GQIQP------LEAVYNAQIQNLMNVLP 102

Query: 119 CPE 121
             E
Sbjct: 103 KEE 105


>gi|184159877|ref|YP_001848216.1| hypothetical protein ACICU_03560 [Acinetobacter baumannii ACICU]
 gi|183211471|gb|ACC58869.1| hypothetical protein ACICU_03560 [Acinetobacter baumannii ACICU]
 gi|322509792|gb|ADX05246.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
          Length = 233

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 11/94 (11%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQREL--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
           ++  + +L + Y  +   +  ++ E+     +Q  W   R  +C F    A  G      
Sbjct: 25  YSNSEHELNSVYSDIKGYISDNKNEVKYLVDTQRFWLKNRNLKCNFNGKEANSGN----- 79

Query: 98  YANCLQGHAIERNEKLE-SYLTCP--EGDLLCPF 128
              CL      + + L+ SYL     EG L+ PF
Sbjct: 80  -YKCLSDFNNSKIKDLKNSYLDLDNLEGKLIKPF 112


>gi|157149610|ref|YP_001456660.1| hypothetical protein CCC13826_0626 [Campylobacter concisus 13826]
 gi|112800193|gb|EAT97537.1| hypothetical protein CCC13826_0626 [Campylobacter concisus 13826]
          Length = 405

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 35/100 (35%), Gaps = 17/100 (17%)

Query: 2   CRKIIFALTIIAIAFQS-----MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
            + I  +  +I     S      + +C++   + +   C+    + V   ++  Y  ++ 
Sbjct: 4   LKLIFISTLLITSNLYSNDRIQPSFDCSKAKTRVEKLVCSDEDLSRVDRDMQKAYDLMMG 63

Query: 57  KVE------------KHQRELFEKSQMAWEIYRGSECAFA 84
           K +            K   E  ++SQ+ W  YR   C   
Sbjct: 64  KYDLAYMNEEAKEEIKPYLEKLKQSQIDWVKYRDKRCNAE 103


>gi|254284847|ref|ZP_04959814.1| probable urease-associated protein, putative [Vibrio cholerae
           AM-19226]
 gi|150425632|gb|EDN17408.1| probable urease-associated protein, putative [Vibrio cholerae
           AM-19226]
          Length = 135

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 41/124 (33%), Gaps = 11/124 (8%)

Query: 1   MCRKIIF-ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV- 58
           M + + F      + A  S +  C+ TL    +  C  N        L  +Y  + + V 
Sbjct: 1   MLKYLFFIGFIFSSSASASASDECDYTLPLGSIVACYENKNEESDAVLNKSYNDLKKLVM 60

Query: 59  ----EKHQREL----FEKSQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIER 109
               +   + +      KSQ  W   R S+C       E GT  Q +    CL      R
Sbjct: 61  GSPYDDETKGVYWSNIVKSQKNWIQMRDSQCLAKGVFFENGTDLQRIEIKKCLFLSTEIR 120

Query: 110 NEKL 113
              L
Sbjct: 121 VLYL 124


>gi|77919860|ref|YP_357675.1| hypothetical protein Pcar_2266 [Pelobacter carbinolicus DSM 2380]
 gi|77545943|gb|ABA89505.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 497

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 34/89 (38%), Gaps = 7/89 (7%)

Query: 5  IIFALTIIAIAFQSMAL----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          ++      +I   SMA     +C +   + +   C     + +  +++  Y   L+  E 
Sbjct: 9  LLCIALSFSITCASMAEGPSFDCEKAGTKIEKMICADAELSKLDVRIDEAYAAALQATEA 68

Query: 61 HQRELFEKSQMAWEIYRGSECAFAASGAE 89
           +    ++ Q  W   R + C  AA  +E
Sbjct: 69 PET--LKQQQRLWLKARNA-CDDAAGLSE 94


>gi|294789340|ref|ZP_06754578.1| conserved hypothetical protein [Simonsiella muelleri ATCC 29453]
 gi|294482765|gb|EFG30454.1| conserved hypothetical protein [Simonsiella muelleri ATCC 29453]
          Length = 240

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 34/79 (43%), Gaps = 4/79 (5%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
            +     ++++++++ +        R+   + Q AWE  R   C  AA+ A   T  S +
Sbjct: 162 KAHKKADDEIKSSWRNI----SPEIRKDLVEEQKAWEKQRNQRCRQAANAASNDTEASKL 217

Query: 98  YANCLQGHAIERNEKLESY 116
           Y  C      ER + L+ Y
Sbjct: 218 YMQCDTRMTKERVKNLQGY 236


>gi|76811342|ref|YP_332628.1| hypothetical protein BURPS1710b_1217 [Burkholderia pseudomallei
           1710b]
 gi|76580795|gb|ABA50270.1| putative exported protein [Burkholderia pseudomallei 1710b]
          Length = 199

 Score = 47.6 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 37/84 (44%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E  F  +  E  +G
Sbjct: 18  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHFVRAVYETTQG 77

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 78  TMYAMANADMRLQPVRERALALRG 101



 Score = 39.5 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 135 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 181

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 182 IGARVATLKRF 192


>gi|77460483|ref|YP_349990.1| hypothetical protein Pfl01_4262 [Pseudomonas fluorescens Pf0-1]
 gi|77384486|gb|ABA75999.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 479

 Score = 47.6 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 31/80 (38%), Gaps = 4/80 (5%)

Query: 1  MCRKIIFALTIIAIAFQSMAL--NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
          +  + I ++  +    Q++A   +C +     +   C       +  ++ A Y+K+++  
Sbjct: 22 IKGRYIVSVCALLFFQQAVASGMDCTKAASAVEKAICADKPLYELDAQMGAAYRKLMK-- 79

Query: 59 EKHQRELFEKSQMAWEIYRG 78
              +   + +Q  W   R 
Sbjct: 80 AAPAQAEVKNAQRQWLKERD 99


>gi|226944379|ref|YP_002799452.1| lipoprotein [Azotobacter vinelandii DJ]
 gi|226719306|gb|ACO78477.1| lipoprotein [Azotobacter vinelandii DJ]
          Length = 221

 Score = 47.6 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 32/102 (31%), Gaps = 13/102 (12%)

Query: 15  AFQSMALNCNETLMQA-DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
           A ++    C E L  A +   CT      +  K+   Y               E+ Q  W
Sbjct: 29  AGEAPPYECGENLSDALEKTICTDQDLTALDRKMAEVYAAARNGDSAGNPAGLEEQQRDW 88

Query: 74  EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
              R + C  +A   E           CLQ     R  +L++
Sbjct: 89  IESRDA-CEKSAEPPE-----------CLQESYRRRIAELQA 118


>gi|213967834|ref|ZP_03395981.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|213927610|gb|EEB61158.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 126

 Score = 47.6 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 50/125 (40%), Gaps = 11/125 (8%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK---- 60
           +  A+T +  A    A  C+         +C+  S    +E L+  +  +L++V+     
Sbjct: 1   MATAVTGVQAAQNPDASPCDGVDDDKQTLECSVYSRTTAEELLKENFNNLLKRVQSQFVA 60

Query: 61  ------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQGHAIERNEKL 113
                       + +Q AWE  R ++CA     +  G+    I   +C+   + ER+E L
Sbjct: 61  NKTQYNDFTSKLKTAQQAWEKLRDADCAVDVFPSAAGSKAFTISENDCIARMSDERSEYL 120

Query: 114 ESYLT 118
           ES   
Sbjct: 121 ESIAQ 125


>gi|332974227|gb|EGK11160.1| hypothetical protein HMPREF0476_0469 [Kingella kingae ATCC 23330]
          Length = 352

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 35/92 (38%), Gaps = 9/92 (9%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS 86
           + Q D+NQ      A   + ++ +++K+        ++     Q  WE  +   C    +
Sbjct: 265 VSQNDINQ-ANRDNAAADQAIKNSWRKI----SPDIQQTLVAEQRDWESKKNVSCR--NA 317

Query: 87  GAEEGTAQSMIYAN--CLQGHAIERNEKLESY 116
            A+ G+A    Y    C      ER + L  Y
Sbjct: 318 AAKGGSAAESQYLQMQCDTRLTRERVQYLNGY 349


>gi|300696822|ref|YP_003747483.1| hypothetical protein RCFBP_mp10276 [Ralstonia solanacearum
           CFBP2957]
 gi|299073546|emb|CBJ53066.1| exported protein of unknown function [Ralstonia solanacearum
           CFBP2957]
          Length = 115

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 36/95 (37%), Gaps = 14/95 (14%)

Query: 34  QCTGNSFALVKEKLEATYKK-------------VLEKVEKHQRELFEKSQMAWEIYRGSE 80
            C       + +++E  + +             V +++++  R  F ++Q  W  YR + 
Sbjct: 19  YCYAAESERLDKEVEVLFAEKLRQLDSLPKALAVSKELQREVRHNFTEAQAHWTAYRDAA 78

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           C F       GT +   Y++C       R   LE+
Sbjct: 79  CRFEGDSNL-GTGRPRAYSSCRIELDKRRIADLEA 112


>gi|126451849|ref|YP_001065695.1| hypothetical protein BURPS1106A_1422 [Burkholderia pseudomallei
           1106a]
 gi|242316413|ref|ZP_04815429.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|126225491|gb|ABN89031.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|242139652|gb|EES26054.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 141

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 38/106 (35%), Gaps = 4/106 (3%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + A    ++  +C+    Q  MN C      + + +L+             ++   E   
Sbjct: 32  LPASEVSALLADCDSN--QTSMNFCAWRDQIVAERELQQV-VDQQVSQHPERKAALEAKV 88

Query: 71  MAWEIYRGSECAFAASGA-EEGTAQSMIYANCLQGHAIERNEKLES 115
             W+  R + C  +A    ++G+ +    A C      +  +KL +
Sbjct: 89  AKWKKARDASCEKSARKEWDDGSMRPAAQAICATASTKKMTKKLSA 134


>gi|330879866|gb|EGH14015.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 46

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/46 (26%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 83  FAASGAEE-GTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           + A   E+ G+   ++ + CL      R ++L++Y+ C E    CP
Sbjct: 2   YQAGKPEDSGSIWPLLQSQCLADQTRVRLKQLQAYVACRE--EGCP 45


>gi|157157453|ref|YP_001463309.1| putative lipoprotein [Escherichia coli E24377A]
 gi|209919435|ref|YP_002293519.1| hypothetical protein ECSE_2244 [Escherichia coli SE11]
 gi|157079483|gb|ABV19191.1| putative lipoprotein [Escherichia coli E24377A]
 gi|209912694|dbj|BAG77768.1| conserved hypothetical protein [Escherichia coli SE11]
          Length = 307

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 34/93 (36%), Gaps = 12/93 (12%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           +E+L Q+ M      +FA     L   +     K+   +++    SQ  W   + + C  
Sbjct: 227 SESLDQSRM------AFANADSDLNTVW----SKLTPAKKKELLPSQRQWIKTKDAMCGK 276

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +    +   + M+  +C     + R   L + 
Sbjct: 277 VSMQGTDAEVKKMV--DCQTQMTLSRIAFLRNQ 307


>gi|310639420|ref|YP_003944179.1| hypothetical protein EIO_3074 [Ketogulonicigenium vulgare Y25]
 gi|308752996|gb|ADO44140.1| Conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 262

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/80 (15%), Positives = 24/80 (30%), Gaps = 3/80 (3%)

Query: 1   MCRKIIFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M   I      + +   + A    +C +     +   C     A     +   Y  ++E+
Sbjct: 44  MKYVIAAVTAALVLPSFAAAQAGFDCAKAQTDTEFAICKDAKIAAADLAMTRAYTALMER 103

Query: 58  VEKHQRELFEKSQMAWEIYR 77
                + L    Q A+   R
Sbjct: 104 AGAPLQSLLRADQRAFLAQR 123


>gi|21243931|ref|NP_643513.1| hypothetical protein XAC3205 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109540|gb|AAM38049.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 389

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 42/114 (36%), Gaps = 12/114 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 15  ALVLSAGAAWSASFDCKQAGTPVERRLCAVPALGQLDDQLDEAYRGVLDTAPRDSLTAVR 74

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
             Q AW   R + CA   +  ++          CL+     R + L   L   +
Sbjct: 75  DQQRAWLRQRNA-CA-QDAKVDD----------CLRRSLKARVDALGKILDAQQ 116


>gi|167845129|ref|ZP_02470637.1| hypothetical protein BpseB_07548 [Burkholderia pseudomallei B7210]
          Length = 141

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 38/106 (35%), Gaps = 4/106 (3%)

Query: 11  IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           + A    ++  +C+    Q  MN C      + + +L+             ++   E   
Sbjct: 32  LPASEVSALLADCDSN--QTSMNFCAWRDQIVAERELQQV-VDQQVSQHPERKTALEAKV 88

Query: 71  MAWEIYRGSECAFAASGA-EEGTAQSMIYANCLQGHAIERNEKLES 115
             W+  R + C  +A    ++G+ +    A C      +  +KL +
Sbjct: 89  AKWKKARDASCEKSARKEWDDGSMRPAAQAICATASTKKMTKKLSA 134


>gi|293610540|ref|ZP_06692840.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826884|gb|EFF85249.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 257

 Score = 47.6 bits (112), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 43/127 (33%), Gaps = 15/127 (11%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL- 65
           F   ++  +  +    C+        +      +   +  L  TY  V   +  ++ E+ 
Sbjct: 19  FFSVLLVFSLSA----CSNAADYKPQHLDEKTVYKNSEHDLNNTYSDVKSYISDNKNEVK 74

Query: 66  -FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE-SYLTCP--E 121
               +Q +W   R  +C F    A            CL      + + L  SYL     E
Sbjct: 75  YLIDTQRSWLRNRNLKCNFNGKEANN------ENYKCLSDFNNSKIKDLRISYLDFDSLE 128

Query: 122 GDLLCPF 128
           G+L+ PF
Sbjct: 129 GNLIKPF 135


>gi|212633155|ref|YP_002309680.1| lipoprotein [Shewanella piezotolerans WP3]
 gi|212554639|gb|ACJ27093.1| Lipoprotein, putative [Shewanella piezotolerans WP3]
          Length = 189

 Score = 47.2 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 29/77 (37%), Gaps = 3/77 (3%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          ++     +     S + +CN+     +   C     A +  +L   Y + L K+   Q+ 
Sbjct: 8  VLAIFLSLPALAASPSFDCNKASGSVETLICNDAELATLDRQLAQVYHQALPKIPAAQQP 67

Query: 65 LFEKSQMAWEIYRGSEC 81
            + +Q  W   R  +C
Sbjct: 68 --KATQRGWIKGRN-DC 81


>gi|83951670|ref|ZP_00960402.1| hypothetical protein ISM_13945 [Roseovarius nubinhibens ISM]
 gi|83836676|gb|EAP75973.1| hypothetical protein ISM_13945 [Roseovarius nubinhibens ISM]
          Length = 235

 Score = 47.2 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 10/62 (16%), Positives = 20/62 (32%)

Query: 17 QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
          Q  + NC +     +   C     + + +++   YK     +    R      Q +W   
Sbjct: 27 QQPSFNCAKAGTPTEHAICASPLLSALDQEIAEAYKAKRATLGNEARAALLAEQRSWLKT 86

Query: 77 RG 78
          R 
Sbjct: 87 RD 88


>gi|225375221|ref|ZP_03752442.1| hypothetical protein ROSEINA2194_00846 [Roseburia inulinivorans DSM
           16841]
 gi|225212888|gb|EEG95242.1| hypothetical protein ROSEINA2194_00846 [Roseburia inulinivorans DSM
           16841]
          Length = 366

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 35/106 (33%), Gaps = 1/106 (0%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMA 72
             ++ +      +  +Q+ M+      + +    L   +  V     + +       Q  
Sbjct: 262 QASYDAAEEELKKATLQSRMDDYAMQMYDISDSCLNEIWNLVKYNTSEEKFNEILTEQRK 321

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           W   + +         +  +AQ M  +  +    +ER E+L  YL 
Sbjct: 322 WIADKEAAGNEILDQNDGSSAQ-MDSSLKMAELTMERCEELADYLK 366


>gi|84687965|ref|ZP_01015829.1| lipoprotein, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84663997|gb|EAQ10497.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2654]
          Length = 200

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 28/82 (34%), Gaps = 6/82 (7%)

Query: 4  KIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK---VEK 60
           +      + +A +    +C +   +A++  C     A +  +L  TY   L     ++ 
Sbjct: 7  TVFACCPGVVLAQEGPTFDCAKATHEAEIAICENAELAALDRRLAETYGAALAMAEGLDA 66

Query: 61 HQREL---FEKSQMAWEIYRGS 79
            +      +  Q  W   R +
Sbjct: 67 GAKTAVAELKAYQRGWIGGRDA 88


>gi|325524855|gb|EGD02806.1| hypothetical protein B1M_19639 [Burkholderia sp. TJI49]
          Length = 103

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46 KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 39 DLNRYYQKLRRKMPAHSAATLVRAQRAWIAFRDATA 74


>gi|325919507|ref|ZP_08181527.1| putative lipoprotein [Xanthomonas gardneri ATCC 19865]
 gi|325550010|gb|EGD20844.1| putative lipoprotein [Xanthomonas gardneri ATCC 19865]
          Length = 389

 Score = 46.8 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 40/110 (36%), Gaps = 12/110 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A    + + +C +     +   C   +   + ++L+ +Y+ ++E   +       
Sbjct: 15  ALLLGASGAWAASFDCKQASTAVEKRLCAVPALGDLDDQLDESYRALVETTPRSSVASVR 74

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
             Q AW   R + CA  A              +CLQ     R + L   L
Sbjct: 75  DQQRAWLRQRNA-CAQDAK-----------LDDCLQRSLKARADVLAKAL 112


>gi|330874653|gb|EGH08802.1| hypothetical protein PSYMP_07790 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330967277|gb|EGH67537.1| hypothetical protein PSYAC_22013 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 136

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 44/110 (40%), Gaps = 11/110 (10%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK----------HQRELFEKS 69
           A  C+         +C+  S    ++ L+  +  +L++V+                 + +
Sbjct: 26  ASPCDGVDDDKQTLECSVYSRTTAEQLLKENFDNLLKRVQSQFVANKSQFNDFTSKLKTA 85

Query: 70  QMAWEIYRGSECAFAASGAEEGTAQSMIY-ANCLQGHAIERNEKLESYLT 118
           Q AWE  R ++CA     +  G+    I   +C+   + ER+E LES   
Sbjct: 86  QQAWEKLRDADCAVDVFPSAAGSKAFTISENDCIARMSDERSEYLESIAQ 135


>gi|161503670|ref|YP_001570782.1| hypothetical protein SARI_01754 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865017|gb|ABX21640.1| hypothetical protein SARI_01754 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 109

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 39/116 (33%), Gaps = 15/116 (12%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  +   + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLITFALLTPLLVNAASFDCQKAKAADEKTICAHLALNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             R   + +Q +W   R  +C   A+              CL     ER ++L++ 
Sbjct: 61  GNRGALQDAQQSWLKQR-QQCKTDAA--------------CLTKAYNERLKQLDAL 101


>gi|87124504|ref|ZP_01080353.1| hypothetical protein RS9917_12860 [Synechococcus sp. RS9917]
 gi|86168076|gb|EAQ69334.1| hypothetical protein RS9917_12860 [Synechococcus sp. RS9917]
          Length = 106

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 37/119 (31%), Gaps = 18/119 (15%)

Query: 1   MCRKIIFALTIIAI---AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R ++ A   +     + Q  A+ C       +M  C   ++     +L        EK
Sbjct: 1   MKRLLLVAGLTLFPDVVSAQPAAIQCPG-DTTPEMRYCAEQAWRRSDAQL-------REK 52

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           V     + ++ +  A        CA A +   EGT    +   C         ++    
Sbjct: 53  VSPELMQQWQDATKA-------LCAAAYASYLEGTIYPQLVVGCDDNLNRALLKEFRGL 104


>gi|323937522|gb|EGB33792.1| hypothetical protein ERCG_01273 [Escherichia coli E1520]
          Length = 256

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 45/123 (36%), Gaps = 21/123 (17%)

Query: 2   CRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            + II A+ + A AF + A   +C +   +++   C   S + +  KL   Y K ++   
Sbjct: 1   MKNIIAAIMLSATAFGADAASFDCTKATTKSEKFICANESISALDSKLHEVYVKAVKI-- 58

Query: 60  KHQRELFEKSQMAW-EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                  ++ Q  W +  R +           G  Q       L+     + + L + L+
Sbjct: 59  ---NPSLKQEQRNWNKTVRDTMINI-------GQIQP------LEAVYNAQIQNLMNVLS 102

Query: 119 CPE 121
             E
Sbjct: 103 KEE 105


>gi|157311562|ref|YP_001469605.1| hypothetical protein phi1p262 [Enterobacteria phage Phi1]
 gi|149380766|gb|ABR24771.1| hypothetical protein phi1p262 [Enterobacteria phage Phi1]
          Length = 266

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 45/123 (36%), Gaps = 21/123 (17%)

Query: 2   CRKIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            + II A+ + A  F + A   +C +   +++   C   S + +  KL   Y K + K++
Sbjct: 1   MKNIIAAIVLSATTFGANAASFDCAKATTKSEKFICANESISALDSKLHEVYVKAV-KID 59

Query: 60  KHQRELFEKSQMAW-EIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
                  ++ Q  W +  R +           G  Q       L+     + + L + L 
Sbjct: 60  PS----LKQEQRNWNKTVRDTMINI-------GQIQP------LEAVYNAQIQNLMNVLP 102

Query: 119 CPE 121
             E
Sbjct: 103 KEE 105


>gi|158421959|ref|YP_001523251.1| hypothetical protein AZC_0335 [Azorhizobium caulinodans ORS 571]
 gi|158328848|dbj|BAF86333.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 236

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/62 (14%), Positives = 23/62 (37%)

Query: 21 LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
           +C     + +   C   + + +  ++ A Y+K+L  ++   R      Q  +   R  +
Sbjct: 32 FDCRAARSKIEKAICADPALSALDRRIAAAYQKLLAALDAPGRTALRMDQRTFLEARDIQ 91

Query: 81 CA 82
            
Sbjct: 92 AR 93


>gi|134291977|ref|YP_001115746.1| hypothetical protein Bcep1808_6597 [Burkholderia vietnamiensis G4]
 gi|134135166|gb|ABO59491.1| conserved hypothetical protein [Burkholderia vietnamiensis G4]
          Length = 347

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 29/99 (29%), Gaps = 17/99 (17%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           A  +   +C +     +   C       +  +L   ++K   K         + +Q+ W 
Sbjct: 32  AAHAAGFDCAKAASPTEHAICADARLFALDGQLATAWQKARAKGGDTAAP--KAAQLKWL 89

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             R   C         G       A+C+     ER   L
Sbjct: 90  AQRD-RC--------GGD------ASCIADRYRERLAIL 113


>gi|146277875|ref|YP_001168034.1| hypothetical protein Rsph17025_1838 [Rhodobacter sphaeroides ATCC
          17025]
 gi|145556116|gb|ABP70729.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC
          17025]
          Length = 225

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 17/58 (29%)

Query: 21 LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
           +C+      +   C+  + A +   +   Y           R+     Q AW   R 
Sbjct: 22 FDCSRAGTMVEHAICSDPALAALDRDVAQAYGAARAGQPPAARDQLLAEQRAWLAARD 79


>gi|257126947|ref|YP_003165061.1| hypothetical protein Lebu_2218 [Leptotrichia buccalis C-1013-b]
 gi|257050886|gb|ACV40070.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 202

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 7/46 (15%), Positives = 18/46 (39%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           + M      ++    ++L   YK ++ ++   Q+      + AW  
Sbjct: 103 SQMYYQAEAAYQAWDKELNKVYKLLMSELPDSQKTKLRNEERAWLK 148


>gi|294624512|ref|ZP_06703192.1| secreted protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292601188|gb|EFF45245.1| secreted protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 385

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 42/114 (36%), Gaps = 12/114 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 11  ALVLSAGAAWSASFDCKQAGTPVEKRLCAVPALGQLDDQLDEAYRGVLDTAPRASLTAVR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
             Q AW   R + CA   +  ++          CLQ     R + L   L   +
Sbjct: 71  DQQRAWLRQRNA-CA-QDAKVDD----------CLQRSLKARVDALGKTLDAQQ 112


>gi|170697589|ref|ZP_02888678.1| hypothetical protein BamIOP4010DRAFT_0740 [Burkholderia ambifaria
           IOP40-10]
 gi|170137476|gb|EDT05715.1| hypothetical protein BamIOP4010DRAFT_0740 [Burkholderia ambifaria
           IOP40-10]
          Length = 334

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 29/96 (30%), Gaps = 18/96 (18%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C + + + +   C+    A    +L A Y     K         +  Q  W   R + 
Sbjct: 257 FDCGQAVSKIEKLICSTPETADADRRLNAAYSAARAKTNDLVG--LKDDQRQWLKARNA- 313

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           C  AA               CL      R ++L + 
Sbjct: 314 CDDAA---------------CLLNVTQVRIQRLSAM 334


>gi|187924611|ref|YP_001896253.1| hypothetical protein Bphyt_2634 [Burkholderia phytofirmans PsJN]
 gi|187715805|gb|ACD17029.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 192

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 43/117 (36%), Gaps = 18/117 (15%)

Query: 3   RKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           R ++ A  ++A     + + +CN      +   C   + + + + L   Y K   +V  +
Sbjct: 5   RPLLIAALMLAHPVAHATSFDCNRGRSLTEKMICNNPALSKLDDTLGQLYWKARRRVS-N 63

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           +R     S   W  +R + C  AA               CL      R E+L++ + 
Sbjct: 64  RRAFLTDSDSKW-AWREANCRDAA---------------CLGTWYATRIEELQTLIE 104


>gi|222084733|ref|YP_002543262.1| hypothetical protein Arad_0710 [Agrobacterium radiobacter K84]
 gi|221722181|gb|ACM25337.1| hypothetical protein Arad_0710 [Agrobacterium radiobacter K84]
          Length = 118

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 35/88 (39%), Gaps = 4/88 (4%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           ++M +C          +L A Y  + ++    +R   +  Q AW  +   E    A+   
Sbjct: 27  SEMLKCGQVEIDKFDARLNAAYNILTDRKHGAERLRLQGEQRAWLKHHLQEAHRLAADPN 86

Query: 90  EGTAQSMIYANC--LQGHAIERNEKLES 115
           +G+A +++ +    L      R  +LE 
Sbjct: 87  DGSA-ALLVSQGFELDDLT-ARTLELEK 112


>gi|85703224|ref|ZP_01034328.1| hypothetical protein ROS217_20822 [Roseovarius sp. 217]
 gi|85672152|gb|EAQ27009.1| hypothetical protein ROS217_20822 [Roseovarius sp. 217]
          Length = 152

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 30/91 (32%), Gaps = 10/91 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVE----------KHQRELFEKSQMAWEIYRGSECAFA 84
           C     A     L   Y+++  K+             Q E     Q AW  +R ++C + 
Sbjct: 57  CLDRERAQWDGWLNTVYQQLYAKLAAQDAQIQSYAPKQAEALRDMQRAWIEFRDAKCGYE 116

Query: 85  ASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           A+    GT       NC       +   L+S
Sbjct: 117 AAQWGGGTGAGPAAVNCHLHATARQMLYLQS 147


>gi|302382749|ref|YP_003818572.1| hypothetical protein Bresu_1638 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193377|gb|ADL00949.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 127

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 40/123 (32%), Gaps = 18/123 (14%)

Query: 10  TIIAIAFQSMALNCNETLMQADMN------------------QCTGNSFALVKEKLEATY 51
            I   A  +++    +  +QA M                    C          +L   Y
Sbjct: 1   MIALFAATALSFAQADPEIQAQMTPVYLQCMAAAGRVPERRLACMTAETERQDHRLNVVY 60

Query: 52  KKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           +++        R      + AW   R S CA   + A  G+  ++ +A+C     IER  
Sbjct: 61  RRMRTAASPEDRIELRDMERAWIQMRDSYCAADRARAGAGSRAAVAFADCYLAETIERRV 120

Query: 112 KLE 114
            LE
Sbjct: 121 WLE 123


>gi|126727157|ref|ZP_01742994.1| hypothetical protein RB2150_00939 [Rhodobacterales bacterium
           HTCC2150]
 gi|126703585|gb|EBA02681.1| hypothetical protein RB2150_00939 [Rhodobacterales bacterium
           HTCC2150]
          Length = 226

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 42/119 (35%), Gaps = 20/119 (16%)

Query: 5   IIFALTIIAIAFQSMALN-----CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           I+  L  +A    + A       C+  L   +   C     A++   L  T+K +L  + 
Sbjct: 7   ILGTLITVAHVNAAFAERILPRWCSNNLNSLERAICRTPELAVLDVTLGETFKVILRGLP 66

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           + Q +  +  Q  W  +R + C     G +           CL+     R  +L  YL 
Sbjct: 67  EEQSDALDDQQAVWRKWR-ATC-----GTD---------LICLKHRYTTRIIELAGYLP 110


>gi|154254024|ref|YP_001414848.1| hypothetical protein Plav_3593 [Parvibaculum lavamentivorans DS-1]
 gi|154157974|gb|ABS65191.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1]
          Length = 323

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 32/101 (31%), Gaps = 13/101 (12%)

Query: 22  NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           +C +     +   C+  + + + E++   Y      +     E+  KSQ +W  +    C
Sbjct: 24  DCGKASSPREKAICSDEALSALDEEIAGAYASARAALSPRGAEILRKSQRSWLRFLDKAC 83

Query: 82  AFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
                            A CL     ++ + L   +    G
Sbjct: 84  -------------PRATAACLAPWMEDQAKFLAGAVVKKSG 111


>gi|156932861|ref|YP_001436777.1| hypothetical protein ESA_00658 [Cronobacter sakazakii ATCC BAA-894]
 gi|156531115|gb|ABU75941.1| hypothetical protein ESA_00658 [Cronobacter sakazakii ATCC BAA-894]
          Length = 401

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 40/116 (34%), Gaps = 13/116 (11%)

Query: 2   CRKIIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
            R++   +T+   A  ++  + +C++     +   C   S   +  K+  +Y +    + 
Sbjct: 10  LRRLALCVTLACGAAPAIGASFDCDKAGTPVEHAICQQTSLGELDSKISDSYLRATSSMT 69

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
                     Q AW   R + CA  AS              CL      R E+LE 
Sbjct: 70  AQDAAALRTEQRAWLKTRNA-CAGNASE----------LNACLMATMKPRAEQLER 114


>gi|260429484|ref|ZP_05783461.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260420107|gb|EEX13360.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 211

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/78 (14%), Positives = 32/78 (41%), Gaps = 3/78 (3%)

Query: 5  IIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE--KVEKH 61
          +I  + +++ A       +C      A+   C+ ++ A +  +L   +++  E   ++  
Sbjct: 11 VISVIALMSPALALEPPFDCTRAESDAEKAVCSDDTLASMDLELSRLFQRAAEGPNMDPE 70

Query: 62 QRELFEKSQMAWEIYRGS 79
          +  + +  Q  W   R +
Sbjct: 71 RHRMLQAEQRGWIKGRDA 88


>gi|161614529|ref|YP_001588494.1| hypothetical protein SPAB_02278 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161363893|gb|ABX67661.1| hypothetical protein SPAB_02278 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 109

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 40/115 (34%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++ ++ + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVKAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R+  + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRDALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|295675294|ref|YP_003603818.1| hypothetical protein BC1002_0200 [Burkholderia sp. CCGE1002]
 gi|295435137|gb|ADG14307.1| conserved hypothetical protein [Burkholderia sp. CCGE1002]
          Length = 147

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 45/121 (37%), Gaps = 12/121 (9%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV---LEKVEKH 61
           ++ A  +   + +++   C     QA M  C        K+ L    +K+   L + ++ 
Sbjct: 19  VLAASAVPVASERALREEC-SAFSQAGMRDCLAEKAEASKKTLRRAEEKMAGTLARWDED 77

Query: 62  QR------ELFEKSQMAWEIYRGSECAFAASGAEE--GTAQSMIYANCLQGHAIERNEKL 113
           ++           S   +  YR S+C FAAS      G A  +    C+      R E+L
Sbjct: 78  EKYVNQARAQLAASNRKFVRYRESQCDFAASLTGGAAGNAHEISRLACVSELNNRRAEQL 137

Query: 114 E 114
            
Sbjct: 138 R 138


>gi|78062237|ref|YP_372145.1| hypothetical protein Bcep18194_B1387 [Burkholderia sp. 383]
 gi|77970122|gb|ABB11501.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 132

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 37/115 (32%), Gaps = 22/115 (19%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------ 58
           +   +        + + NC +     +   CT  + + + + L A Y++V++        
Sbjct: 6   VALVVAAGMTGAHAASFNCAKASTFVEREICTNPALSRLDDALNADYQRVVDDFANYPVE 65

Query: 59  EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           +  +   F  SQ AW   R   C                   CL     +R + L
Sbjct: 66  DPPEYHSFIASQKAWLKTRN-RCT---------------TTQCLIDSYRKRIDVL 104


>gi|325929057|ref|ZP_08190212.1| hypothetical protein conserved in bacteria, putative lipoprotein
           [Xanthomonas perforans 91-118]
 gi|325540590|gb|EGD12177.1| hypothetical protein conserved in bacteria, putative lipoprotein
           [Xanthomonas perforans 91-118]
          Length = 385

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 40/114 (35%), Gaps = 12/114 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 11  ALVLSAGAAWSASFDCKQAGTPVEKRLCAVPALGQLDDQLDEAYRGVLDTTPRASLTAVR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
             Q AW   R + CA  A               CLQ     R + L   L   +
Sbjct: 71  DQQRAWLRQRNA-CAQDAK-----------VDACLQRSLKTRVDALGKTLDAQQ 112


>gi|262375141|ref|ZP_06068375.1| predicted protein [Acinetobacter lwoffii SH145]
 gi|262310154|gb|EEY91283.1| predicted protein [Acinetobacter lwoffii SH145]
          Length = 114

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 10/78 (12%), Positives = 30/78 (38%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          + + I+   +++  +  + + +C +     +   C          K+  +Y  +   V  
Sbjct: 4  LSQGIVIFFSLLVGSTYAASFDCQKAETVTEKAICEHRLLNDADVKMSTSYHILRRMVPM 63

Query: 61 HQRELFEKSQMAWEIYRG 78
            R + ++ Q+ W  +R 
Sbjct: 64 GTRSVIQRDQVKWLQFRD 81


>gi|158604905|gb|ABW74729.1| hypothetical protein CCC13826_1937 [Campylobacter concisus 13826]
          Length = 409

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 35/98 (35%), Gaps = 17/98 (17%)

Query: 2   CRKIIFALTIIAIAFQS-----MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
            + I  +  +I     S      + +C++   + +   C+    + V   ++  Y  ++ 
Sbjct: 4   LKLIFISTLLITSNLYSSEKIQPSFDCSKAKTRVEKLVCSDEDISRVDRDMQKAYDLMMG 63

Query: 57  KVE------------KHQRELFEKSQMAWEIYRGSECA 82
           K +            K   E  ++SQ+ W  YR   C 
Sbjct: 64  KYDLAYMNEEAKEEIKPYLEKLKQSQIDWVKYRDKYCN 101


>gi|91784308|ref|YP_559514.1| hypothetical protein Bxe_A1492 [Burkholderia xenovorans LB400]
 gi|91688262|gb|ABE31462.1| hypothetical protein Bxe_A1492 [Burkholderia xenovorans LB400]
          Length = 222

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 42/118 (35%), Gaps = 18/118 (15%)

Query: 2   CRKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
            R ++ A+ ++A     + + +CN      +   C   + + + + L   Y K   +V  
Sbjct: 31  LRPLLIAVLMLAHPLAHAASFDCNRGRSPTEKMICGDPALSKLDDALGQLYWKARRRV-T 89

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
           ++R     S   W  +R + C  AA               CL      R E+L   + 
Sbjct: 90  NRRAFLTDSDGKW-AWREANCRDAA---------------CLGTWYATRIEELRKLVE 131


>gi|163746187|ref|ZP_02153546.1| hypothetical protein OIHEL45_11383 [Oceanibulbus indolifex HEL-45]
 gi|161380932|gb|EDQ05342.1| hypothetical protein OIHEL45_11383 [Oceanibulbus indolifex HEL-45]
          Length = 161

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 24/94 (25%), Gaps = 13/94 (13%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVE-------------KHQRELFEKSQMAWE 74
               M  C           L   Y+  + + +               Q E     Q AW 
Sbjct: 59  STYGMGGCLDRELRYWDTLLNENYRARMVQAKSADEDTAMYQPELPKQAEALRDMQRAWI 118

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIE 108
            +R + C +  S    GT        CL     E
Sbjct: 119 TFRDAACDYERSQWGGGTGGGPATLACLMRLTGE 152


>gi|107029033|ref|YP_626128.1| hypothetical protein Bcen_6292 [Burkholderia cenocepacia AU 1054]
 gi|116689808|ref|YP_835431.1| hypothetical protein Bcen2424_1787 [Burkholderia cenocepacia
          HI2424]
 gi|105898197|gb|ABF81155.1| conserved hypothetical protein [Burkholderia cenocepacia AU 1054]
 gi|116647897|gb|ABK08538.1| conserved hypothetical protein [Burkholderia cenocepacia HI2424]
          Length = 280

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 27/69 (39%), Gaps = 1/69 (1%)

Query: 12 IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQ 70
          + +A  S A++C + +   +   C   +      +L A Y   L+       R++  +SQ
Sbjct: 23 VGVALPSFAMDCAKAVQPIEKRICASPALRAADARLNAAYAGALKAAPDAAIRDMLVRSQ 82

Query: 71 MAWEIYRGS 79
            W   R  
Sbjct: 83 RRWLDARNK 91


>gi|188993783|ref|YP_001905793.1| conserved putative secreted protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167735543|emb|CAP53758.1| conserved putative secreted protein [Xanthomonas campestris pv.
           campestris]
          Length = 146

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 37/108 (34%), Gaps = 7/108 (6%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71
           ++  + +        + QA    C      +   +L   YK++L  ++   R     +Q 
Sbjct: 40  LSTTYAACQKQARGAIEQA---ACISQEEMIQDRRLNKVYKQLLASLKADSRTKLVDAQR 96

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAI--ERNEKLESYL 117
            W + R  +    A     G +Q     +          R ++LE YL
Sbjct: 97  TWLLSRTKDGNLEAVIY--GDSQPENIESAEAAMLRLSARADQLEEYL 142


>gi|254248095|ref|ZP_04941416.1| hypothetical protein BCPG_02920 [Burkholderia cenocepacia PC184]
 gi|124872871|gb|EAY64587.1| hypothetical protein BCPG_02920 [Burkholderia cenocepacia PC184]
          Length = 365

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 28/72 (38%), Gaps = 1/72 (1%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFE 67
           +T + +A    A++C + +   +   C   +      +L A Y   L+       R++  
Sbjct: 105 MTGVGVALPGFAMDCAKAVQPIEKRICANPALRAADARLNAAYAGALKAAPDAAIRDMLV 164

Query: 68  KSQMAWEIYRGS 79
           +SQ  W   R  
Sbjct: 165 RSQRRWLDARNK 176


>gi|293610096|ref|ZP_06692397.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827328|gb|EFF85692.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124264|gb|ADY83787.1| hypothetical protein BDGL_003201 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 117

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 46/123 (37%), Gaps = 20/123 (16%)

Query: 1   MCRKIIFALTIIAIAF-----QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M  K+   L +++        Q+ + +C+    + + + C   S      K+  TY+ VL
Sbjct: 1   MNNKLAICLALLSGIAFTQNLQAASFSCDAAKTKTEKSICKNRSLNDADVKMATTYQIVL 60

Query: 56  EKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             +    R+  + +Q  W   R +  A                 +C+     +R ++L++
Sbjct: 61  HALPMGGRDNQKDTQQQWLKKRNACAA---------------NVSCISKAYQQRQKQLDT 105

Query: 116 YLT 118
            L 
Sbjct: 106 ILQ 108


>gi|262373793|ref|ZP_06067071.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311546|gb|EEY92632.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 246

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 32/82 (39%), Gaps = 9/82 (10%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQREL--FEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
           +   + +L + Y  +   +  ++ E+     +Q +W   R  +C F       G  ++  
Sbjct: 37  YKNSEHELNSIYFDIKIYIGDNKNEVKYLVDTQRSWLKNRNLKCDFN------GKEENYE 90

Query: 98  YANCLQGHAIERNEKL-ESYLT 118
              CL      + + L +SYL 
Sbjct: 91  NYKCLSDFNNSKIKDLRKSYLN 112


>gi|134281016|ref|ZP_01767725.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|134247322|gb|EBA47407.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
          Length = 238

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 57  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 116

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 117 TMYAMANADMRLQPVRERALALRG 140



 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 174 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 220

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 221 IGARVATLKRF 231


>gi|121600798|ref|YP_993606.1| hypothetical protein BMASAVP1_A2297 [Burkholderia mallei SAVP1]
 gi|124385213|ref|YP_001028933.1| hypothetical protein BMA10229_A2989 [Burkholderia mallei NCTC
           10229]
 gi|226194328|ref|ZP_03789926.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242316992|ref|ZP_04816008.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254178304|ref|ZP_04884959.1| hypothetical protein BMA10399_E0213 [Burkholderia mallei ATCC
           10399]
 gi|254199390|ref|ZP_04905756.1| hypothetical protein BMAFMH_C0215 [Burkholderia mallei FMH]
 gi|254205704|ref|ZP_04912056.1| hypothetical protein BMAJHU_C0224 [Burkholderia mallei JHU]
 gi|254357865|ref|ZP_04974138.1| hypothetical protein BMA721280_A1261 [Burkholderia mallei
           2002721280]
 gi|121229608|gb|ABM52126.1| hypothetical protein BMASAVP1_A2297 [Burkholderia mallei SAVP1]
 gi|124293233|gb|ABN02502.1| hypothetical protein BMA10229_A2989 [Burkholderia mallei NCTC
           10229]
 gi|147748986|gb|EDK56060.1| hypothetical protein BMAFMH_C0215 [Burkholderia mallei FMH]
 gi|147753147|gb|EDK60212.1| hypothetical protein BMAJHU_C0224 [Burkholderia mallei JHU]
 gi|148026992|gb|EDK85013.1| hypothetical protein BMA721280_A1261 [Burkholderia mallei
           2002721280]
 gi|160699343|gb|EDP89313.1| hypothetical protein BMA10399_E0213 [Burkholderia mallei ATCC
           10399]
 gi|225933413|gb|EEH29402.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242140231|gb|EES26633.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 242

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 61  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 120

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 121 TMYAMANADMRLQPVRERALALRG 144



 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 178 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 224

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 225 IGARVATLKRF 235


>gi|167918025|ref|ZP_02505116.1| hypothetical protein BpseBC_05688 [Burkholderia pseudomallei
           BCC215]
 gi|254190796|ref|ZP_04897303.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|157938471|gb|EDO94141.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
          Length = 239

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 58  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 117

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 118 TMYAMANADMRLQPVRERALALRG 141



 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 175 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 221

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 222 IGARVATLKRF 232


>gi|126440468|ref|YP_001058109.1| hypothetical protein BURPS668_1059 [Burkholderia pseudomallei 668]
 gi|167814743|ref|ZP_02446423.1| hypothetical protein Bpse9_06347 [Burkholderia pseudomallei 91]
 gi|167893295|ref|ZP_02480697.1| hypothetical protein Bpse7_05985 [Burkholderia pseudomallei 7894]
 gi|254181398|ref|ZP_04887995.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|126219961|gb|ABN83467.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|184211936|gb|EDU08979.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
          Length = 236

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 55  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 114

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 115 TMYAMANADMRLQPVRERALALRG 138



 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 172 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 218

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 219 IGARVATLKRF 229


>gi|110678670|ref|YP_681677.1| hypothetical protein RD1_1349 [Roseobacter denitrificans OCh 114]
 gi|109454786|gb|ABG30991.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 212

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 27/81 (33%), Gaps = 7/81 (8%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------EK 60
            A T +       + +C +   QA+   C   + A +  +L   +   LE         +
Sbjct: 21  LAATGVNAETTGPSFDCAKASSQAEDLICADAALATLDRRLALRFGAALEAAGNIEDDTE 80

Query: 61  HQRELFEKSQMAWEIYRGSEC 81
           + R      Q  W   R  EC
Sbjct: 81  NARTTLRAMQRGWIKGRD-EC 100


>gi|53718646|ref|YP_107632.1| hypothetical protein BPSL1004 [Burkholderia pseudomallei K96243]
 gi|53725201|ref|YP_102486.1| hypothetical protein BMA0716 [Burkholderia mallei ATCC 23344]
 gi|126450832|ref|YP_001081154.1| hypothetical protein BMA10247_1610 [Burkholderia mallei NCTC 10247]
 gi|126455025|ref|YP_001065345.1| hypothetical protein BURPS1106A_1065 [Burkholderia pseudomallei
           1106a]
 gi|167003041|ref|ZP_02268831.1| hypothetical protein BMAPRL20_A0728 [Burkholderia mallei PRL-20]
 gi|167901753|ref|ZP_02488958.1| hypothetical protein BpseN_05700 [Burkholderia pseudomallei NCTC
           13177]
 gi|167909992|ref|ZP_02497083.1| hypothetical protein Bpse112_05831 [Burkholderia pseudomallei 112]
 gi|254298279|ref|ZP_04965731.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|52209060|emb|CAH35000.1| putative exported protein [Burkholderia pseudomallei K96243]
 gi|52428624|gb|AAU49217.1| hypothetical protein BMA0716 [Burkholderia mallei ATCC 23344]
 gi|126228667|gb|ABN92207.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126243702|gb|ABO06795.1| hypothetical protein BMA10247_1610 [Burkholderia mallei NCTC 10247]
 gi|157808157|gb|EDO85327.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|243061346|gb|EES43532.1| hypothetical protein BMAPRL20_A0728 [Burkholderia mallei PRL-20]
          Length = 240

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 59  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 118

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 119 TMYAMANADMRLQPVRERALALRG 142



 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 176 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 222

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 223 IGARVATLKRF 233


>gi|78048885|ref|YP_365060.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037315|emb|CAJ25060.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 384

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 40/114 (35%), Gaps = 12/114 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 11  ALVLSAGAAWSASFDCKQAGTPVEKRLCAVPALGQLDDQLDEAYRGVLDTTPRASLTAVR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
             Q AW   R + CA  A               CLQ     R + L   L   +
Sbjct: 71  DQQRAWLRQRNA-CAQDAK-----------VDACLQRSLKTRVDALGKTLDAQQ 112


>gi|294666961|ref|ZP_06732190.1| secreted protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292603250|gb|EFF46672.1| secreted protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 338

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 41/114 (35%), Gaps = 12/114 (10%)

Query: 8   ALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           AL + A A  S + +C +     +   C   +   + ++L+  Y+ VL+   +       
Sbjct: 11  ALVLSAGAAWSASFDCKQAGTPVEKRLCAVPALGQLDDQLDEAYRGVLDTAPRASLTAVR 70

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPE 121
             Q AW   R + CA  A              +CLQ     R + L   L   +
Sbjct: 71  DQQRAWLRQRNA-CAQDAK-----------VDDCLQRSLKARVDALGKTLDAQQ 112


>gi|291614076|ref|YP_003524233.1| hypothetical protein Slit_1613 [Sideroxydans lithotrophicus ES-1]
 gi|291584188|gb|ADE11846.1| protein of unknown function DUF1311 [Sideroxydans lithotrophicus
           ES-1]
          Length = 280

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 26/62 (41%), Gaps = 3/62 (4%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            NC++   Q +   C+ N    +   L+A Y+ +L+  +  +     + Q  W   R  E
Sbjct: 199 FNCSKAESQVEKLICSENEMKSLDRLLDAIYRNMLK--QDRRSNSLREMQRQWMKKRN-E 255

Query: 81  CA 82
           C 
Sbjct: 256 CQ 257


>gi|257126849|ref|YP_003164963.1| hypothetical protein Lebu_2113 [Leptotrichia buccalis C-1013-b]
 gi|257050788|gb|ACV39972.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 198

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 29/92 (31%), Gaps = 11/92 (11%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
            G  F    ++L   YK ++ ++ + Q+      + AW   +  E   AA     G  ++
Sbjct: 100 AGEVFEAWDKELNKIYKLIISELPESQKIKLRNEERAWLKRKDKEMDKAAEEMAMGRDEN 159

Query: 96  MIYANCLQ-----------GHAIERNEKLESY 116
                C                 ER  +L   
Sbjct: 160 GELVGCGTGCGHASRAMNIEMTKERTIELARM 191


>gi|323170549|gb|EFZ56199.1| hypothetical protein ECLT68_4613 [Escherichia coli LT-68]
          Length = 95

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 29/80 (36%), Gaps = 4/80 (5%)

Query: 41  ALVKEKLEATYKKVLE--KVEKHQRELFEKSQMAWEIYRGSECAFAASGA--EEGTAQSM 96
               + L   YK+++   +  K  ++  +KSQ+ W  YR             E+G+   +
Sbjct: 4   KSWDKMLNTEYKQLMSDSESSKEFKDSLKKSQLVWIKYRDLYTDTIKKYYNNEQGSYWGI 63

Query: 97  IYANCLQGHAIERNEKLESY 116
           +    +      +  +L   
Sbjct: 64  VGTENIMNITKNKAIELHKL 83


>gi|237811328|ref|YP_002895779.1| hypothetical protein GBP346_A1057 [Burkholderia pseudomallei
           MSHR346]
 gi|237506090|gb|ACQ98408.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
          Length = 239

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 59  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 118

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 119 TMYAMANADMRLQPVRERALALRG 142



 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 175 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 221

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 222 IGARVATLKRF 232


>gi|167718582|ref|ZP_02401818.1| hypothetical protein BpseD_06137 [Burkholderia pseudomallei DM98]
          Length = 195

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 14  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 73

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 74  TMYAMANADMRLQPVRERALALRG 97



 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 131 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 177

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 178 IGARVATLKRF 188


>gi|254438983|ref|ZP_05052477.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 307]
 gi|198254429|gb|EDY78743.1| conserved hypothetical protein, putative [Octadecabacter
           antarcticus 307]
          Length = 136

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 30/83 (36%), Gaps = 15/83 (18%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
           C  + +  + ++L A Y+ +               Q  W +YR + C +       GT  
Sbjct: 69  CISSEWQQLDDRLNAAYQDI---------------QRGWIVYRDTACDWEMVQWGGGTGG 113

Query: 95  SMIYANCLQGHAIERNEKLESYL 117
                 C+     ++   LE++L
Sbjct: 114 GPASVACMMRLTAQQTLFLENHL 136


>gi|330828395|ref|YP_004391347.1| hypothetical protein B565_0695 [Aeromonas veronii B565]
 gi|328803531|gb|AEB48730.1| hypothetical protein B565_0695 [Aeromonas veronii B565]
          Length = 198

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1  MCRKIIFALTI--IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV 58
          M + ++  L    +  +  + + +C +     +   C     A +  +L A Y K +  +
Sbjct: 1  MNKTLLATLLFAPLLASAATPSFDCTKASGSVETLICKDAGLAALDNELAALYPKAIAAL 60

Query: 59 EKHQRELFEKSQMAWEIYRGSEC 81
             Q +     Q  W   R  +C
Sbjct: 61 SPEQLKTERAMQRGWIKGRN-DC 82


>gi|83748392|ref|ZP_00945415.1| Hypothetical Protein RRSL_01787 [Ralstonia solanacearum UW551]
 gi|83724908|gb|EAP72063.1| Hypothetical Protein RRSL_01787 [Ralstonia solanacearum UW551]
          Length = 154

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 7/92 (7%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQR----ELFEKSQMAWEIYRGSECAFAASGAE 89
           QC   S  +    L AT ++V +++ +  R      FE++Q  W  +R + C F A    
Sbjct: 60  QCGRVSLEIADRTLRATIQRVAQRLRQGNRVATLADFERTQQQWATFRKNYCRFVAGLDP 119

Query: 90  EGTA---QSMIYANCLQGHAIERNEKLESYLT 118
           +G+A   Q +    C       RN +LE  + 
Sbjct: 120 DGSAGNWQVLTSDACEVRLIKARNAELEILID 151


>gi|217419704|ref|ZP_03451210.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|217397008|gb|EEC37024.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
          Length = 236

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 55  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 114

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 115 TMYAMANADMRLQPVRERALALRG 138



 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 172 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 218

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 219 IGARVATLKRF 229


>gi|260890291|ref|ZP_05901554.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
 gi|260859911|gb|EEX74411.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
          Length = 144

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 31/92 (33%), Gaps = 8/92 (8%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           A+M + +        ++L   YK ++ K+ K ++E     +  W   +      AA    
Sbjct: 45  AEMKEASSVILDGWNDELNKVYKLLMSKLSKKEQEKLRNEERTWIKRKERVAKEAADEFC 104

Query: 90  E--------GTAQSMIYANCLQGHAIERNEKL 113
                    GT   + Y   L      R  +L
Sbjct: 105 GTVNGQKLCGTGYGLEYTQSLINSTKNRAIEL 136


>gi|167844762|ref|ZP_02470270.1| hypothetical protein BpseB_05683 [Burkholderia pseudomallei B7210]
          Length = 205

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 24  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 83

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 84  TMYAMANADMRLQPVRERALALRG 107



 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 141 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 187

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 188 IGARVATLKRF 198


>gi|167737610|ref|ZP_02410384.1| hypothetical protein Bpse14_06065 [Burkholderia pseudomallei 14]
          Length = 204

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 23  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 82

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 83  TMYAMANADMRLQPVRERALALRG 106



 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 140 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 186

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 187 IGARVATLKRF 197


>gi|261379531|ref|ZP_05984104.1| conserved hypothetical protein [Neisseria subflava NJ9703]
 gi|284797998|gb|EFC53345.1| conserved hypothetical protein [Neisseria subflava NJ9703]
          Length = 340

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q++++            ++   +      ++   ++     Q AW   +   C  AA+ 
Sbjct: 254 SQSELDN-ARAQNRQADGEINDLW----GGLDSDVKQQILGEQRAWIQSKKLNCQQAAAS 308

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  Y
Sbjct: 309 ADNAAQAEYLRLQCETRMTRERTQYLRGY 337


>gi|238028336|ref|YP_002912567.1| hypothetical protein bglu_1g27970 [Burkholderia glumae BGR1]
 gi|237877530|gb|ACR29863.1| Hypothetical protein bglu_1g27970 [Burkholderia glumae BGR1]
          Length = 235

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 22/71 (30%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            L   Y K+ +++    R    ++Q AW  +R +                MI        
Sbjct: 171 DLNRYYVKLQKRMPSRSRPTLVRAQRAWVAFRDAT-------------TPMISEQQRVDL 217

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 218 IGARVATLKRF 228


>gi|170703071|ref|ZP_02893895.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
 gi|170132027|gb|EDT00531.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
          Length = 76

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46 KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 12 DLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDATA 47


>gi|204930727|ref|ZP_03221600.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320186|gb|EDZ05390.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|322616612|gb|EFY13521.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619873|gb|EFY16747.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622441|gb|EFY19286.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629441|gb|EFY26218.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632937|gb|EFY29680.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636818|gb|EFY33521.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641382|gb|EFY38021.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645147|gb|EFY41676.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652310|gb|EFY48666.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655662|gb|EFY51964.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660967|gb|EFY57197.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665447|gb|EFY61635.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667576|gb|EFY63737.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673630|gb|EFY69732.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322677556|gb|EFY73620.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679779|gb|EFY75818.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687252|gb|EFY83224.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323193056|gb|EFZ78278.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199447|gb|EFZ84540.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203635|gb|EFZ88657.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208824|gb|EFZ93762.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323214162|gb|EFZ98922.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217798|gb|EGA02513.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323218891|gb|EGA03402.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226639|gb|EGA10839.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229601|gb|EGA13724.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232826|gb|EGA16922.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240138|gb|EGA24182.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242875|gb|EGA26896.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246791|gb|EGA30761.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254309|gb|EGA38126.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255575|gb|EGA39334.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259409|gb|EGA43045.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267005|gb|EGA50490.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272109|gb|EGA55523.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 109

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 39/115 (33%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVNAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R + + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGVLQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|167585796|ref|ZP_02378184.1| hypothetical protein BuboB_10698 [Burkholderia ubonensis Bu]
          Length = 256

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 10/36 (27%), Positives = 15/36 (41%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H       +Q AW  YR +  
Sbjct: 192 DLNRYYQKLRRKMPAHSAATLVHAQRAWVAYRDATA 227



 Score = 34.1 bits (77), Expect = 6.7,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--G 91
           QC G +    +  ++A YK++L       +  +++SQ  W ++R  E     +  +   G
Sbjct: 52  QCMGEAQQQWQTVMDAAYKRLLNDAPADAKRGWQESQRRWLMWRKDEAHLLKAVYDTTRG 111

Query: 92  TAQSMIYA 99
           T  +M  A
Sbjct: 112 TMYTMASA 119


>gi|85373067|ref|YP_457129.1| hypothetical protein ELI_01200 [Erythrobacter litoralis HTCC2594]
 gi|84786150|gb|ABC62332.1| hypothetical protein ELI_01200 [Erythrobacter litoralis HTCC2594]
          Length = 495

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 29/75 (38%), Gaps = 11/75 (14%)

Query: 21  LNCNETLMQADMNQCTGNS--FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
            +C +  ++A++  C         +   L + Y+  +++    QRE     Q AW   R 
Sbjct: 277 FDCAKASIKAEVLICAEYQSGLRHMDRDLSSLYRHAVKRGATSQRE-----QRAWLRQRN 331

Query: 79  ----SECAFAASGAE 89
               +EC   A  A 
Sbjct: 332 RCDSAECVAQAYQAR 346


>gi|254507894|ref|ZP_05120023.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
 gi|219549130|gb|EED26126.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
          Length = 166

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 39/104 (37%), Gaps = 16/104 (15%)

Query: 13  AIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE-KHQRELFEKSQM 71
            +A    + NC+     A+   C     + +   +   Y++ L     +  ++   + Q 
Sbjct: 1   MLANAEPSYNCDNVSHVAEHAICGSQELSSLDRLIAKQYRQSLSDAALEKDKQTLRQVQR 60

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           AW   R  EC ++               +CL+  ++ER   L++
Sbjct: 61  AWVTQRN-ECEYS--------------FDCLKERSLERLATLKA 89


>gi|16764591|ref|NP_460206.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|62179757|ref|YP_216174.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167991974|ref|ZP_02573073.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168264251|ref|ZP_02686224.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197263188|ref|ZP_03163262.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|224584256|ref|YP_002638054.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|16419755|gb|AAL20165.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62127390|gb|AAX65093.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197241443|gb|EDY24063.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205329769|gb|EDZ16533.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205347215|gb|EDZ33846.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|224468783|gb|ACN46613.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261246448|emb|CBG24258.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993015|gb|ACY87900.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157777|emb|CBW17270.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912224|dbj|BAJ36198.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321223854|gb|EFX48917.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322714227|gb|EFZ05798.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323129506|gb|ADX16936.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332988127|gb|AEF07110.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 109

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/113 (14%), Positives = 36/113 (31%), Gaps = 15/113 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVNAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             R   + +Q +W   R  +C                   CL     ER ++L
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQL 98


>gi|83718664|ref|YP_441418.1| hypothetical protein BTH_I0862 [Burkholderia thailandensis E264]
 gi|167580186|ref|ZP_02373060.1| hypothetical protein BthaT_18685 [Burkholderia thailandensis TXDOH]
 gi|167618290|ref|ZP_02386921.1| hypothetical protein BthaB_18426 [Burkholderia thailandensis Bt4]
 gi|257139907|ref|ZP_05588169.1| hypothetical protein BthaA_12005 [Burkholderia thailandensis E264]
 gi|83652489|gb|ABC36552.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 238

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 36/84 (42%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++++      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 58  QCMDEARQQWQGEVDAAYQRLVKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 117

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       ER   L  
Sbjct: 118 TMYAMASADMRLQPVRERALALRG 141



 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++    R+    +Q  W  +  +                ++        
Sbjct: 174 DMNRYYEKLRARMPADSRQTLVAAQREWAAFSDA-------------MTPLVSEGERVDL 220

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 221 IGARVATLKRF 231


>gi|16760111|ref|NP_455728.1| secreted protein [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29142118|ref|NP_805460.1| hypothetical protein t1684 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413778|ref|YP_150853.1| hypothetical protein SPA1614 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|168239143|ref|ZP_02664201.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168244310|ref|ZP_02669242.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168467198|ref|ZP_02701040.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822343|ref|ZP_02834343.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194443121|ref|YP_002040492.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448181|ref|YP_002045238.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194737222|ref|YP_002114243.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197250138|ref|YP_002146805.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197362701|ref|YP_002142338.1| hypothetical protein SSPA1499 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198244395|ref|YP_002215899.1| hypothetical protein SeD_A2130 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389311|ref|ZP_03215922.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|213052786|ref|ZP_03345664.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213423672|ref|ZP_03356652.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213428088|ref|ZP_03360838.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213580466|ref|ZP_03362292.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213612637|ref|ZP_03370463.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648219|ref|ZP_03378272.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213850126|ref|ZP_03381024.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|238910945|ref|ZP_04654782.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289828346|ref|ZP_06546259.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25512455|pir||AE0647 probable secreted protein STY1276 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502405|emb|CAD08360.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137747|gb|AAO69309.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128035|gb|AAV77541.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194401784|gb|ACF62006.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406485|gb|ACF66704.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194712724|gb|ACF91945.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630448|gb|EDX49074.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197094178|emb|CAR59682.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197213841|gb|ACH51238.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197288099|gb|EDY27486.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938911|gb|ACH76244.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199601756|gb|EDZ00302.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205336800|gb|EDZ23564.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205341223|gb|EDZ27987.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320086323|emb|CBY96096.1| putative lipoprotein lprI Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|326623647|gb|EGE29992.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 109

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 38/115 (33%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVNAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|172061386|ref|YP_001809038.1| hypothetical protein BamMC406_2344 [Burkholderia ambifaria MC40-6]
 gi|171993903|gb|ACB64822.1| conserved hypothetical protein [Burkholderia ambifaria MC40-6]
          Length = 276

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 212 DLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDATA 247


>gi|126462627|ref|YP_001043741.1| hypothetical protein Rsph17029_1865 [Rhodobacter sphaeroides ATCC
          17029]
 gi|126104291|gb|ABN76969.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC
          17029]
          Length = 225

 Score = 44.9 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 18/58 (31%)

Query: 21 LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
           +C+      +   C+  + A +   +   Y           R+ F   Q AW   R 
Sbjct: 22 FDCSRAGTMVEHAICSDPALAALDRDVAQAYGAARAGQPPAVRDQFLAEQRAWLAARD 79


>gi|115352529|ref|YP_774368.1| hypothetical protein Bamb_2478 [Burkholderia ambifaria AMMD]
 gi|115282517|gb|ABI88034.1| conserved hypothetical protein [Burkholderia ambifaria AMMD]
          Length = 267

 Score = 44.9 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 203 DLNRYYQKLRRKMPAHSAATLVRAQRAWVTFRDATA 238


>gi|330817982|ref|YP_004361687.1| hypothetical protein bgla_1g31230 [Burkholderia gladioli BSR3]
 gi|327370375|gb|AEA61731.1| hypothetical protein bgla_1g31230 [Burkholderia gladioli BSR3]
          Length = 246

 Score = 44.9 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 21/71 (29%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            L   Y K+ +++    R +  ++Q AW  +R                  MI        
Sbjct: 182 DLNRYYVKLQKRMPARSRPMLVRAQRAWVSFRDGT-------------TPMISEEQRVDL 228

Query: 106 AIERNEKLESY 116
              R   L+  
Sbjct: 229 IGARVATLKRL 239


>gi|293605194|ref|ZP_06687582.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
 gi|292816379|gb|EFF75472.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
          Length = 211

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 8/69 (11%), Positives = 22/69 (31%)

Query: 11 IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQ 70
          +   A  + + NC +     + + C     +     +   YK +  +++    +     Q
Sbjct: 1  MAGSAAAAPSFNCAKAATPVEKSICANYKLSDQDAAIAQQYKALRGELDAEAVKSLAADQ 60

Query: 71 MAWEIYRGS 79
            +   R  
Sbjct: 61 RYYLSIRDK 69


>gi|238790289|ref|ZP_04634063.1| hypothetical protein yfred0001_31190 [Yersinia frederiksenii ATCC
          33641]
 gi|238721639|gb|EEQ13305.1| hypothetical protein yfred0001_31190 [Yersinia frederiksenii ATCC
          33641]
          Length = 329

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 30/74 (40%), Gaps = 3/74 (4%)

Query: 2  CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
          C + IF L ++ I+  + A+NC       +   C+      + +     Y+ +L K +  
Sbjct: 3  CFRGIFFLLMMIISSSAFAINCQRAATPVEYTVCSDEDLHWLDQTFSDIYQAMLVKYDTE 62

Query: 62 QRELFEKSQMAWEI 75
                + + AWE 
Sbjct: 63 T---VYQQRRAWEK 73


>gi|300311756|ref|YP_003775848.1| lipoprotein [Herbaspirillum seropedicae SmR1]
 gi|300074541|gb|ADJ63940.1| lipoprotein [Herbaspirillum seropedicae SmR1]
          Length = 265

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 31/80 (38%), Gaps = 6/80 (7%)

Query: 6  IFALTIIAI----AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
          +F  T ++     + ++ + +C +     +   C     + + ++L A +++        
Sbjct: 10 LFTFTALSALAWHSTRAASFDCAKAGSSNEKMICADAQLSALDDRLGALFRQARASAS-D 68

Query: 62 QRELFEKSQMAWEIYRGSEC 81
          +R L   +   W  +R   C
Sbjct: 69 KRALRADADQHWR-WREQHC 87


>gi|295675822|ref|YP_003604346.1| protein of unknown function DUF1311 [Burkholderia sp. CCGE1002]
 gi|295435665|gb|ADG14835.1| protein of unknown function DUF1311 [Burkholderia sp. CCGE1002]
          Length = 247

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMIYANCL 102
             ++  Y+++L KV   +R L+EKSQ +W   R +E    A+     +G+   +  A+  
Sbjct: 83  AAVDNAYQQLLAKVPPARRRLWEKSQSSWLASRDAEKQLLAAVFATTQGSMYVLSEADMQ 142

Query: 103 QGHAIERNEKLESYLTCPEGDLLCPFIN 130
                +R   L S L     D   P   
Sbjct: 143 LQPVRDRALVLRSALA----DASGPAPR 166



 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 8/31 (25%), Positives = 12/31 (38%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            L   Y+ +  K+    R     +Q AW  Y
Sbjct: 183 DLNRYYRVLESKMPAKSRPTLVHAQRAWNAY 213


>gi|168233118|ref|ZP_02658176.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194468898|ref|ZP_03074882.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455262|gb|EDX44101.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205332629|gb|EDZ19393.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 109

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 39/115 (33%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++ ++ + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVKAASFDCQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|186472541|ref|YP_001859883.1| hypothetical protein Bphy_3702 [Burkholderia phymatum STM815]
 gi|184194873|gb|ACC72837.1| conserved hypothetical protein [Burkholderia phymatum STM815]
          Length = 206

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 42/121 (34%), Gaps = 18/121 (14%)

Query: 1   MCRKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + R ++ AL ++A  +  + + NC      A+   C     +   ++L   ++  L++  
Sbjct: 3   LNRTMLAALGLLAMSSAHATSFNCAIAHSTAETLICHDAGLSKADDELGKLFRLALKQT- 61

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
             +R     S   W  +R   C   A               CL      R  ++  +L  
Sbjct: 62  ADRRAYRRDSDSKW-TWREENCKDVA---------------CLTDWYSTRIGEIREHLRK 105

Query: 120 P 120
           P
Sbjct: 106 P 106


>gi|254247506|ref|ZP_04940827.1| Hypothetical protein BCPG_02305 [Burkholderia cenocepacia PC184]
 gi|124872282|gb|EAY63998.1| Hypothetical protein BCPG_02305 [Burkholderia cenocepacia PC184]
          Length = 273

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 209 DLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDATA 244



 Score = 33.7 bits (76), Expect = 9.1,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 33/84 (39%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--G 91
           QC G +    +  ++  Y+++ +      +  ++ SQ  W  +R  E     +  +   G
Sbjct: 66  QCMGEAQQQWQAVMDGAYQRLSKDAPADAKRGWQDSQRRWVTWRKDEMLLLKAVYDTTRG 125

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           TA +M  A+       +R   L  
Sbjct: 126 TAYAMSSADLQLQPVRDRALALRG 149


>gi|323526659|ref|YP_004228812.1| hypothetical protein BC1001_2336 [Burkholderia sp. CCGE1001]
 gi|323383661|gb|ADX55752.1| hypothetical protein BC1001_2336 [Burkholderia sp. CCGE1001]
          Length = 195

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 44/118 (37%), Gaps = 18/118 (15%)

Query: 1   MCRKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + R ++ A  +IA  +  + + +C++    A+   C   + + + + L   Y K   KV 
Sbjct: 3   LVRPVLIAALLIAHSSAHAASFDCSKGRSLAEKIICHDPALSRLDDTLGQLYWKARRKVS 62

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
             +R     S   W  +R + C  AA               CL      R ++L   +
Sbjct: 63  -DRRGFITDSDNKW-AWRETHCRDAA---------------CLGTWYATRIDELRQLI 103


>gi|126640381|ref|YP_001083365.1| putative signal peptide [Acinetobacter baumannii ATCC 17978]
          Length = 97

 Score = 44.5 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 40/103 (38%), Gaps = 15/103 (14%)

Query: 16  FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
            Q+ + +CN    + +++ C   S      K+  TY+ VL  +    R+  + +Q  W  
Sbjct: 1   MQAASFSCNAAKTKTELSICKNRSLNDADVKMATTYQIVLHALPMGGRDNQKDTQQQWLK 60

Query: 76  YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            R +  A                 +C+     +R ++L++ L 
Sbjct: 61  KRNACAA---------------NVSCISKAYQQRQKQLDTILQ 88


>gi|254196281|ref|ZP_04902705.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|169653024|gb|EDS85717.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
          Length = 240

 Score = 44.5 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 35/84 (41%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 59  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 118

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T   M  A+       ER   L  
Sbjct: 119 TMYVMANADMRLQPVRERALALRG 142



 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 176 DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 222

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 223 IGARVATLKRF 233


>gi|189499720|ref|YP_001959190.1| hypothetical protein Cphamn1_0757 [Chlorobium phaeobacteroides
          BS1]
 gi|189495161|gb|ACE03709.1| conserved hypothetical protein [Chlorobium phaeobacteroides BS1]
          Length = 208

 Score = 44.5 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 35/84 (41%), Gaps = 3/84 (3%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVEKHQ 62
          ++F +    +   S + +C++    A+   C  +  A +  ++   +      + +   +
Sbjct: 9  LVFMMFSATVQATSPSFDCSKAQSSAEKLVCEDDELASLDLEVARLFDLARDGKYMTPER 68

Query: 63 RELFEKSQMAWEIYRGSECAFAAS 86
          R+L   +Q  W   R  +C  A+S
Sbjct: 69 RKLLIATQRGWVKGRD-DCWKASS 91


>gi|257125531|ref|YP_003163645.1| hypothetical protein Lebu_0746 [Leptotrichia buccalis C-1013-b]
 gi|257049470|gb|ACV38654.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 139

 Score = 44.5 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 32/83 (38%), Gaps = 4/83 (4%)

Query: 37  GNSFALV---KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
             S+ L    +++L   Y  +L+K+   ++  F+  Q  W   R +    A +  E+G  
Sbjct: 50  NASYKLTGEWEKELNKVYDLILKKLPAKEKSKFKAEQEKWIKSRKAAIKKALADEEDGPR 109

Query: 94  QSMI-YANCLQGHAIERNEKLES 115
            ++   A         R  +L  
Sbjct: 110 MALFGAAGTEYEMTKARVLELAK 132


>gi|332097003|gb|EGJ01987.1| hypothetical protein SD15574_0831 [Shigella dysenteriae 155-74]
          Length = 103

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/85 (15%), Positives = 30/85 (35%), Gaps = 8/85 (9%)

Query: 40  FALV----KEKLEATYKKVLE--KVEKHQRELFEKSQMAWEIYRGSECAFAASGA--EEG 91
           + +      + L   YK+++   +  K  ++  +KSQ+ W  YR             E G
Sbjct: 7   YQVAIKSWDKMLNTEYKQLMSDSESSKEFKDSLKKSQLVWIKYRDLYTDTIKKYYNNEHG 66

Query: 92  TAQSMIYANCLQGHAIERNEKLESY 116
           +   ++    +      +  +L   
Sbjct: 67  SYWGIVGTENIMNITKNKAIELHKL 91


>gi|149925321|ref|ZP_01913585.1| putative periplasmic protein [Limnobacter sp. MED105]
 gi|149825438|gb|EDM84646.1| putative periplasmic protein [Limnobacter sp. MED105]
          Length = 130

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 41/132 (31%), Gaps = 17/132 (12%)

Query: 2   CRKIIFALTIIAI-AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
             K++F L  +   +  S A          +   CT         ++E T  ++ ++   
Sbjct: 1   MNKLMFKLVFLGFFSVPSWAF----ASSTVEEEFCT--QLKSANAEMEGTLLQIKQRKRD 54

Query: 61  HQR--ELFEKSQMAWEIYRGSECAFAASGAE---EGTAQSMIYANCLQGH--AIERNEKL 113
                     SQ  W  Y  +E             G+   M    C+       ER   L
Sbjct: 55  DSVFLTALNNSQKQWVQYVDAESLMQFPSQRFIDYGSVLPM--CQCITRLGLTQERITTL 112

Query: 114 ESYLT-CPEGDL 124
           + +L    EGD+
Sbjct: 113 KQWLEPVVEGDV 124


>gi|296159509|ref|ZP_06842333.1| conserved hypothetical protein [Burkholderia sp. Ch1-1]
 gi|295890217|gb|EFG70011.1| conserved hypothetical protein [Burkholderia sp. Ch1-1]
          Length = 284

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 34/94 (36%), Gaps = 5/94 (5%)

Query: 1  MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK-VE 59
          M    I A   +A    + + +C     + +   C     + + E L   Y+  +   + 
Sbjct: 1  MRHAYIMAALALATTAHAASFDCARAGSRVEATVCADGRLSRLDEVLAQDYQYTMASDIG 60

Query: 60 KHQRELFEKSQMAWEIYR----GSECAFAASGAE 89
             R+  + +Q AW + R     +EC   A  A 
Sbjct: 61 DGARKDLKATQRAWVLSRNSCTDAECIRTAYAAR 94


>gi|291613362|ref|YP_003523519.1| hypothetical protein Slit_0894 [Sideroxydans lithotrophicus ES-1]
 gi|291583474|gb|ADE11132.1| Uncharacterized protein putative lipoprotein-like protein
          [Sideroxydans lithotrophicus ES-1]
          Length = 589

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 38/87 (43%), Gaps = 9/87 (10%)

Query: 2  CRKIIFALT--IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           R+I++     ++ +  Q+ + +C ++  + +   C+ +  + + + L+  Y+K LE  +
Sbjct: 1  MRRIVWVALGWLLMLTAQAASFDCRQSSSKVEKLICSDHDLSKLDDALKMAYQKALE--Q 58

Query: 60 KHQRELFEKSQMAWEIY-----RGSEC 81
             ++     Q  W        + + C
Sbjct: 59 SDSKQKVIDEQRQWLKKVRNACQDTSC 85


>gi|170733772|ref|YP_001765719.1| hypothetical protein Bcenmc03_2436 [Burkholderia cenocepacia MC0-3]
 gi|169817014|gb|ACA91597.1| conserved hypothetical protein [Burkholderia cenocepacia MC0-3]
          Length = 271

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 207 DLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDATA 242



 Score = 33.7 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 33/84 (39%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--G 91
           QC G +    +  ++  Y+++ +      +  ++ SQ  W  +R  E     +  +   G
Sbjct: 64  QCMGEAQQQWQAVMDGAYQRLSKDAPADAKRGWQDSQRRWLTWRKDEVLLLKAVYDTTRG 123

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           TA +M  A+       +R   L  
Sbjct: 124 TAYAMSSADLQLQPVRDRALALRG 147


>gi|161615300|ref|YP_001589265.1| hypothetical protein SPAB_03069 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168261062|ref|ZP_02683035.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|161364664|gb|ABX68432.1| hypothetical protein SPAB_03069 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205349984|gb|EDZ36615.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 275

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|115522091|ref|YP_779002.1| hypothetical protein RPE_0061 [Rhodopseudomonas palustris BisA53]
 gi|115516038|gb|ABJ04022.1| protein of unknown function DUF1311 [Rhodopseudomonas palustris
           BisA53]
          Length = 153

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 32/86 (37%), Gaps = 3/86 (3%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVE--KHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
            C           LEA Y   +  ++    Q E   +SQ +W  ++ + C F A      
Sbjct: 67  ACLKRLIRREAASLEAAYSATMSSLQSMPSQTERLRQSQRSWLQFQTANCEF-AKAISGN 125

Query: 92  TAQSMIYANCLQGHAIERNEKLESYL 117
                 Y +C+    I+R  +L S +
Sbjct: 126 ENADESYHDCVLRSTIDRRVELRSLV 151


>gi|107023369|ref|YP_621696.1| hypothetical protein Bcen_1820 [Burkholderia cenocepacia AU 1054]
 gi|116690451|ref|YP_836074.1| hypothetical protein Bcen2424_2431 [Burkholderia cenocepacia
           HI2424]
 gi|105893558|gb|ABF76723.1| conserved hypothetical protein [Burkholderia cenocepacia AU 1054]
 gi|116648540|gb|ABK09181.1| conserved hypothetical protein [Burkholderia cenocepacia HI2424]
          Length = 271

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 207 DLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDATA 242



 Score = 33.7 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 33/84 (39%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--G 91
           QC G +    +  ++  Y+++ +      +  ++ SQ  W  +R  E     +  +   G
Sbjct: 64  QCMGEAQQQWQAVMDGAYQRLSKDAPADAKRGWQDSQRRWLTWRKDEVLLLKAVYDTTRG 123

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           TA +M  A+       +R   L  
Sbjct: 124 TAYAMSSADLQLQPVRDRALALRG 147


>gi|332094619|gb|EGI99665.1| hypothetical protein SB521682_0468 [Shigella boydii 5216-82]
          Length = 95

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 28/80 (35%), Gaps = 4/80 (5%)

Query: 41  ALVKEKLEATYKKVLE--KVEKHQRELFEKSQMAWEIYRGSECAFAASGA--EEGTAQSM 96
               + L   YK+++   +  K  ++  +KSQ+ W  YR             E G+   +
Sbjct: 4   KSWDKMLNTEYKQLMSDSESSKEFKDSLKKSQLVWIKYRDLYTDTIKKYYNNEHGSYWGI 63

Query: 97  IYANCLQGHAIERNEKLESY 116
           +    +      +  +L   
Sbjct: 64  VGTENIMNITKNKAIELHKL 83


>gi|134296613|ref|YP_001120348.1| hypothetical protein Bcep1808_2515 [Burkholderia vietnamiensis G4]
 gi|134139770|gb|ABO55513.1| conserved hypothetical protein [Burkholderia vietnamiensis G4]
          Length = 263

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 199 DLNRYYQKLRRKMPAHSAATLVRAQRAWVAFRDATA 234


>gi|330815832|ref|YP_004359537.1| hypothetical protein bgla_1g08940 [Burkholderia gladioli BSR3]
 gi|327368225|gb|AEA59581.1| hypothetical protein bgla_1g08940 [Burkholderia gladioli BSR3]
          Length = 141

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           I     + A   Q++  +C+    Q  MN C      + + +L+    + + +    ++ 
Sbjct: 26  IAARSGLPASQVQALLQDCDSN--QTSMNFCAWRDQIVAERELQQVVDQRISE-HPDRKS 82

Query: 65  LFEKSQMAWEIYRGSECAFAASGA-EEGTA 93
             E     W+  R + C  +A     +G+ 
Sbjct: 83  ALESKIAKWKKARDASCDKSARKEWSDGSM 112


>gi|224582335|ref|YP_002636133.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224466862|gb|ACN44692.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 275

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|254251698|ref|ZP_04945016.1| hypothetical protein BDAG_00893 [Burkholderia dolosa AUO158]
 gi|124894307|gb|EAY68187.1| hypothetical protein BDAG_00893 [Burkholderia dolosa AUO158]
          Length = 146

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 82  DLNRYYQKLRRKMPAHSMSTLVRAQRAWVAFRDATA 117


>gi|194444338|ref|YP_002039742.1| hypothetical protein SNSL254_A0551 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|205351804|ref|YP_002225605.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207855976|ref|YP_002242627.1| hypothetical protein SEN0478 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|194403001|gb|ACF63223.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|205271585|emb|CAR36406.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206707779|emb|CAR32064.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326626841|gb|EGE33184.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 275

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|200390101|ref|ZP_03216712.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199602546|gb|EDZ01092.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 275

 Score = 44.5 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|120608749|ref|YP_968427.1| hypothetical protein Aave_0036 [Acidovorax citrulli AAC00-1]
 gi|120587213|gb|ABM30653.1| hypothetical protein Aave_0036 [Acidovorax citrulli AAC00-1]
          Length = 147

 Score = 44.5 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 41/125 (32%), Gaps = 15/125 (12%)

Query: 5   IIFALTIIAIAFQSMAL----NCNETLMQADMNQCTGNSFALVKEKL----EATYKKVLE 56
           ++FA  I   +  +              QA M  C     A  ++ L          + +
Sbjct: 14  LLFASFIATASAHATEERALREACSAFSQAGMRDCLSKKAADSQDDLRQARNDATSALSK 73

Query: 57  KVEKHQ-----RELFEKSQMAWEIYRGSECAFAASGAEEGTAQS--MIYANCLQGHAIER 109
             E  Q     +     S   +E YR + C F AS +  G   S  ++ + C+      R
Sbjct: 74  WDEDAQYTGRAKAELTASDKVFEKYRDAHCKFRASLSGGGAGNSREILRSACIAELNGIR 133

Query: 110 NEKLE 114
             +L 
Sbjct: 134 ARQLR 138


>gi|168465597|ref|ZP_02699479.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195631784|gb|EDX50304.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 275

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|298369589|ref|ZP_06980906.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282146|gb|EFI23634.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 339

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 26/81 (32%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                     ++   +      ++K  ++     Q +W   +   CA AA+ A+      
Sbjct: 260 AREQNRKADSEINRIW----GGMDKTIQQGMLAEQRSWIQSKKQNCAQAAAEADNPAQAE 315

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 316 YLRLQCDTRMTRERVQYLRGY 336


>gi|319638867|ref|ZP_07993625.1| lipoprotein [Neisseria mucosa C102]
 gi|317399771|gb|EFV80434.1| lipoprotein [Neisseria mucosa C102]
          Length = 340

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q++++            ++   +      ++   ++     Q AW   +   C  AA+ 
Sbjct: 254 SQSELDN-ARAQNRQADGEINDLW----GGMDSDVKQQILGEQRAWIQSKKLNCQQAAAS 308

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  Y
Sbjct: 309 ADNAAQAEYLRLQCETRMTRERTQYLRGY 337


>gi|241759046|ref|ZP_04757158.1| lipoprotein [Neisseria flavescens SK114]
 gi|241320867|gb|EER57100.1| lipoprotein [Neisseria flavescens SK114]
          Length = 340

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q++++            ++   +      ++   ++     Q AW   +   C  AA+ 
Sbjct: 254 SQSELDN-ARAQNRQADGEINDLW----GGMDSDVKQQILGEQRAWIQSKKLNCQQAAAS 308

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  Y
Sbjct: 309 ADNAAQAEYLRLQCETRMTRERTQYLRGY 337


>gi|171912775|ref|ZP_02928245.1| hypothetical protein VspiD_16385 [Verrucomicrobium spinosum DSM
           4136]
          Length = 255

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 28/83 (33%), Gaps = 1/83 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
               F    + L A +     ++ + + +     Q  W +YR  +   AA     G  +S
Sbjct: 44  AKGRFDKADQDLNAAWVTAKAQLGEERMKHVSTVQRQWVVYRDIQAD-AAQEKAGGKTRS 102

Query: 96  MIYANCLQGHAIERNEKLESYLT 118
             +       + +R   L+  + 
Sbjct: 103 SAWYEKAAFLSSDRAAWLQRVIK 125


>gi|197250398|ref|YP_002145481.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197214101|gb|ACH51498.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 275

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|198244471|ref|YP_002214453.1| hypothetical protein SeD_A0546 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197938987|gb|ACH76320.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326622200|gb|EGE28545.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 275

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|168818882|ref|ZP_02830882.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205344268|gb|EDZ31032.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320084773|emb|CBY94563.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 275

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|56698171|ref|YP_168543.1| hypothetical protein SPO3347 [Ruegeria pomeroyi DSS-3]
 gi|56679908|gb|AAV96574.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 128

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 38/121 (31%), Gaps = 10/121 (8%)

Query: 8   ALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR-- 63
               +A    +   AL C++   Q +   C     A V+  L    +       +     
Sbjct: 8   VALALAPVLTAADPALECSDAASQVETGACVSEMSARVEGALAIALEIARGSAAELDEVT 67

Query: 64  ------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
                    + +Q AW  YR + C    +G   G+   +   +C       R ++L +  
Sbjct: 68  GRKMALPALDSAQSAWTAYRAAHCEAVGAGFGGGSGTGIAITSCQIELGRARIDELMAMA 127

Query: 118 T 118
            
Sbjct: 128 Q 128


>gi|167622285|ref|YP_001672579.1| hypothetical protein Shal_0344 [Shewanella halifaxensis HAW-EB4]
 gi|167352307|gb|ABZ74920.1| conserved hypothetical protein [Shewanella halifaxensis HAW-EB4]
          Length = 216

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/143 (11%), Positives = 36/143 (25%), Gaps = 44/143 (30%)

Query: 1   MCRKIIFALTIIAIAFQ-------------------------SMALNCNETLMQADMNQC 35
           M + I+    ++  A                           +   +C +   Q +   C
Sbjct: 1   MQKTILLGCLVLLAACSSTVATQIKPTQADSELVVPVSDMHVAPTFDCAKAQGQVETLIC 60

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG--------SECAFAAS- 86
                A +   +E  YK  +  +   ++   + +Q  W   R          EC      
Sbjct: 61  HDAELAQLDRLMEQIYKAAVVNIPASEQP--KATQRGWIKGRNDCWKAQDVRECTLQNYK 118

Query: 87  ------GAEEG--TAQSMIYANC 101
                   + G       +  +C
Sbjct: 119 GRIIELQIQGGLLEVPPAVVFDC 141


>gi|238563611|ref|ZP_00438592.2| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|238520354|gb|EEP83815.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
          Length = 143

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + +++A Y+++L+      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 61  QCMDEARQQWQGEVDAAYQRLLKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 120

Query: 92  TAQSMIYANCLQGHAIERNEKLE 114
           T  +M  A+       ER   L 
Sbjct: 121 TMYAMANADMRLQPVRERALALR 143


>gi|126728412|ref|ZP_01744228.1| hypothetical protein SSE37_20517 [Sagittula stellata E-37]
 gi|126711377|gb|EBA10427.1| hypothetical protein SSE37_20517 [Sagittula stellata E-37]
          Length = 211

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 38/111 (34%), Gaps = 15/111 (13%)

Query: 7   FALTIIAIAFQS-MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVEKHQR 63
            A+T   +A  +  A +C +     +   C  +  A +  ++   Y   +    + + + 
Sbjct: 13  LAMTAPGMAPAADPAFDCGKASGTVEEMICANDGLAELDREMARLYGLAVNDPDLGQERL 72

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           +  +  Q  W   R  +C + A   E           C+  +   R  +L 
Sbjct: 73  DRLKAMQRGWIKGRN-DC-WKADSVEG----------CVAENYAMRMHELR 111


>gi|167550973|ref|ZP_02344729.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205324283|gb|EDZ12122.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 275

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|78067231|ref|YP_370000.1| hypothetical protein Bcep18194_A5762 [Burkholderia sp. 383]
 gi|77967976|gb|ABB09356.1| hypothetical protein Bcep18194_A5762 [Burkholderia sp. 383]
          Length = 279

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 215 DLNRYYQKLRRKMPAHSAATLVRAQRAWVGFRDATA 250



 Score = 34.1 bits (77), Expect = 5.9,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 35/84 (41%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--G 91
           QC G +    +  ++  Y+++L+      +  ++ SQ  W  +R  E     +  +   G
Sbjct: 64  QCMGEAQQQWQAVMDGAYQRLLKDAPADAKRGWQDSQRHWLTWRKDEVHLLKAVYDTTRG 123

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T+ +M  A+       +R   L S
Sbjct: 124 TSYAMSSADLQLQPVRDRALALRS 147


>gi|206560979|ref|YP_002231744.1| hypothetical protein BCAL2640 [Burkholderia cenocepacia J2315]
 gi|198037021|emb|CAR52942.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 273

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 209 DLNRYYQKLRRKMPAHSAGTLVRAQRAWVAFRDATA 244



 Score = 34.5 bits (78), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEE--G 91
           QC G +    +  ++  Y+++L+      +  ++ SQ  W  +R  E     +  +   G
Sbjct: 64  QCMGEAQQQWQTVMDGAYQRLLKDAPADAKRGWQDSQRRWLTWRKDEVLLLKAVYDTTRG 123

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           TA +M  A+       +R   L  
Sbjct: 124 TAYAMSSADLQLQPVRDRALALRG 147


>gi|332533636|ref|ZP_08409496.1| hypothetical protein PH505_as00280 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036917|gb|EGI73377.1| hypothetical protein PH505_as00280 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 150

 Score = 43.7 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 45/125 (36%), Gaps = 10/125 (8%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNE-----TLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
            +KII        +F + A + +       +   ++    GN +     K+     ++  
Sbjct: 1   MKKIIIVFAFAISSFGAFAQSADGWPEGGAMHTGNIYNLEGNRYKT---KISKMMDEIYP 57

Query: 57  KVEKHQRELFEKSQ-MAWEIYRGSECAFAASGAEEGTAQSMIYA-NCLQGHAIERNEKLE 114
           ++    +    K+Q  AWE Y  + C         G +    Y+  C +  + +R    +
Sbjct: 58  QLTDDYQVDAVKAQIKAWEQYIDATCNVVGIATGAGGSWPSTYSVKCERSLSYDRYFATK 117

Query: 115 SYLTC 119
           + L C
Sbjct: 118 NALKC 122


>gi|94312934|ref|YP_586143.1| hypothetical protein Rmet_4006 [Cupriavidus metallidurans CH34]
 gi|93356786|gb|ABF10874.1| conserved hypothetical protein; putative lipoprotein [Cupriavidus
          metallidurans CH34]
          Length = 211

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 29/81 (35%), Gaps = 7/81 (8%)

Query: 7  FALTIIAIAFQSMA----LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE--KVEK 60
           AL ++     +MA     +C     Q +   C  ++ A +  +    Y   L+   +  
Sbjct: 10 VALAMLGTTSVAMAASPSFDCGNAKGQVEQLICKDDTLARLDRETTRLYGMALDARSLPA 69

Query: 61 HQRELFEKSQMAWEIYRGSEC 81
           Q++     Q  W   R  +C
Sbjct: 70 PQKKTLLAEQRGWIKGRN-DC 89


>gi|322835272|ref|YP_004215298.1| secreted protein [Rahnella sp. Y9602]
 gi|321170473|gb|ADW76171.1| putative secreted protein [Rahnella sp. Y9602]
          Length = 269

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 29/78 (37%), Gaps = 6/78 (7%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQSM 96
           N++A     L   +K     +    +   +KSQ AW   +  +C   + +  E    Q+ 
Sbjct: 191 NNYARSDRNLNDIWKS----LPDSIKTSMKKSQQAWVNEKALKCGKLSDADMEITPIQNR 246

Query: 97  I-YANCLQGHAIERNEKL 113
           I   +C      ER   L
Sbjct: 247 INIYDCQTKMTNERIAFL 264


>gi|254499014|ref|ZP_05111713.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254351764|gb|EET10600.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 310

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 34/87 (39%), Gaps = 9/87 (10%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQREL----FEKSQMAWEIYRGSECAFAASGAEEGTAQ 94
            +  +  KL   Y K+ +K+      +     +K++ AW  YR +   F      E +A 
Sbjct: 229 QYQKIDNKLNVIYNKIQKKLFAKSLTVTINGIQKTERAWIKYRNAWVDFGYMKCPEISA- 287

Query: 95  SMIYANCLQGHAIERNEKLESYLTCPE 121
             I  N L     ER  +LE+     +
Sbjct: 288 --ISWNAL--ITKERVIQLEALANLED 310


>gi|167835838|ref|ZP_02462721.1| hypothetical protein Bpse38_05065 [Burkholderia thailandensis
           MSMB43]
          Length = 202

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 35/84 (41%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    + + +A Y+++++      R  +++SQ  W  +R  E     +  E  +G
Sbjct: 22  QCMDEARQQWQGEADAAYQRLVKTAPADARRGWQESQRRWLAWRKDEAHLVRAVYETTQG 81

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       +R   L  
Sbjct: 82  TMYAMASADMRLQPVRDRALALRG 105



 Score = 37.6 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 5/34 (14%), Positives = 13/34 (38%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
            +   Y+K+  ++          +Q  W  +R +
Sbjct: 138 DMNRYYEKLRARMPVDSLPTLVAAQREWAAFRDA 171


>gi|78049966|ref|YP_366141.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78038396|emb|CAJ26141.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 146

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 32/83 (38%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
            C      L   +L   YK +L  ++   R    ++Q AW   R  +    A+   +  A
Sbjct: 59  ACVSQEETLQDRRLNKAYKLLLSSLKADVRTKLVEAQRAWLQSRTKDGNLEAAIYGDSQA 118

Query: 94  QSMIYANCLQGHAIERNEKLESY 116
           +++  A         R ++LE Y
Sbjct: 119 ENIESAEAAMLRLTARADQLEKY 141


>gi|209519966|ref|ZP_03268746.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209499617|gb|EDZ99692.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 191

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 43/118 (36%), Gaps = 18/118 (15%)

Query: 1   MCRKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + R ++ A  ++A     + + +C       +   C  ++ + + + L   Y K   +V 
Sbjct: 3   LFRPLLIAGLLLAHPYANATSFDCQRGHSPTERMICGDSALSTLDDTLGQLYWKARRRVS 62

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
             +R   + S   W  +R + C                 A CL+     R ++L+  L
Sbjct: 63  -QRRAFIDDSDSKW-AWREANCR---------------DATCLRTWYETRIDELQRLL 103


>gi|92118328|ref|YP_578057.1| twin-arginine translocation pathway signal [Nitrobacter
           hamburgensis X14]
 gi|91801222|gb|ABE63597.1| Twin-arginine translocation pathway signal [Nitrobacter
           hamburgensis X14]
          Length = 434

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 39/126 (30%), Gaps = 13/126 (10%)

Query: 3   RKIIFALTIIAIAFQSM--------ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
           + ++    ++     S         + +C +     +   C+          L  +Y+  
Sbjct: 13  KAVLLCCVVLLGGLASADPASAVEASFDCKKAASAIEKFICSQAVLRWQDLALSRSYRAA 72

Query: 55  LEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY----ANCLQGHAIERN 110
              V    R+    SQ  W   R   C    S  ++ +A S        +CL    ++R 
Sbjct: 73  SNAVVGAARDDLLVSQRDWVRERDRRCIADRS-FKDLSAPSTTLRTQAYDCLNSVYLDRR 131

Query: 111 EKLESY 116
             L+  
Sbjct: 132 RALQDL 137


>gi|238752831|ref|ZP_04614297.1| hypothetical protein yrohd0001_16060 [Yersinia rohdei ATCC 43380]
 gi|238708927|gb|EEQ01179.1| hypothetical protein yrohd0001_16060 [Yersinia rohdei ATCC 43380]
          Length = 294

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 14/93 (15%), Positives = 30/93 (32%), Gaps = 12/93 (12%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
             +L Q+ M      +FA     L   +      +   +R+    SQ  W   + + C  
Sbjct: 214 AGSLDQSRM------AFANADSDLNTAW----STLTPVKRKELLPSQRQWIKTKDAMCGK 263

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
            +    +   + M+  +C     + R     + 
Sbjct: 264 VSMQGTDSEVKKMV--DCQTQMTLARTAFFRNQ 294


>gi|167569206|ref|ZP_02362080.1| hypothetical protein BoklC_05135 [Burkholderia oklahomensis C6786]
          Length = 236

 Score = 43.7 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +      +++A Y+++ +      R  +++SQ  W  +R  E     +  +  +G
Sbjct: 56  QCMDEARQQWLAEVDAAYQRLQKAAPADARRGWQESQRRWLAWRKDEAHLVRAVYDTTQG 115

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       +R   L  
Sbjct: 116 TMYAMASADMRLQPVRDRARALRG 139



 Score = 35.3 bits (80), Expect = 3.1,   Method: Composition-based stats.
 Identities = 8/71 (11%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y K+  ++         ++Q  W  +R +                +I  +     
Sbjct: 172 DMNRYYAKLQSRMPAASLPTLAQAQREWAAFRDA-------------MTPLISEDERVDL 218

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 219 IGARVATLKRF 229


>gi|197285790|ref|YP_002151662.1| upregulator of flagellar master operon [Proteus mirabilis HI4320]
 gi|194683277|emb|CAR43984.1| upregulator of flagellar master operon [Proteus mirabilis HI4320]
          Length = 137

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 41/122 (33%), Gaps = 17/122 (13%)

Query: 9   LTIIAIAFQSMAL-------NCNETLM---QADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           LT+  I+F S A         C E      Q  +  C  +   L +E+L   Y K    +
Sbjct: 13  LTMSLISFSSFAQVNHDPLTKCYELSTDASQTTIKACLLDELRLSEEQLNVIYNKSKGDL 72

Query: 59  EKHQR-------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           E           +    SQ  + ++R SEC   ++    G     +   C       R +
Sbjct: 73  EDSDSIAAKSAIDALVSSQEQFILFRSSECQRQSALMMGGNGADEVLLACEIKLNQWRAK 132

Query: 112 KL 113
            L
Sbjct: 133 LL 134


>gi|322614774|gb|EFY11703.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618881|gb|EFY15769.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322623588|gb|EFY20427.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629113|gb|EFY25892.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631834|gb|EFY28588.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637429|gb|EFY34131.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322645862|gb|EFY42383.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652324|gb|EFY48679.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653227|gb|EFY49560.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660624|gb|EFY56860.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664776|gb|EFY60969.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669171|gb|EFY65321.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670717|gb|EFY66850.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322679045|gb|EFY75100.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322685098|gb|EFY81095.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323193009|gb|EFZ78232.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196909|gb|EFZ82051.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203894|gb|EFZ88911.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207021|gb|EFZ91974.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323214224|gb|EFZ98982.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214453|gb|EFZ99204.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219205|gb|EGA03702.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323230224|gb|EGA14344.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233962|gb|EGA18051.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238344|gb|EGA22402.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244031|gb|EGA28040.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323257814|gb|EGA41493.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261171|gb|EGA44763.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264898|gb|EGA48397.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272462|gb|EGA55869.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 311

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 25/82 (30%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEALPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYTCQLEMTIARTAYLDG 273


>gi|227326754|ref|ZP_03830778.1| hypothetical protein PcarcW_05304 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 141

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 33/86 (38%), Gaps = 5/86 (5%)

Query: 34  QCTGNSFALVKEKLEATYKK----VLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           +C         +KL     +    +++  +    + F+K Q +WE Y+   C +  SG E
Sbjct: 50  ECAYLMVKESDKKLNKRLSERTLELVKINDNDIIKAFKKHQRSWERYKKDRCTYVTSGTE 109

Query: 90  EGT-AQSMIYANCLQGHAIERNEKLE 114
           + + A       C       R E LE
Sbjct: 110 KDSAAYQFHLNLCNATENYRRIETLE 135


>gi|56707875|ref|YP_169771.1| hypothetical protein FTT_0761c [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89256654|ref|YP_514016.1| hypothetical protein FTL_1353 [Francisella tularensis subsp.
           holarctica LVS]
 gi|110670346|ref|YP_666903.1| hypothetical protein FTF0761c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134301717|ref|YP_001121685.1| hypothetical protein FTW_0672 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156502797|ref|YP_001428862.1| hypothetical protein FTA_1431 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187931535|ref|YP_001891519.1| hypothetical protein FTM_0776 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456954|ref|ZP_03665427.1| hypothetical protein FtultM_04221 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254874690|ref|ZP_05247400.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|290953407|ref|ZP_06558028.1| hypothetical protein FtulhU_03393 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313368|ref|ZP_06803977.1| hypothetical protein FtulhU_03383 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|56604367|emb|CAG45394.1| hypothetical protein [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|89144485|emb|CAJ79792.1| hypothetical protein FTL_1353 [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320679|emb|CAL08777.1| hypothetical protein FTF0761c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134049494|gb|ABO46565.1| hypothetical protein FTW_0672 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156253400|gb|ABU61906.1| hypothetical protein FTA_1431 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187712444|gb|ACD30741.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840689|gb|EET19125.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 97

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 46/115 (40%), Gaps = 18/115 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + II  LTI+     +  + C+      ++N C  +   +   KL           + 
Sbjct: 1   MKKLIIMTLTILPTLVAADKV-CDGNT--YEINACLKSQMQIYDTKLNDV--------QN 49

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           H  + F+K       YR + C   +S  + GT Q++ Y NC+        ++L+ 
Sbjct: 50  HDIKNFKK-------YRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLKP 97


>gi|323246619|gb|EGA30593.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
          Length = 312

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 25/82 (30%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 197 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEALPAE 252

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 253 KRISIYTCQLEMTIARTAYLDG 274


>gi|167628099|ref|YP_001678599.1| hypothetical protein Fphi_1872 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167598100|gb|ABZ88098.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 96

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 44/115 (38%), Gaps = 21/115 (18%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R I+     + I   + +  C+      ++NQC         +KL++           
Sbjct: 1   MLRIIL--SLFLPILVFANSPICDGNT--YEINQCLKTQMQTYDKKLDS----------- 45

Query: 61  HQRELFEKSQ-MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
                 + S    ++ YR + C+  +S    GT +S+ Y NC+        ++LE
Sbjct: 46  -----LKDSNIKDFKKYRDNICSKISSTYSGGTYESIKYGNCIISLDRWYLKELE 95


>gi|296108067|ref|YP_003619768.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
 gi|295649969|gb|ADG25816.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
          Length = 347

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 37/85 (43%), Gaps = 16/85 (18%)

Query: 11  IIAIAFQSMALNCNETLMQ------ADMNQC-----TGNSFALVKEKLEATYKKVLEKVE 59
           +   A  + A+N    L Q        +N+C     T   +  + ++L + YKK++    
Sbjct: 226 LSGTARSAFAINAQLNLNQRLFELLQKVNRCETPLMTIKQYEEMDKQLNSIYKKLMADTS 285

Query: 60  KHQ-----RELFEKSQMAWEIYRGS 79
             Q     +E  +K+++AW  YR +
Sbjct: 286 SFQYTTVTKEGIKKTEIAWIKYRDA 310


>gi|262274700|ref|ZP_06052511.1| hypothetical protein VHA_001682 [Grimontia hollisae CIP 101886]
 gi|262221263|gb|EEY72577.1| hypothetical protein VHA_001682 [Grimontia hollisae CIP 101886]
          Length = 139

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 50/132 (37%), Gaps = 15/132 (11%)

Query: 1   MCRK----IIFALTIIAIAF--QSMALNCNET-LMQADMNQCTGNSFALVKEKLEATYKK 53
           MC+     I+  L + A A    S  + C +      ++  C  N + + ++ L  T   
Sbjct: 1   MCKSWWGCILLGLPLTAFAGKEHSALMACYKASETHVEVTACLDNRWNVSQDALNKTEAA 60

Query: 54  VLEK------VEKHQRELFEKSQ--MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
           + E       +   Q  +   +Q   A+  +R ++C    +    G+     Y NC+   
Sbjct: 61  LREHFIKLDALSSLQHGVPVAAQTFSAFRNWREAQCKMVEASYASGSGSGQGYLNCMIEI 120

Query: 106 AIERNEKLESYL 117
             E+  +L S +
Sbjct: 121 TNEQIARLNSLM 132


>gi|120600746|ref|YP_965320.1| hypothetical protein Sputw3181_3962 [Shewanella sp. W3-18-1]
 gi|120560839|gb|ABM26766.1| conserved hypothetical protein [Shewanella sp. W3-18-1]
          Length = 212

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 39/114 (34%), Gaps = 15/114 (13%)

Query: 5   IIFALTIIAIAFQSMALNCN--ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ AL+  A+A    + +C         DM  C       +  +L   Y + LEK +  Q
Sbjct: 24  MVSALSAGAMAANEPSFDCAKVNAGSIEDM-VCKDAGLNQLDNQLAKVYSQALEKAKNEQ 82

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               +  Q  W   R  EC  +                C+Q     R  +L++ 
Sbjct: 83  PPTLKAMQRGWVKGRN-ECWKSDDK-----------HACIQSSYQTRIAELQAQ 124


>gi|118588851|ref|ZP_01546259.1| hypothetical protein SIAM614_19134 [Stappia aggregata IAM 12614]
 gi|118438837|gb|EAV45470.1| hypothetical protein SIAM614_19134 [Stappia aggregata IAM 12614]
          Length = 204

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 31/85 (36%), Gaps = 9/85 (10%)

Query: 5  IIFALTIIAIAFQSM--ALNCNETLMQADMNQCTGNSFALVKEKLEATYK---KVLEKVE 59
          +  A      A  +   A +C +    A+   C+ +    + +KL   Y+    V++ ++
Sbjct: 10 LFVAAVGFVPAAWAAGPAFDCAKAESSAEKLVCSNDDLGALDQKLADVYEGAVGVVKSLD 69

Query: 60 KHQREL---FEKSQMAWEIYRGSEC 81
              E     +  Q  W   R  +C
Sbjct: 70 AGAEEELNTLKAYQRGWVKGRD-DC 93


>gi|168239014|ref|ZP_02664072.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194734675|ref|YP_002113529.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194710177|gb|ACF89398.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288204|gb|EDY27589.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 278

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 25/82 (30%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEALPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYTCQLEMTIARTAYLDG 273


>gi|226198549|ref|ZP_03794115.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|225929292|gb|EEH25313.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
          Length = 91

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 33/85 (38%), Gaps = 2/85 (2%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA-EE 90
           MN C      + + +L+    + + +    ++   E     W+  R + C  +A    ++
Sbjct: 1   MNFCAWRDQLVAERELQQVVDQQISE-HPERKTALEAKVAKWKKARDASCEKSARKEWDD 59

Query: 91  GTAQSMIYANCLQGHAIERNEKLES 115
           G+ +    A C      +  +KL +
Sbjct: 60  GSMRPAAQAICATASTKKMTKKLSA 84


>gi|3360263|gb|AAC28927.1| UmoC [Proteus mirabilis]
          Length = 137

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 41/122 (33%), Gaps = 17/122 (13%)

Query: 9   LTIIAIAFQSMAL-------NCNETLM---QADMNQCTGNSFALVKEKLEATYKKVLEKV 58
           LT+  I+F S A         C E      Q  +  C  +   L +E+L   Y K    +
Sbjct: 13  LTMSLISFSSFAQVNHDPLTKCYELSTDASQTTIKSCLLDELRLSEEQLNVIYNKSKGDL 72

Query: 59  EKHQR-------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNE 111
           E           +    SQ  + ++R SEC   ++    G     +   C       R +
Sbjct: 73  EDSDSIAAKSAIDALVSSQEQFILFRSSECQRQSALMMGGNGADEVLLACEIKLNQWRAK 132

Query: 112 KL 113
            L
Sbjct: 133 LL 134


>gi|186476936|ref|YP_001858406.1| hypothetical protein Bphy_2185 [Burkholderia phymatum STM815]
 gi|184193395|gb|ACC71360.1| conserved hypothetical protein [Burkholderia phymatum STM815]
          Length = 237

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 5/46 (10%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           QC   +F      L   Y+++  K+  H R +  ++Q AW  YR +
Sbjct: 166 QCEHATF-----DLNRYYRRLHAKLPSHARPVLSRAQRAWTAYRDA 206


>gi|146291219|ref|YP_001181643.1| hypothetical protein Sputcn32_0108 [Shewanella putrefaciens CN-32]
 gi|145562909|gb|ABP73844.1| conserved hypothetical protein [Shewanella putrefaciens CN-32]
 gi|319428422|gb|ADV56496.1| Protein of unknown function DUF2091, periplasmic [Shewanella
           putrefaciens 200]
          Length = 212

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 31/91 (34%), Gaps = 10/91 (10%)

Query: 5   IIFALTIIAIAFQSMALNCN--ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ AL+  A+A  + + +C         DM  C       +  +L   Y + LEK +  Q
Sbjct: 24  VVGALSAGAMAANAPSFDCTKVNAGSIEDM-VCKDAGLNQLDNQLAKVYSQALEKSKNEQ 82

Query: 63  RELFEKSQMAWEIYR-------GSECAFAAS 86
               +  Q  W   R              +S
Sbjct: 83  PPTLKAMQRGWVKGRNECWKNDDKHACIQSS 113


>gi|168231491|ref|ZP_02656549.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194469409|ref|ZP_03075393.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455773|gb|EDX44612.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205334057|gb|EDZ20821.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 275

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +K     +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 ATKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|221199346|ref|ZP_03572390.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221205752|ref|ZP_03578767.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221174590|gb|EEE07022.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221180631|gb|EEE13034.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 256

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 192 DLNRYYQKLRRKMPAHSAATLVRAQRAWFAFRDATA 227



 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 28/68 (41%), Gaps = 2/68 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    +  ++  Y ++L+      +  +++SQ  W  +R  E     +  +   G
Sbjct: 52  QCMNEAQQQWQAAMDDAYARLLKNAPADAKRGWQESQRRWLTWRKDEAHLLKAVYDTTSG 111

Query: 92  TAQSMIYA 99
           T  +M  A
Sbjct: 112 TMYTMASA 119


>gi|332162923|ref|YP_004299500.1| hypothetical protein YE105_C3303 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|325667153|gb|ADZ43797.1| hypothetical protein YE105_C3303 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330862331|emb|CBX72491.1| hypothetical protein YEW_GP28220 [Yersinia enterocolitica W22703]
          Length = 329

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 11/70 (15%), Positives = 24/70 (34%), Gaps = 3/70 (4%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
             L ++ ++  S A+NC       +   C       + +     Y+ +L K +      
Sbjct: 7  FLFLLMMVVSSSSFAINCQRAATPVEYTVCGDEDLHWLDQTFSDIYQAMLVKYDTET--- 63

Query: 66 FEKSQMAWEI 75
            + + AW  
Sbjct: 64 VYQQRQAWIK 73


>gi|325916262|ref|ZP_08178543.1| hypothetical protein conserved in bacteria, putative lipoprotein
          [Xanthomonas vesicatoria ATCC 35937]
 gi|325537556|gb|EGD09271.1| hypothetical protein conserved in bacteria, putative lipoprotein
          [Xanthomonas vesicatoria ATCC 35937]
          Length = 389

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 10/78 (12%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 3  RKIIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
          R ++ +  +++ +   + + +C +     +   C   +  L+ ++L+ +Y+ +++   + 
Sbjct: 9  RLLLGSALVLSASGAGAASFDCKQASTPVEQRICAVPALGLLDDQLDESYQALVQTTPRA 68

Query: 62 QRELFEKSQMAWEIYRGS 79
                + Q AW   R +
Sbjct: 69 AVTGVREQQGAWLRQRNA 86


>gi|149201457|ref|ZP_01878432.1| hypothetical protein RTM1035_17567 [Roseovarius sp. TM1035]
 gi|149145790|gb|EDM33816.1| hypothetical protein RTM1035_17567 [Roseovarius sp. TM1035]
          Length = 186

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 17/105 (16%), Positives = 29/105 (27%), Gaps = 13/105 (12%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL-------------FEKSQ 70
           +       M  C      L   +L A Y   ++       E+               + Q
Sbjct: 78  DGGETTIGMIDCLDAELKLWDGRLNAAYAAKMDAARASDAEMASIGASVPSLENSLREMQ 137

Query: 71  MAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            AW  +R + C +  +    GT        C       +  +LE 
Sbjct: 138 RAWMAFRDAACLYEQAQWMGGTGGGPATMACHMQETAHQALRLEG 182


>gi|239834854|ref|ZP_04683182.1| Conserved hypothetical protein [Ochrobactrum intermedium LMG
          3301]
 gi|239822917|gb|EEQ94486.1| Conserved hypothetical protein [Ochrobactrum intermedium LMG
          3301]
          Length = 225

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 31/83 (37%), Gaps = 3/83 (3%)

Query: 5  IIFALTIIAIAFQSMA-LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
          ++ A         + A  +C +   + +   C+    A     +  +YK +L++     R
Sbjct: 13 LLAAFAFCCSPANAQAGFDCKKASTETEKAICSDPEIAESDRGMTVSYKSLLDRAGTKLR 72

Query: 64 ELFEKSQMAWEIYRGSECAFAAS 86
          E     Q A+   R    AF +S
Sbjct: 73 ETLRADQAAFLKIRTE--AFESS 93


>gi|54298438|ref|YP_124807.1| hypothetical protein lpp2502 [Legionella pneumophila str. Paris]
 gi|53752223|emb|CAH13655.1| hypothetical protein lpp2502 [Legionella pneumophila str. Paris]
          Length = 347

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 36/85 (42%), Gaps = 16/85 (18%)

Query: 11  IIAIAFQSMALNCNETLMQ------ADMNQC-----TGNSFALVKEKLEATYKKVLEKVE 59
           +   A  + A+N    L Q        +N+C     T   +  + ++L   YKK++    
Sbjct: 226 LSGTARSAFAINAQLNLNQRLFELLQKVNRCETPLMTIKQYEEMDKQLNNIYKKLMADTS 285

Query: 60  KHQ-----RELFEKSQMAWEIYRGS 79
             Q     +E  +K+++AW  YR +
Sbjct: 286 SFQYTTVTKEGIKKTEIAWIQYRDA 310


>gi|262368207|ref|ZP_06061536.1| predicted protein [Acinetobacter johnsonii SH046]
 gi|262315885|gb|EEY96923.1| predicted protein [Acinetobacter johnsonii SH046]
          Length = 140

 Score = 43.0 bits (100), Expect = 0.016,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 34/87 (39%), Gaps = 2/87 (2%)

Query: 30  ADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE 89
           ++++ C    + + K++L+  +K  L K    ++ L ++S   W   R   C        
Sbjct: 50  SEIDACMSKEYKVQKKRLKKVFKPYLAKAPVEEQGLVKQSHQQWLAQRDQICN--NKPIV 107

Query: 90  EGTAQSMIYANCLQGHAIERNEKLESY 116
           +     +   +CL      R +  E+ 
Sbjct: 108 KNEKTELQRISCLMQMTQTRADMYEAL 134


>gi|254374151|ref|ZP_04989633.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571871|gb|EDN37525.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 97

 Score = 43.0 bits (100), Expect = 0.016,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 46/115 (40%), Gaps = 18/115 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + II  LTI+     +  + C+      ++N C  +   +   KL           + 
Sbjct: 1   MKKLIIMTLTILPTLVLADKV-CDGNT--YEINACLKSQMQIYDTKLNDV--------QN 49

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           H  + F+K       YR + C   +S  + GT Q++ Y NC+        ++L+ 
Sbjct: 50  HDIKNFKK-------YRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLKP 97


>gi|227356317|ref|ZP_03840705.1| upregulator of flagellar master operon [Proteus mirabilis ATCC
           29906]
 gi|227163427|gb|EEI48348.1| upregulator of flagellar master operon [Proteus mirabilis ATCC
           29906]
          Length = 137

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 41/123 (33%), Gaps = 15/123 (12%)

Query: 6   IFALTIIAIAFQSMAL-----NCNETLM---QADMNQCTGNSFALVKEKLEATYKKVLEK 57
           +  +++++ +  +         C E      Q  +  C  +   L +E+L   Y K    
Sbjct: 12  LLTMSLLSFSSFAQVNHDPLTKCYELSTDASQTTIKACLLDELRLSEEQLNVIYNKSKGD 71

Query: 58  VEKHQR-------ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERN 110
           +E           +    SQ  + ++R SEC   ++    G     +   C       R 
Sbjct: 72  LEDSDSIAAKSAIDALVSSQEQFILFRSSECQRQSALMMGGNGADEVLLACEIKLNQWRA 131

Query: 111 EKL 113
           + L
Sbjct: 132 KLL 134


>gi|221211561|ref|ZP_03584540.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221168922|gb|EEE01390.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 256

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 192 DLNRYYQKLRRKMPAHSAATLVRAQRAWFAFRDATA 227



 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    +  ++A Y ++L+      +  +++SQ  W  +R  E     +  +   G
Sbjct: 52  QCMNEAQQQWQAAMDAAYARLLKDAPADAKRGWQESQRRWLTWRKDEAQLLKAVYDTTSG 111

Query: 92  TAQSMIYA 99
           T  +M  A
Sbjct: 112 TMYTMASA 119


>gi|317048638|ref|YP_004116286.1| hypothetical protein Pat9b_2429 [Pantoea sp. At-9b]
 gi|316950255|gb|ADU69730.1| protein of unknown function DUF1311 [Pantoea sp. At-9b]
          Length = 271

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 20/58 (34%)

Query: 18 SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
          + + +CN      +   C     + + E L   Y + +  +        ++SQ  W  
Sbjct: 23 AASFDCNRASTPQEKLICQTPQLSSLDETLANVYHQKMSGLAAADAVQLKQSQREWLK 80


>gi|118497328|ref|YP_898378.1| hypothetical protein FTN_0733 [Francisella tularensis subsp.
           novicida U112]
 gi|195536014|ref|ZP_03079021.1| hypothetical protein FTE_0973 [Francisella tularensis subsp.
           novicida FTE]
 gi|118423234|gb|ABK89624.1| hypothetical protein FTN_0733 [Francisella novicida U112]
 gi|194372491|gb|EDX27202.1| hypothetical protein FTE_0973 [Francisella tularensis subsp.
           novicida FTE]
          Length = 97

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 46/115 (40%), Gaps = 18/115 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + II  LTI+     +  + C+      ++N C  +   +   KL           + 
Sbjct: 1   MKKLIIMTLTILPTLIVADKV-CDGNT--YEINACLKSQMQIYDTKLNDV--------QN 49

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           H  + F+K       YR + C   +S  + GT Q++ Y NC+        ++L+ 
Sbjct: 50  HDIKNFKK-------YRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLKP 97


>gi|153876624|ref|ZP_02003849.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
 gi|152066912|gb|EDN66151.1| conserved hypothetical protein, secreted [Beggiatoa sp. PS]
          Length = 188

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 30/80 (37%), Gaps = 3/80 (3%)

Query: 4  KIIFALTIIAIAFQ---SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          K   A+ +I I      + + NC     + +   C      L  +++   Y+ + + + K
Sbjct: 2  KFFIAILLIFINTSSLFAASFNCQIASKEIERMICNTPELNLADKQMGQAYRNLQKVLPK 61

Query: 61 HQRELFEKSQMAWEIYRGSE 80
           +R +    Q  W   R  E
Sbjct: 62 SERYILLNDQRGWLRERDIE 81


>gi|260654983|ref|ZP_05860471.1| hypothetical protein GCWU000246_00933 [Jonquetella anthropi E3_33
           E1]
 gi|260630298|gb|EEX48492.1| hypothetical protein GCWU000246_00933 [Jonquetella anthropi E3_33
           E1]
          Length = 283

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 32/88 (36%), Gaps = 14/88 (15%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF-------AASGAEE 90
              A   E+L       L+ +    +E F+K+Q AWE +  +E             G   
Sbjct: 69  KEIARADEEL-------LKVLPAAGKEKFKKTQKAWEAFSQAENDVLDLAIEKVNEGPYG 121

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
           GT    I AN        R  +L +YL 
Sbjct: 122 GTMWVSIQANSHAEFTRVRAMELLTYLD 149


>gi|148360110|ref|YP_001251317.1| hypothetical protein LPC_2041 [Legionella pneumophila str. Corby]
 gi|148281883|gb|ABQ55971.1| hypothetical protein LPC_2041 [Legionella pneumophila str. Corby]
          Length = 347

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 36/85 (42%), Gaps = 16/85 (18%)

Query: 11  IIAIAFQSMALNCNETLMQ------ADMNQC-----TGNSFALVKEKLEATYKKVLEKVE 59
           +   A  + A+N    L Q        +N+C     T   +  + ++L   YKK++    
Sbjct: 226 LSGTARSAFAINAQLNLNQRLFELLQKVNRCETPLMTIKQYEEMDKQLNNIYKKLMADTS 285

Query: 60  KHQ-----RELFEKSQMAWEIYRGS 79
             Q     +E  +K+++AW  YR +
Sbjct: 286 SFQYTTVAKEGIKKTEIAWIQYRDA 310


>gi|167561958|ref|ZP_02354874.1| hypothetical protein BoklE_05295 [Burkholderia oklahomensis EO147]
          Length = 236

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 35/84 (41%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +      +++A Y+++ +      R  +++SQ  W ++R  E     +  +  +G
Sbjct: 56  QCMDEARQQWLAEVDAAYQRLQKAAPADARRGWQESQRRWLVWRKDEAHLVRAVYDTTQG 115

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           T  +M  A+       +R   L  
Sbjct: 116 TMYAMASADMRLQPVRDRARALRG 139



 Score = 35.6 bits (81), Expect = 2.6,   Method: Composition-based stats.
 Identities = 8/71 (11%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y K+  ++         ++Q  W  +R +                +I  +     
Sbjct: 172 DMNRYYAKLQSRMPAASLPTLAQAQREWAAFRDA-------------MTPLISEDERVDL 218

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 219 IGARVATLKRF 229


>gi|238021973|ref|ZP_04602399.1| hypothetical protein GCWU000324_01878 [Kingella oralis ATCC 51147]
 gi|237866587|gb|EEP67629.1| hypothetical protein GCWU000324_01878 [Kingella oralis ATCC 51147]
          Length = 363

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 31/79 (39%)

Query: 38  NSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMI 97
           N+     +K + + K    K++   ++     Q  WE  + + C  AA+  +  T    +
Sbjct: 282 NAAREANDKADQSIKSAWRKIDPQVQQDLVDEQREWESKKRANCRNAAAKGKSATESQYL 341

Query: 98  YANCLQGHAIERNEKLESY 116
              C      ER + L+ Y
Sbjct: 342 QLQCDTRMTRERVQYLKGY 360


>gi|255066701|ref|ZP_05318556.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
 gi|255049029|gb|EET44493.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
          Length = 155

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 43/112 (38%), Gaps = 4/112 (3%)

Query: 18  SMALNCN-ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           ++   C+  +++Q D+  C   S+ L +++L   Y    ++   + R      Q  W   
Sbjct: 33  ALNKPCHVNSIIQEDILICFSKSYLLAQKELNNNYSIAQKQKNVNIRNYLIHQQRQWNKN 92

Query: 77  RGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF 128
           +  EC       E G      Y  C     ++RN  L+    C  G+  C F
Sbjct: 93  KFDEC-LILPEKEVGREGIFEYLQCATDAILKRNSYLKEIYVC--GNEPCQF 141


>gi|15608679|ref|NP_216057.1| lipoprotein LprI [Mycobacterium tuberculosis H37Rv]
 gi|15841008|ref|NP_336045.1| hypothetical protein MT1593 [Mycobacterium tuberculosis CDC1551]
 gi|31792727|ref|NP_855220.1| lipoprotein LprI [Mycobacterium bovis AF2122/97]
 gi|121637462|ref|YP_977685.1| putative lipoprotein lprI [Mycobacterium bovis BCG str. Pasteur
          1173P2]
 gi|148661337|ref|YP_001282860.1| putative lipoprotein LprI [Mycobacterium tuberculosis H37Ra]
 gi|148822765|ref|YP_001287519.1| lipoprotein lprI [Mycobacterium tuberculosis F11]
 gi|167968096|ref|ZP_02550373.1| lipoprotein lprI [Mycobacterium tuberculosis H37Ra]
 gi|215403397|ref|ZP_03415578.1| lipoprotein lprI [Mycobacterium tuberculosis 02_1987]
 gi|215426885|ref|ZP_03424804.1| lipoprotein lprI [Mycobacterium tuberculosis T92]
 gi|215430435|ref|ZP_03428354.1| lipoprotein lprI [Mycobacterium tuberculosis EAS054]
 gi|215445739|ref|ZP_03432491.1| lipoprotein lprI [Mycobacterium tuberculosis T85]
 gi|218753262|ref|ZP_03532058.1| lipoprotein lprI [Mycobacterium tuberculosis GM 1503]
 gi|219557452|ref|ZP_03536528.1| lipoprotein lprI [Mycobacterium tuberculosis T17]
 gi|224989937|ref|YP_002644624.1| putative lipoprotein [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253799404|ref|YP_003032405.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 1435]
 gi|254231770|ref|ZP_04925097.1| lipoprotein lprI [Mycobacterium tuberculosis C]
 gi|254364413|ref|ZP_04980459.1| lipoprotein lprI [Mycobacterium tuberculosis str. Haarlem]
 gi|254550561|ref|ZP_05141008.1| lipoprotein lprI [Mycobacterium tuberculosis '98-R604
          INH-RIF-EM']
 gi|260186492|ref|ZP_05763966.1| lipoprotein lprI [Mycobacterium tuberculosis CPHL_A]
 gi|260200602|ref|ZP_05768093.1| lipoprotein lprI [Mycobacterium tuberculosis T46]
 gi|260204827|ref|ZP_05772318.1| lipoprotein lprI [Mycobacterium tuberculosis K85]
 gi|289442995|ref|ZP_06432739.1| lipoprotein lprI [Mycobacterium tuberculosis T46]
 gi|289447152|ref|ZP_06436896.1| lipoprotein lprI [Mycobacterium tuberculosis CPHL_A]
 gi|289554667|ref|ZP_06443877.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 605]
 gi|289569576|ref|ZP_06449803.1| lipoprotein lprI [Mycobacterium tuberculosis T17]
 gi|289574225|ref|ZP_06454452.1| lipoprotein lprI [Mycobacterium tuberculosis K85]
 gi|289745297|ref|ZP_06504675.1| lipoprotein LprI [Mycobacterium tuberculosis 02_1987]
 gi|289750108|ref|ZP_06509486.1| lipoprotein lprI [Mycobacterium tuberculosis T92]
 gi|289753628|ref|ZP_06513006.1| lipoprotein lprI [Mycobacterium tuberculosis EAS054]
 gi|289757657|ref|ZP_06517035.1| lipoprotein lprI [Mycobacterium tuberculosis T85]
 gi|289761704|ref|ZP_06521082.1| lipoprotein lprI [Mycobacterium tuberculosis GM 1503]
 gi|294996508|ref|ZP_06802199.1| lipoprotein lprI [Mycobacterium tuberculosis 210]
 gi|297634110|ref|ZP_06951890.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 4207]
 gi|297731097|ref|ZP_06960215.1| lipoprotein lprI [Mycobacterium tuberculosis KZN R506]
 gi|306775731|ref|ZP_07414068.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu001]
 gi|306779555|ref|ZP_07417892.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu002]
 gi|306784286|ref|ZP_07422608.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu003]
 gi|306788654|ref|ZP_07426976.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu004]
 gi|306792993|ref|ZP_07431295.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu005]
 gi|306797372|ref|ZP_07435674.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu006]
 gi|306803253|ref|ZP_07439921.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu008]
 gi|306807832|ref|ZP_07444500.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu007]
 gi|306967652|ref|ZP_07480313.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu009]
 gi|306971840|ref|ZP_07484501.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu010]
 gi|307079555|ref|ZP_07488725.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu011]
 gi|307084120|ref|ZP_07493233.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu012]
 gi|313658429|ref|ZP_07815309.1| lipoprotein lprI [Mycobacterium tuberculosis KZN V2475]
 gi|54037752|sp|P65319|LPRI_MYCBO RecName: Full=Putative lipoprotein lprI; Flags: Precursor
 gi|54041443|sp|P65318|LPRI_MYCTU RecName: Full=Putative lipoprotein lprI; Flags: Precursor
 gi|1403501|emb|CAA98321.1| Possible lipoprotein lprI [Mycobacterium tuberculosis H37Rv]
 gi|13881217|gb|AAK45859.1| hypothetical protein MT1593 [Mycobacterium tuberculosis CDC1551]
 gi|31618317|emb|CAD96235.1| Possible lipoprotein lprI [Mycobacterium bovis AF2122/97]
 gi|121493109|emb|CAL71580.1| Possible lipoprotein lprI [Mycobacterium bovis BCG str. Pasteur
          1173P2]
 gi|124600829|gb|EAY59839.1| lipoprotein lprI [Mycobacterium tuberculosis C]
 gi|134149927|gb|EBA41972.1| lipoprotein lprI [Mycobacterium tuberculosis str. Haarlem]
 gi|148505489|gb|ABQ73298.1| putative lipoprotein LprI [Mycobacterium tuberculosis H37Ra]
 gi|148721292|gb|ABR05917.1| lipoprotein lprI [Mycobacterium tuberculosis F11]
 gi|224773050|dbj|BAH25856.1| putative lipoprotein [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253320907|gb|ACT25510.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 1435]
 gi|289415914|gb|EFD13154.1| lipoprotein lprI [Mycobacterium tuberculosis T46]
 gi|289420110|gb|EFD17311.1| lipoprotein lprI [Mycobacterium tuberculosis CPHL_A]
 gi|289439299|gb|EFD21792.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 605]
 gi|289538656|gb|EFD43234.1| lipoprotein lprI [Mycobacterium tuberculosis K85]
 gi|289543330|gb|EFD46978.1| lipoprotein lprI [Mycobacterium tuberculosis T17]
 gi|289685825|gb|EFD53313.1| lipoprotein LprI [Mycobacterium tuberculosis 02_1987]
 gi|289690695|gb|EFD58124.1| lipoprotein lprI [Mycobacterium tuberculosis T92]
 gi|289694215|gb|EFD61644.1| lipoprotein lprI [Mycobacterium tuberculosis EAS054]
 gi|289709210|gb|EFD73226.1| lipoprotein lprI [Mycobacterium tuberculosis GM 1503]
 gi|289713221|gb|EFD77233.1| lipoprotein lprI [Mycobacterium tuberculosis T85]
 gi|308215823|gb|EFO75222.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu001]
 gi|308327490|gb|EFP16341.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu002]
 gi|308330951|gb|EFP19802.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu003]
 gi|308334772|gb|EFP23623.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu004]
 gi|308338560|gb|EFP27411.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu005]
 gi|308342262|gb|EFP31113.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu006]
 gi|308345757|gb|EFP34608.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu007]
 gi|308350057|gb|EFP38908.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu008]
 gi|308354711|gb|EFP43562.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu009]
 gi|308358697|gb|EFP47548.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu010]
 gi|308362577|gb|EFP51428.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu011]
 gi|308366241|gb|EFP55092.1| lipoprotein lprI [Mycobacterium tuberculosis SUMu012]
 gi|323719989|gb|EGB29101.1| lipoprotein lprI [Mycobacterium tuberculosis CDC1551A]
 gi|326903171|gb|EGE50104.1| lipoprotein lprI [Mycobacterium tuberculosis W-148]
 gi|328459154|gb|AEB04577.1| lipoprotein lprI [Mycobacterium tuberculosis KZN 4207]
          Length = 197

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 22/61 (36%), Gaps = 3/61 (4%)

Query: 19 MALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
           +L+C +         C       +  +L   Y++ L      +    E +Q +W + R 
Sbjct: 31 QSLDCTKPATIVQQLVCHDRQLTSLDHRLSTAYQQALAH---RRSAALEAAQSSWTMLRD 87

Query: 79 S 79
          +
Sbjct: 88 A 88


>gi|293394383|ref|ZP_06638683.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291423361|gb|EFE96590.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 263

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 6   IFALTIIAIAFQSM---ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           + A+T+++   +S    + +C + L + +   C+  + A + + L  TY + L   ++  
Sbjct: 14  VAAMTLLSFTVRSADNPSFDCKKKLNKVEGLICSNPTLAQLDKTLADTYPQTLNAADQAS 73

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN---CLQGHAIERNEKLE 114
           R   + SQ  W   R   C   A  + +G  +  I  N   CLQ     R ++L+
Sbjct: 74  RAKIQASQKQWLQARAGIC--IAPQSWQGLFKQPISDNPQRCLQDLYSLRIDELK 126


>gi|168240330|ref|ZP_02665262.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194450974|ref|YP_002044530.1| hypothetical protein SeHA_C0605 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197262438|ref|ZP_03162512.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|194409278|gb|ACF69497.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197240693|gb|EDY23313.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205339755|gb|EDZ26519.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 275

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+S
Sbjct: 252 KRISIYKCQLEMTIARTAYLDS 273


>gi|156935158|ref|YP_001439074.1| hypothetical protein ESA_03009 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533412|gb|ABU78238.1| hypothetical protein ESA_03009 [Cronobacter sakazakii ATCC BAA-894]
          Length = 147

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 52/139 (37%), Gaps = 26/139 (18%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNET---------LMQA--DMNQCTGNSFALVKEKLEAT 50
            +KI+F ++++ ++  S+A                 Q   + ++C G+        L   
Sbjct: 1   MKKIVFIISVLLVSHASLAAETANVTRNDEVKACEDQYGDENSECLGDIDDKSTGALNKA 60

Query: 51  YKKVLEKV-----------EKHQRE----LFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
           Y   L+++           ++ +++    LF+KSQ  W  YR   C  A + A       
Sbjct: 61  YADKLKEMENFDYTKWWMGDEDRKKRMIELFKKSQAEWLKYRDDYCGVAVAEAASTHYLG 120

Query: 96  MIYANCLQGHAIERNEKLE 114
                C      +R ++++
Sbjct: 121 NAATACNINMNRQRIKEIQ 139


>gi|161524042|ref|YP_001579054.1| hypothetical protein Bmul_0863 [Burkholderia multivorans ATCC
           17616]
 gi|189351197|ref|YP_001946825.1| hypothetical protein BMULJ_02395 [Burkholderia multivorans ATCC
           17616]
 gi|160341471|gb|ABX14557.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|189335219|dbj|BAG44289.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 265

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
            L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 201 DLNRYYQKLRRKMPAHSAATLVRAQRAWFAFRDATA 236



 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAE--EG 91
           QC   +    +  ++A Y ++L+      +  +++SQ  W  +R  E     +  +   G
Sbjct: 61  QCMNEAQQQWQAAMDAAYARLLKDAPADAKRGWQESQRRWLTWRKDEAQLLKAVYDTTSG 120

Query: 92  TAQSMIYA 99
           T  +M  A
Sbjct: 121 TMYTMASA 128


>gi|289165192|ref|YP_003455330.1| hypothetical protein LLO_1855 [Legionella longbeachae NSW150]
 gi|288858365|emb|CBJ12233.1| hypothetical protein LLO_1855 [Legionella longbeachae NSW150]
          Length = 318

 Score = 42.6 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 40/104 (38%), Gaps = 20/104 (19%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKK--------VLEKVEKHQ-RELFE---KSQM 71
           N    Q +MNQ   ++F   + ++    +K        + ++  K Q ++      + + 
Sbjct: 207 NSPTTQYEMNQ---SAFEKSE-EINKRIRKFIADICLYIKQRSSKEQVKQFLIYYHQREK 262

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           + + Y   +  F     E G+   +IY + +        ++L+ 
Sbjct: 263 SIKEYGKLQADF----YEGGSMYPLIYYSAITSGREIFFDELKK 302


>gi|213612352|ref|ZP_03370178.1| hypothetical protein SentesTyp_07524 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 283

 Score = 42.6 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E+  A+
Sbjct: 201 AAKKFESRDRELNQVWNS----LPTSARTALKQEQRVWVTKKEQQCGKLSDAKSEDIPAE 256

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 257 KRISIYKCQLEMTIARTTYLDG 278


>gi|171322648|ref|ZP_02911413.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
 gi|171092017|gb|EDT37459.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
          Length = 76

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 46 KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
           L   Y+K+  K+  H      ++Q AW  +R +  
Sbjct: 12 DLNRYYQKLRRKMPAHSAATLARAQHAWVAFRDATA 47


>gi|311108673|ref|YP_003981526.1| hypothetical protein AXYL_05511 [Achromobacter xylosoxidans A8]
 gi|310763362|gb|ADP18811.1| hypothetical protein AXYL_05511 [Achromobacter xylosoxidans A8]
          Length = 223

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 18/58 (31%)

Query: 21 LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
           NC +     +   C   + A     +   YK V  K++    +     Q  +   R 
Sbjct: 23 FNCAKATSPVEKAICAHPALADQDAAIAQQYKAVRAKLDAEAVKSLTSDQRYFLSVRD 80


>gi|238911373|ref|ZP_04655210.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 275

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 25/82 (30%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQPEMTIARTAYLDG 273


>gi|225077080|ref|ZP_03720279.1| hypothetical protein NEIFLAOT_02133 [Neisseria flavescens
           NRL30031/H210]
 gi|224951637|gb|EEG32846.1| hypothetical protein NEIFLAOT_02133 [Neisseria flavescens
           NRL30031/H210]
          Length = 340

 Score = 42.2 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 12/89 (13%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q++++            ++   +      ++   ++     Q AW   +   C  AA+ 
Sbjct: 254 SQSELDN-ARAQNRQADGEINDLW----GGMDSDVKQQILGEQRAWIQSKKLNCQQAAAS 308

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  +
Sbjct: 309 ADSAAQAEYLRLQCETRMTRERTQYLRGF 337


>gi|241668639|ref|ZP_04756217.1| hypothetical protein FphipA2_07721 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877172|ref|ZP_05249882.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843193|gb|EET21607.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 96

 Score = 42.2 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 47/114 (41%), Gaps = 19/114 (16%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R I+     + I   + +  C+      ++NQC      +  +KL++        ++ 
Sbjct: 1   MLRIIL--SLFLPILVFANSPICDGNT--YEINQCLKTQMQMYDKKLDS--------LKN 48

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
              + F+K       YR + C+  +S    GT +S+ Y NC+        E+++
Sbjct: 49  SNIKEFKK-------YRDNICSNISSAYNGGTYESIKYGNCIISLDRWFLEEVK 95


>gi|258541597|ref|YP_003187030.1| hypothetical protein APA01_05000 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632675|dbj|BAH98650.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635732|dbj|BAI01701.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638787|dbj|BAI04749.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641841|dbj|BAI07796.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644896|dbj|BAI10844.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647951|dbj|BAI13892.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651004|dbj|BAI16938.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653995|dbj|BAI19922.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 143

 Score = 42.2 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 15/114 (13%), Positives = 38/114 (33%), Gaps = 5/114 (4%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
           ++ +   +    Q+ A +    L   ++  C        ++++         ++ +    
Sbjct: 7   LLLSAASVLCTVQARAADKCPGLTTPEIADCQKQGVDKAQKQMARYIAAAEGRIRQSADP 66

Query: 65  L-----FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                 F  +Q  W  Y+ +EC  A     +GT +  +   C+      R   +
Sbjct: 67  EHALADFHTAQQHWAQYQKAECNAAYEAWSDGTIRFSMALTCMLRLTHSRTMDI 120


>gi|120554246|ref|YP_958597.1| hypothetical protein Maqu_1321 [Marinobacter aquaeolei VT8]
 gi|120324095|gb|ABM18410.1| hypothetical protein Maqu_1321 [Marinobacter aquaeolei VT8]
          Length = 405

 Score = 42.2 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 32/88 (36%), Gaps = 1/88 (1%)

Query: 24  NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAF 83
           N      ++ Q       +  E++ A   + L   E  Q++  + SQ  WE Y  + C  
Sbjct: 294 NAPQTMREIQQAEKLKMEIAFEEMNAYLAEAL-IAEVEQKDAIQNSQSLWEQYANAHCDA 352

Query: 84  AASGAEEGTAQSMIYANCLQGHAIERNE 111
                  G+ +   Y  C +   +ER  
Sbjct: 353 VYERWSGGSVRFFEYYRCHKELILERTR 380



 Score = 34.9 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 27/90 (30%), Gaps = 9/90 (10%)

Query: 23  CNETL--MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR--- 77
           C+ T    Q +   C  +  +     L   Y  V  ++E         SQ+ W   R   
Sbjct: 202 CSNTSKLSQVEKQICGSSQLSRADRVLANLYNFVQVEIENDD---LRASQLNWLDKRAKC 258

Query: 78  -GSECAFAASGAEEGTAQSMIYANCLQGHA 106
              +C ++           M+    L  H 
Sbjct: 259 DDEQCIYSEYSERISELVGMVTVEKLVSHT 288


>gi|16759475|ref|NP_455092.1| hypothetical protein STY0543 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142753|ref|NP_806095.1| hypothetical protein t2363 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213650635|ref|ZP_03380688.1| hypothetical protein SentesTy_27400 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865243|ref|ZP_03387362.1| hypothetical protein SentesT_36075 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289828664|ref|ZP_06546463.1| hypothetical protein Salmonellentericaenterica_19341 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25380619|pir||AD0564 probable secreted protein [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16501767|emb|CAD04982.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138385|gb|AAO69955.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 278

 Score = 42.2 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E+  A+
Sbjct: 196 AAKKFESRDRELNQVWNS----LPTSARTALKQEQRVWVTKKEQQCGKLSDAKSEDIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTTYLDG 273


>gi|325267321|ref|ZP_08133983.1| hypothetical protein HMPREF9098_1711 [Kingella denitrificans ATCC
           33394]
 gi|324981258|gb|EGC16908.1| hypothetical protein HMPREF9098_1711 [Kingella denitrificans ATCC
           33394]
          Length = 175

 Score = 42.2 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 38/101 (37%), Gaps = 11/101 (10%)

Query: 29  QADMNQCTGNSFALVKEKLEATYKKVLEKVEK---------HQRELFEKSQMAWEIYRGS 79
           Q ++  C   +  +    L    ++   K+             ++  + ++ ++  YR +
Sbjct: 71  QTEVRDCVRRAAEISAANLRQAQRQATAKIRAWNEDRRYVLAAQQKLKAAEHSFATYRQN 130

Query: 80  ECAFAASGAEE--GTAQSMIYANCLQGHAIERNEKLESYLT 118
            C++AAS      GTA  M    C+      R E+L   + 
Sbjct: 131 HCSWAASLGGGAIGTANEMRRNACIAETNNRRAEELRGIMQ 171


>gi|167553797|ref|ZP_02347542.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205321845|gb|EDZ09684.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 109

 Score = 42.2 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 37/115 (32%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + +  C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVNAASFACQKAQAADEKAICAHLTLNDKDVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|170694696|ref|ZP_02885847.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
 gi|170140327|gb|EDT08504.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
          Length = 164

 Score = 42.2 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 34/81 (41%), Gaps = 3/81 (3%)

Query: 3  RKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
          R ++ A  +IA  + Q+ + +C++    A+   C   + + + + L   Y K   +    
Sbjct: 5  RPLLIAALLIAHPSAQAASFDCSKGRSLAEKIICNDPALSRLDDTLGRLYWKAR-RTVSD 63

Query: 62 QRELFEKSQMAWEIYRGSECA 82
          +R     S   W  +R + C 
Sbjct: 64 RRGFIADSDSKW-AWREANCR 83


>gi|154245844|ref|YP_001416802.1| hypothetical protein Xaut_1900 [Xanthobacter autotrophicus Py2]
 gi|154159929|gb|ABS67145.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 132

 Score = 42.2 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 34/97 (35%), Gaps = 15/97 (15%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C       +   C     A +  K+   Y  + + V   QR + + +Q AW   R S 
Sbjct: 42  FDCASARAADEKAICDSCDLAQLDVKMSTLYGVLTKLVAMGQRGMIQDAQRAWLAQR-ST 100

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           C         G        +CL G    R  +LE+ L
Sbjct: 101 C--------GGD------TSCLSGAYRSRIAQLEAAL 123


>gi|209521538|ref|ZP_03270240.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209498038|gb|EDZ98191.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 206

 Score = 42.2 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMIYANCL 102
             +++ Y+++L K+   +R L++KSQ +W   R +E    A+     +G+   +  A+  
Sbjct: 42  AAVDSAYQQLLAKLPTARRGLWQKSQSSWLASRDAEKQLLAAVFATTKGSMYVLAEADMQ 101

Query: 103 QGHAIERNEKLESYL 117
                +R   L S L
Sbjct: 102 LQPVRDRALVLRSAL 116



 Score = 34.9 bits (79), Expect = 4.0,   Method: Composition-based stats.
 Identities = 8/31 (25%), Positives = 12/31 (38%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
            L   Y+ +  K+    R     +Q AW  Y
Sbjct: 142 DLNRYYRVLESKMPAQSRPTLVHAQRAWSAY 172


>gi|13474022|ref|NP_105590.1| hypothetical protein mll4801 [Mesorhizobium loti MAFF303099]
 gi|14024774|dbj|BAB51376.1| mll4801 [Mesorhizobium loti MAFF303099]
          Length = 130

 Score = 42.2 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 19/121 (15%), Positives = 40/121 (33%), Gaps = 8/121 (6%)

Query: 6   IFALTIIAIAFQSMALN------C--NETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           +  +  +  A  +MA +      C        + M  C          +L   Y  ++ +
Sbjct: 7   LLGILAMTTAHSAMAQSDAEMKACVDRSGGATSAMLDCGKTEIDKFDARLNTAYNTLMHR 66

Query: 58  VEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
               +R   ++ Q AW  +   E    A+  + G+A  +   +        R  +LE  +
Sbjct: 67  EHGPERARLQREQRAWLKHHLRETHRLAADPDNGSAAFLTSQSFELDDLSARTAELEKRV 126

Query: 118 T 118
            
Sbjct: 127 Q 127


>gi|329119582|ref|ZP_08248264.1| lipoprotein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464320|gb|EGF10623.1| lipoprotein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 346

 Score = 41.8 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 12/91 (13%), Positives = 34/91 (37%), Gaps = 5/91 (5%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
            + +A+++    +     + ++ A ++     +    ++  +  Q  W   + + C  AA
Sbjct: 257 AVSEAELDS-ARSDQQASEREINAVWR----GLNPTVQQSLQDEQREWIGRKNTACRRAA 311

Query: 86  SGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           + A++      +   C      ER   L  +
Sbjct: 312 AKADDPARAEYLRLQCDAQQTRERTGYLRGF 342


>gi|309378559|emb|CBX22831.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 337

 Score = 41.8 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 258 AHVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADGKEYAE 313

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 314 YLKLQCDTRMTRERIQYLRGY 334


>gi|253690384|ref|YP_003019574.1| hypothetical protein PC1_4023 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|251756962|gb|ACT15038.1| conserved hypothetical protein [Pectobacterium carotovorum subsp.
          carotovorum PC1]
          Length = 266

 Score = 41.8 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 29/84 (34%), Gaps = 9/84 (10%)

Query: 4  KIIFALTIIAIAF----QSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV- 58
           II A ++   AF    Q+ +  C++   + +   C       + E+L   +K     + 
Sbjct: 6  TIIIAASVTLAAFNDNAQAASFPCDKATSEQEKLICASPLLGQLDEELAQAWKTSRAFLT 65

Query: 59 ----EKHQRELFEKSQMAWEIYRG 78
                   +   + Q +W   R 
Sbjct: 66 AYSNSTPWEKTLNQFQRSWLTTRD 89


>gi|257125530|ref|YP_003163644.1| hypothetical protein Lebu_0745 [Leptotrichia buccalis C-1013-b]
 gi|257049469|gb|ACV38653.1| protein of unknown function DUF1311 [Leptotrichia buccalis
           C-1013-b]
          Length = 143

 Score = 41.8 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 28/75 (37%), Gaps = 3/75 (4%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGA---EEGTAQSMIYAN 100
           ++++   Y  +L+K+   ++  F+  Q  W   R S+   A       E       + A+
Sbjct: 60  EKEMNKVYDLILKKLPAKEKTKFKSEQQKWLKNRESQVQKAYDKYTKEEGPRMAGELAAS 119

Query: 101 CLQGHAIERNEKLES 115
                  ER  +L  
Sbjct: 120 ERLSITKERVLELAK 134


>gi|261400020|ref|ZP_05986145.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
 gi|269210241|gb|EEZ76696.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
          Length = 337

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 258 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADGKEYAE 313

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 314 YLKLQCDTRMTRERIQYLRGY 334


>gi|217971328|ref|YP_002356079.1| hypothetical protein Sbal223_0115 [Shewanella baltica OS223]
 gi|217496463|gb|ACK44656.1| protein of unknown function DUF1311 [Shewanella baltica OS223]
          Length = 212

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 40/114 (35%), Gaps = 15/114 (13%)

Query: 5   IIFALTIIAIAFQSMALNCN--ETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ +L+  A+A  + + +C          M  C     + +  +L   Y + LEK +  Q
Sbjct: 24  MVSSLSTGAMAADAPSFDCAKVNAGSIEAM-VCKDAGLSQLDNQLAEVYSQALEKAKNEQ 82

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               +  Q  W   R  EC  +                C++     R  +L++ 
Sbjct: 83  PPTLKAMQRGWVKGRN-ECWKSDDK-----------HACIEASYQTRIAELQAQ 124


>gi|197105877|ref|YP_002131254.1| hypothetical protein PHZ_c2416 [Phenylobacterium zucineum HLK1]
 gi|196479297|gb|ACG78825.1| hypothetical protein PHZ_c2416 [Phenylobacterium zucineum HLK1]
          Length = 251

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 11/66 (16%), Positives = 18/66 (27%), Gaps = 2/66 (3%)

Query: 14  IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAW 73
                 + +C           C     A    +L + Y+  L   +   R      Q AW
Sbjct: 159 APGAQPSFDCGRADTDVLRMICMIPDLANADVRLASAYQTALSTADDPSR--LRDEQRAW 216

Query: 74  EIYRGS 79
              R +
Sbjct: 217 LERRDA 222


>gi|22127350|ref|NP_670773.1| hypothetical protein y3476 [Yersinia pestis KIM 10]
 gi|45442775|ref|NP_994314.1| hypothetical protein YP_3015 [Yersinia pestis biovar Microtus
          str. 91001]
 gi|108809082|ref|YP_652998.1| hypothetical protein YPA_3091 [Yersinia pestis Antiqua]
 gi|108810724|ref|YP_646491.1| hypothetical protein YPN_0559 [Yersinia pestis Nepal516]
 gi|150260270|ref|ZP_01916998.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|153949461|ref|YP_001399611.1| hypothetical protein YpsIP31758_0619 [Yersinia pseudotuberculosis
          IP 31758]
 gi|165924841|ref|ZP_02220673.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. F1991016]
 gi|165939085|ref|ZP_02227637.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|166009047|ref|ZP_02229945.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. E1979001]
 gi|166212173|ref|ZP_02238208.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. B42003004]
 gi|167398941|ref|ZP_02304465.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. UG05-0454]
 gi|167418995|ref|ZP_02310748.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. MG05-1020]
 gi|167425219|ref|ZP_02316972.1| conserved hypothetical protein [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|167466362|ref|ZP_02331066.1| hypothetical protein YpesF_00360 [Yersinia pestis FV-1]
 gi|170022948|ref|YP_001719453.1| hypothetical protein YPK_0699 [Yersinia pseudotuberculosis YPIII]
 gi|186896794|ref|YP_001873906.1| hypothetical protein YPTS_3496 [Yersinia pseudotuberculosis
          PB1/+]
 gi|218927891|ref|YP_002345766.1| hypothetical protein YPO0702 [Yersinia pestis CO92]
 gi|229837384|ref|ZP_04457547.1| putative exported protein [Yersinia pestis Pestoides A]
 gi|229840597|ref|ZP_04460756.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          PEXU2]
 gi|229842852|ref|ZP_04463004.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          India 195]
 gi|229900921|ref|ZP_04516045.1| putative exported protein [Yersinia pestis Nepal516]
 gi|294502768|ref|YP_003566830.1| hypothetical protein YPZ3_0658 [Yersinia pestis Z176003]
 gi|21960433|gb|AAM87024.1|AE013950_9 hypothetical [Yersinia pestis KIM 10]
 gi|45437641|gb|AAS63191.1| putative exported protein [Yersinia pestis biovar Microtus str.
          91001]
 gi|108774372|gb|ABG16891.1| hypothetical protein YPN_0559 [Yersinia pestis Nepal516]
 gi|108780995|gb|ABG15053.1| hypothetical protein YPA_3091 [Yersinia pestis Antiqua]
 gi|115346502|emb|CAL19377.1| putative exported protein [Yersinia pestis CO92]
 gi|149289678|gb|EDM39755.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|152960956|gb|ABS48417.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
          31758]
 gi|165913041|gb|EDR31666.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|165923041|gb|EDR40192.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. F1991016]
 gi|165992386|gb|EDR44687.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. E1979001]
 gi|166206919|gb|EDR51399.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. B42003004]
 gi|166962989|gb|EDR59010.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. MG05-1020]
 gi|167051445|gb|EDR62853.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. UG05-0454]
 gi|167055982|gb|EDR65763.1| conserved hypothetical protein [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|169749482|gb|ACA67000.1| conserved hypothetical protein [Yersinia pseudotuberculosis
          YPIII]
 gi|186699820|gb|ACC90449.1| conserved hypothetical protein [Yersinia pseudotuberculosis
          PB1/+]
 gi|229682260|gb|EEO78352.1| putative exported protein [Yersinia pestis Nepal516]
 gi|229690119|gb|EEO82176.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          India 195]
 gi|229696963|gb|EEO87010.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          PEXU2]
 gi|229705507|gb|EEO91517.1| putative exported protein [Yersinia pestis Pestoides A]
 gi|262360800|gb|ACY57521.1| hypothetical protein YPD4_0612 [Yersinia pestis D106004]
 gi|262364745|gb|ACY61302.1| hypothetical protein YPD8_0612 [Yersinia pestis D182038]
 gi|294353227|gb|ADE63568.1| hypothetical protein YPZ3_0658 [Yersinia pestis Z176003]
 gi|320016734|gb|ADW00306.1| putative exported protein [Yersinia pestis biovar Medievalis str.
          Harbin 35]
          Length = 331

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH----Q 62
          F L ++ I+  S+A+NC       +   C+      + +   + Y+ +L K        Q
Sbjct: 10 FFLWMMLISTSSLAINCQRASTPVEYTVCSNEDLHWLDQTFNSIYQVLLVKYNTEMVYQQ 69

Query: 63 RELFEKS 69
          R+ +EKS
Sbjct: 70 RQTWEKS 76


>gi|53802861|ref|YP_115354.1| hypothetical protein MCA2965 [Methylococcus capsulatus str. Bath]
 gi|53756622|gb|AAU90913.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 340

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 32/94 (34%), Gaps = 2/94 (2%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C +     +   C+  + A     L   + ++ + +          +Q  W  +  + 
Sbjct: 25  FDCTKAQGSIERAICSDENLADRDRSLAERFARLEKDLSPESFATVRNAQRDWVSWVRAW 84

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
           C    S AE+ +      A+CL     ER   L 
Sbjct: 85  CGGKKS-AEDAS-HPSGVADCLNTEYGEREGVLA 116


>gi|213581788|ref|ZP_03363614.1| hypothetical protein SentesTyph_11539 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 190

 Score = 41.8 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 26/82 (31%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E+  A+
Sbjct: 108 AAKKFESRDRELNQVWNS----LPTSARTALKQEQRVWVTKKEQQCGKLSDAKSEDIPAE 163

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 164 KRISIYKCQLEMTIARTTYLDG 185


>gi|238793600|ref|ZP_04637223.1| hypothetical protein yinte0001_2180 [Yersinia intermedia ATCC
          29909]
 gi|238727015|gb|EEQ18546.1| hypothetical protein yinte0001_2180 [Yersinia intermedia ATCC
          29909]
          Length = 331

 Score = 41.8 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 5/71 (7%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH- 61
          R I+F L  + I+  S A+NC       +   C       + +     Y+ +L K +   
Sbjct: 7  RGILF-LLAMIISSSSFAINCQRAATPVEYTVCGDEDLHWLDQTFSDIYQSMLVKYDTET 65

Query: 62 ---QRELFEKS 69
             QR+++EKS
Sbjct: 66 VYQQRQIWEKS 76


>gi|307729171|ref|YP_003906395.1| hypothetical protein BC1003_1125 [Burkholderia sp. CCGE1003]
 gi|307583706|gb|ADN57104.1| hypothetical protein BC1003_1125 [Burkholderia sp. CCGE1003]
          Length = 212

 Score = 41.8 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 44/116 (37%), Gaps = 18/116 (15%)

Query: 3   RKIIFALTIIA-IAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           R ++ A  +IA  + Q+ + +C++     +   C   + + + + L   Y K   KV   
Sbjct: 5   RPVMLAALLIAHSSAQATSFDCSKGRSLTEKMICNDPALSRLDDTLGQLYWKARRKVS-D 63

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           +R     S   W  +R + C  AA               CL      R ++L+  L
Sbjct: 64  RRAFIADSDSKW-AWREANCRDAA---------------CLGTWYATRIDELQQVL 103


>gi|16763877|ref|NP_459492.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167990488|ref|ZP_02571588.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|16419006|gb|AAL19451.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|205331046|gb|EDZ17810.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261245779|emb|CBG23576.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992217|gb|ACY87102.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157106|emb|CBW16590.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911530|dbj|BAJ35504.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321226076|gb|EFX51127.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323128817|gb|ADX16247.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332987446|gb|AEF06429.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 275

 Score = 41.8 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 25/82 (30%), Gaps = 6/82 (7%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC-AFAASGAEEGTAQ 94
               F     +L   +      +    R   ++ Q  W   +  +C   + + +E   A+
Sbjct: 196 AAKKFESRDRELNQVWNS----LPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAE 251

Query: 95  SMI-YANCLQGHAIERNEKLES 115
             I    C     I R   L+ 
Sbjct: 252 KRISIYKCQLEMTIARTAYLDG 273


>gi|146309132|ref|YP_001189597.1| hypothetical protein Pmen_4118 [Pseudomonas mendocina ymp]
 gi|145577333|gb|ABP86865.1| hypothetical protein Pmen_4118 [Pseudomonas mendocina ymp]
          Length = 122

 Score = 41.8 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 12/54 (22%)

Query: 34 QCTGNSFALVKEKLEATYKKVLEKVEKHQRE------------LFEKSQMAWEI 75
           C    + +  ++L A YKK +++ E  Q              L   +Q AW  
Sbjct: 39 ACVAQRYKVADDQLNAEYKKAIQRTEDEQTALRKHWPNTELVSLLRSTQWAWLK 92


>gi|296315144|ref|ZP_06865085.1| hypothetical protein NEIPOLOT_02324 [Neisseria polysaccharea ATCC
           43768]
 gi|296837950|gb|EFH21888.1| hypothetical protein NEIPOLOT_02324 [Neisseria polysaccharea ATCC
           43768]
          Length = 338

 Score = 41.8 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADGKEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|205353030|ref|YP_002226831.1| hypothetical protein SG1885 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857257|ref|YP_002243908.1| hypothetical protein SEN1813 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|205272811|emb|CAR37737.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206709060|emb|CAR33393.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326628109|gb|EGE34452.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 109

 Score = 41.8 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 38/115 (33%), Gaps = 15/115 (13%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M R +I    +  ++  + + +C +     +   C   +      ++   Y+ +      
Sbjct: 1   MKRLLIAFALLTPLSVDAASFDCQKAQAADEKAICAHLTLNDKNVEMHTKYQFLKGLFAM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
             R   + +Q +W   R  +C                   CL     ER ++L++
Sbjct: 61  GSRGALQDAQQSWLKQR-QQCKAD--------------VTCLTKAYNERLKQLDA 100


>gi|238762380|ref|ZP_04623351.1| hypothetical protein ykris0001_26240 [Yersinia kristensenii ATCC
          33638]
 gi|238699365|gb|EEP92111.1| hypothetical protein ykris0001_26240 [Yersinia kristensenii ATCC
          33638]
          Length = 329

 Score = 41.8 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 28/70 (40%), Gaps = 3/70 (4%)

Query: 6  IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
          +F L ++ I+  S+A+NC       +   C       + +     Y+ +L K +      
Sbjct: 7  VFFLLLMIISSSSLAINCQRAATPVEYTVCGDEDLHWLDQTFSDIYQAMLVKYDTET--- 63

Query: 66 FEKSQMAWEI 75
            + + AWE 
Sbjct: 64 VYQQRQAWEK 73


>gi|313667395|ref|YP_004047679.1| lipoprotein [Neisseria lactamica ST-640]
 gi|313004857|emb|CBN86283.1| putative lipoprotein [Neisseria lactamica 020-06]
          Length = 338

 Score = 41.8 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADGKEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|127514274|ref|YP_001095471.1| hypothetical protein Shew_3346 [Shewanella loihica PV-4]
 gi|126639569|gb|ABO25212.1| conserved hypothetical protein [Shewanella loihica PV-4]
          Length = 227

 Score = 41.8 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 25/78 (32%), Gaps = 9/78 (11%)

Query: 21  LNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
            +C ++ L   ++  C  +  A +  +L   Y+    K    Q  L +  Q  W   R  
Sbjct: 56  FDCGSDKLSSIEVLVCQDSELAALDRQLAEVYQAASAKAVNEQPPLLKAEQRGWIKGRDE 115

Query: 80  --------ECAFAASGAE 89
                    CAF      
Sbjct: 116 CWKSDDKHSCAFDNYQMR 133


>gi|302381119|ref|YP_003816942.1| hypothetical protein Bresu_0003 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302191747|gb|ADK99318.1| Uncharacterized protein putative lipoprotein-like protein
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 323

 Score = 41.8 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 10/62 (16%), Positives = 20/62 (32%), Gaps = 1/62 (1%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C      A+   C     A +   +   Y ++   V+    ++    Q  W   R + 
Sbjct: 243 FDCRRARNSAERTICADPGLADLDVAMARRYARMQNNVDGKAAQILRDEQREWLRRRDA- 301

Query: 81  CA 82
           C 
Sbjct: 302 CE 303


>gi|325123643|gb|ADY83166.1| hypothetical protein BDGL_002580 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 138

 Score = 41.8 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVE----KHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           C+  +  + +EK+ A   ++  + E      + +   KSQ  W+ Y   EC  + +G+  
Sbjct: 56  CSEQAKKIYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQEC--SNAGSYI 113

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
           G+   M Y+ C      ER ++LE Y+ 
Sbjct: 114 GS--PM-YSYCPMQKYAERVKQLEEYVN 138


>gi|265509431|gb|ACY75518.1| hypothetical protein [Pseudomonas aeruginosa]
          Length = 404

 Score = 41.8 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 38/105 (36%), Gaps = 17/105 (16%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + + +C++     +   C     + + E L  +YK  LE V   Q +   +SQ  W   R
Sbjct: 24  AASFDCSKASSFPETEICRDGYLSGLDEWLARSYKTALE-VNPGQSDAVRQSQREWLATR 82

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            + C                   CL      R + L+ Y+T  +G
Sbjct: 83  NA-CTDQ---------------QCLDSTIGARIQALDQYVTAEKG 111


>gi|187940055|gb|ACD39188.1| hypothetical protein PACL_0400 [Pseudomonas aeruginosa]
          Length = 404

 Score = 41.8 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 38/105 (36%), Gaps = 17/105 (16%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + + +C++     +   C     + + E L  +YK  LE V   Q +   +SQ  W   R
Sbjct: 24  AASFDCSKASSFPETEICRDGYLSGLDEWLARSYKAALE-VNPGQSDAVRQSQREWLATR 82

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
            + C                   CL      R + L+ Y+T  +G
Sbjct: 83  NA-CTDQ---------------QCLDSTIGARIQALDQYVTAEKG 111


>gi|144898196|emb|CAM75060.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 340

 Score = 41.8 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 24/77 (31%), Gaps = 10/77 (12%)

Query: 46  KLEATYKKVLEKV-----EKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
           +L   YK+V+                   Q AW  YR +  AF  +       Q++I   
Sbjct: 265 ELNRVYKRVMAHDFGEYGGAPSPAAIRGVQRAWLKYRDAWVAFVKAAGPGLPPQAVINLQ 324

Query: 101 CLQGHAIERNEKLESYL 117
                   R  +L   L
Sbjct: 325 -----TRHRIAQLLELL 336


>gi|288986961|ref|YP_003456924.1| Uncharacterized protein putative lipoprotein-like protein
          [Allochromatium vinosum DSM 180]
 gi|288898340|gb|ADC64174.1| Uncharacterized protein putative lipoprotein-like protein
          [Allochromatium vinosum DSM 180]
          Length = 201

 Score = 41.4 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 29/83 (34%), Gaps = 5/83 (6%)

Query: 4  KIIFALTIIAIAFQSMAL---NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          +I+ A  +      ++A    +C++     +   C       +   L   Y+ V      
Sbjct: 8  RIVLATGLALQMLHTVAQPSFDCSKAATLVENAICQDPELGALDVVLAEQYQAVWRATSG 67

Query: 61 H-QRELFEKSQMAWEIYRGSECA 82
             R+  +KSQ  W   R  +C 
Sbjct: 68 DSARQALKKSQRIWLAKRN-QCQ 89


>gi|114045621|ref|YP_736171.1| hypothetical protein Shewmr7_0108 [Shewanella sp. MR-7]
 gi|113887063|gb|ABI41114.1| conserved hypothetical protein [Shewanella sp. MR-7]
          Length = 206

 Score = 41.4 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 41/115 (35%), Gaps = 17/115 (14%)

Query: 6   IFALTIIAIAFQSM--ALNCNE--TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           IFA+T+   A  +   + +C++       ++  C       + ++L   Y K  EK +  
Sbjct: 17  IFAMTLGTPAMAAEKPSFDCSKVRAGSIEEL-VCQDEGLIKLDQQLAEVYTKATEKAKNE 75

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           Q    +  Q  W   R  EC  +                C++     R  +L++ 
Sbjct: 76  QPPTLKAMQRGWVKGRD-ECWKSEDK-----------RACVESTYQTRIAELQAQ 118


>gi|116748689|ref|YP_845376.1| hypothetical protein Sfum_1249 [Syntrophobacter fumaroxidans MPOB]
 gi|116697753|gb|ABK16941.1| conserved hypothetical protein [Syntrophobacter fumaroxidans MPOB]
          Length = 315

 Score = 41.4 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 40/121 (33%), Gaps = 22/121 (18%)

Query: 1   MCRKI-IFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           M R + I A+ +  +   + A   +C +     +   C+    + + + ++  Y K L  
Sbjct: 1   MKRSVSIMAILVAVLPGAAGAASFDCGKAFTLVEKTVCSDRELSGLDDSMQQAYDKALAV 60

Query: 58  VEKHQRELFEKSQMAWEI-YRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           V         + Q  W    R + C                   CL+    +R  +L S 
Sbjct: 61  VPDPGP--LRREQRQWLKSERDA-CRDVR---------------CLKSRYEKRLGQLNSL 102

Query: 117 L 117
           L
Sbjct: 103 L 103


>gi|157963738|ref|YP_001503772.1| hypothetical protein Spea_3927 [Shewanella pealeana ATCC 700345]
 gi|157848738|gb|ABV89237.1| conserved hypothetical protein [Shewanella pealeana ATCC 700345]
          Length = 214

 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 8/61 (13%), Positives = 23/61 (37%), Gaps = 3/61 (4%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C +   + +   C     A +  ++   Y++ +  +    +   + +Q  W   R  +
Sbjct: 44  FDCAKAQGKVETLICDDAELAKLDREMAQVYQQAMVNIPPSAQP--KATQRGWIKGRN-D 100

Query: 81  C 81
           C
Sbjct: 101 C 101


>gi|152992002|ref|YP_001357723.1| hypothetical protein SUN_0406 [Sulfurovum sp. NBC37-1]
 gi|151423863|dbj|BAF71366.1| hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 263

 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 28/82 (34%), Gaps = 14/82 (17%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTA 93
            C+ +    +  +L   YK+ L K  +   ++ +  Q  W   R  +C  A         
Sbjct: 22  ICSSDELMDIDRELATVYKQALAKASEE--DMLKAHQRGWIKGRN-DCWKAEDEKA---- 74

Query: 94  QSMIYANCLQGHAIERNEKLES 115
                  C+      R ++L+ 
Sbjct: 75  -------CMLDQYQLRIKELKE 89


>gi|109898713|ref|YP_661968.1| hypothetical protein Patl_2398 [Pseudoalteromonas atlantica T6c]
 gi|109700994|gb|ABG40914.1| conserved hypothetical protein [Pseudoalteromonas atlantica T6c]
          Length = 203

 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 41/114 (35%), Gaps = 19/114 (16%)

Query: 4   KIIFALTIIAIAFQSMA--LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE--KVE 59
           K+  A  +  +A  + +   NC       +   C     + + E+L   YK  +   + +
Sbjct: 25  KLGCATILAMMASNAFSASFNCQNAAQTDEKIVCGSVELSTLDEQLSKRYKVAIANNQAQ 84

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             ++   ++SQ  W   R + C F+               +C++    +R   L
Sbjct: 85  PAKKLEIQRSQTQWLSQRKA-CHFS--------------FDCIKRVYRKRISSL 123


>gi|167823197|ref|ZP_02454668.1| hypothetical protein Bpseu9_05938 [Burkholderia pseudomallei 9]
          Length = 103

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 39  DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 85

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 86  IGARVATLKRF 96


>gi|312883787|ref|ZP_07743506.1| hypothetical protein VIBC2010_14339 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368536|gb|EFP96069.1| hypothetical protein VIBC2010_14339 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 126

 Score = 41.4 bits (96), Expect = 0.041,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 43/117 (36%), Gaps = 5/117 (4%)

Query: 3   RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK-- 60
           + II  L  +  +    A  C      +++  C     A  + K++  Y  + E +    
Sbjct: 4   KLIISTLIFLFSSVSVSA--CTNLSSSSELLSCKKEVEATSRAKMQKAYLNLDEYLSGAV 61

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTA-QSMIYANCLQGHAIERNEKLESY 116
             ++  + SQ +W       C   +  AEEG+    +  + C+      R E + S 
Sbjct: 62  DYQKKIKLSQESWAKSATQNCDVYSYFAEEGSIAHDIAISECMASEYKSREEFIISL 118


>gi|307611293|emb|CBX00952.1| hypothetical protein LPW_26541 [Legionella pneumophila 130b]
          Length = 347

 Score = 41.4 bits (96), Expect = 0.042,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 5/49 (10%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQ-----RELFEKSQMAWEIYRGS 79
           T   +  +  +L + YKK++      Q     +E  +K+++AW  YR +
Sbjct: 262 TTKQYEELDRQLNSIYKKLMADTTSFQYTTITKEGIKKTEIAWIKYRDA 310


>gi|110636723|ref|YP_676930.1| hypothetical protein CHU_0299 [Cytophaga hutchinsonii ATCC 33406]
 gi|110279404|gb|ABG57590.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 176

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 9/37 (24%), Positives = 15/37 (40%)

Query: 44  KEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
              +   YK +L   +   ++L   +Q  W  YR  E
Sbjct: 91  DILMNKYYKALLGLHDDEGKKLLTAAQKKWLKYRDEE 127


>gi|73539023|ref|YP_299390.1| hypothetical protein Reut_B5200 [Ralstonia eutropha JMP134]
 gi|72122360|gb|AAZ64546.1| putative Uncharacterized protein conserved in bacteria putative
           lipoprotein [Ralstonia eutropha JMP134]
          Length = 306

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 25/63 (39%), Gaps = 6/63 (9%)

Query: 18  SMALNCNE-TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIY 76
           + + +C++    QA +  C       V +KL   Y++ L+      +      Q AW   
Sbjct: 223 AHSFDCSKLVSTQAQL-ICADAELTRVDKKLAMVYEQKLK--TSANKARLRADQRAWL-- 277

Query: 77  RGS 79
           R S
Sbjct: 278 RDS 280


>gi|326314868|ref|YP_004232540.1| hypothetical protein Acav_0046 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323371704|gb|ADX43973.1| hypothetical protein Acav_0046 [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 134

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 32/105 (30%), Gaps = 12/105 (11%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK---------HQRELFEKSQM 71
             C     QA M  C     +  K+ L       +  + K           +   + S  
Sbjct: 22  EEC-SAHSQAGMRDCLAKKASNSKDDLRQARNNAISILSKWDEDAQYAGRAKAELDASDK 80

Query: 72  AWEIYRGSECAFAASGAEEGTA--QSMIYANCLQGHAIERNEKLE 114
            +E YR + C F AS +  G      +    C+      R  +L 
Sbjct: 81  DFEKYRDAHCKFRASLSGGGAGNSHEIQRLACIAELNTTRARQLR 125


>gi|329118566|ref|ZP_08247270.1| hypothetical protein HMPREF9123_0698 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465301|gb|EGF11582.1| hypothetical protein HMPREF9123_0698 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 113

 Score = 41.4 bits (96), Expect = 0.047,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 44/116 (37%), Gaps = 15/116 (12%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFA--LVKEKLEATYKKVLEKVE 59
            +K +FAL ++A+   + A  C           C+G+         +L A  ++    +E
Sbjct: 1   MKKHLFAL-LLAVCATAQAEVCINV-------ICSGDEERERQAAAELSAELQRSQTLLE 52

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            H+      +Q  WE +   +C +  +   + +        C   H  +R E++  
Sbjct: 53  PHRFAGLVHTQQTWETFVKEDCRYNHTRYVQYSRH-----TCFMKHYRDRLEEIRQ 103


>gi|114764434|ref|ZP_01443660.1| hypothetical protein 1100011001309_R2601_01873 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543188|gb|EAU46206.1| hypothetical protein R2601_01873 [Roseovarius sp. HTCC2601]
          Length = 199

 Score = 41.4 bits (96), Expect = 0.047,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 38/119 (31%), Gaps = 21/119 (17%)

Query: 4   KIIFALTIIAIAFQSM---ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE- 59
            ++  L +  +A  +    A +C +    A+   C     A +  +L   +   +E  E 
Sbjct: 7   PLLACLALSPVAGLAQDGPAFDCAKAESSAEKLICDDADLAALDRRLADRFAAAVEVAEG 66

Query: 60  -----KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
                +   +     Q  W   R  EC   +               C++   ++R  +L
Sbjct: 67  LDVGAEETTDTLRAMQRGWISGRD-ECWKESD-----------LRACVETEYLQREAEL 113


>gi|270487699|ref|ZP_06204773.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|270336203|gb|EFA46980.1| conserved hypothetical protein [Yersinia pestis KIM D27]
          Length = 318

 Score = 41.4 bits (96), Expect = 0.047,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 28/63 (44%), Gaps = 4/63 (6%)

Query: 11 IIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH----QRELF 66
          ++ I+  S+A+NC       +   C+      + +   + Y+ +L K        QR+ +
Sbjct: 1  MMLISTSSLAINCQRASTPVEYTVCSNEDLHWLDQTFNSIYQVLLVKYNTEMVYQQRQTW 60

Query: 67 EKS 69
          EKS
Sbjct: 61 EKS 63


>gi|152983582|ref|YP_001349609.1| hypothetical protein PSPA7_4255 [Pseudomonas aeruginosa PA7]
 gi|150958740|gb|ABR80765.1| hypothetical protein PSPA7_4255 [Pseudomonas aeruginosa PA7]
          Length = 111

 Score = 41.0 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 27/92 (29%), Gaps = 5/92 (5%)

Query: 7   FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELF 66
            A  ++A    + + +C +     +   C   +      ++   Y+ +        R   
Sbjct: 9   LAGILLAPLAHAASFDCEKATRADEKAICANRALNDQDVEMSVKYRFLRGLFAMGGRGAM 68

Query: 67  EKSQMAWEIYR-----GSECAFAASGAEEGTA 93
           +  Q AW   R      + C   A     G  
Sbjct: 69  QDRQQAWLQERRRCGGDTGCLSRAYAQRIGEL 100


>gi|187923022|ref|YP_001894664.1| hypothetical protein Bphyt_1021 [Burkholderia phytofirmans PsJN]
 gi|187714216|gb|ACD15440.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 248

 Score = 41.0 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEG 91
           QC  N+    K  L+  ++++ +K+   QR+ ++KSQ +W+  R +E    A+      G
Sbjct: 71  QCMDNARIGWKTALDNAWQQLQQKLPPAQRKRWDKSQASWQASRDAEKQLLAAVFATTHG 130

Query: 92  TAQSMIYANCLQGHAIERNEKLES 115
           +   +  A+       +R   L S
Sbjct: 131 SMYVLAEADMQLQPVRDRALALRS 154



 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/44 (20%), Positives = 16/44 (36%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
                      L   Y+++  K+  H R    ++Q AW  Y  +
Sbjct: 174 ADAQCEHAMFDLNRYYRRLRSKMPVHTRPTLTRAQKAWTAYLNA 217


>gi|227114362|ref|ZP_03828018.1| hypothetical protein PcarbP_15443 [Pectobacterium carotovorum
          subsp. brasiliensis PBR1692]
          Length = 266

 Score = 41.0 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 12/80 (15%), Positives = 25/80 (31%), Gaps = 6/80 (7%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----EKH 61
           A    +   Q+ + +CN+     +   C       + E+L   +K     +        
Sbjct: 13 VAFAAFSHHAQAASFSCNKADSVQEKLICASPLLGQLDEELAQAWKTSRTFLTAYDNSAP 72

Query: 62 QRELFEKSQMAWEIYRGSEC 81
            +   + Q  W   R  +C
Sbjct: 73 WEKTLNQFQRGWLTTRD-QC 91


>gi|225024048|ref|ZP_03713240.1| hypothetical protein EIKCOROL_00915 [Eikenella corrodens ATCC
           23834]
 gi|224943073|gb|EEG24282.1| hypothetical protein EIKCOROL_00915 [Eikenella corrodens ATCC
           23834]
          Length = 396

 Score = 41.0 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 11/81 (13%), Positives = 27/81 (33%), Gaps = 11/81 (13%)

Query: 39  SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSM-- 96
                 ++L   ++     +    R   + +Q  W   R S+CA+ +      + + +  
Sbjct: 231 QNKQAHDELNKAWQA----LPAAARTQLKDAQNQWNRLRESQCAYQSKAD---STEPLEQ 283

Query: 97  --IYANCLQGHAIERNEKLES 115
             +   C      +R   L+ 
Sbjct: 284 EALRIECDTREVQQRIPALKQ 304


>gi|194737742|ref|YP_002116674.1| hypothetical protein SeSA_A3939 [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|197300668|ref|ZP_02660403.2| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. SL480]
 gi|194713244|gb|ACF92465.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|197291262|gb|EDY30614.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. SL480]
          Length = 277

 Score = 41.0 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 38/85 (44%), Gaps = 6/85 (7%)

Query: 3  RKIIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL-EKVEK 60
          +K +F L+++A +   + + +CN      +   C+ +  + + + L   YK  +   + +
Sbjct: 7  KKSLFILSMMACSTSYAASFDCNTVASGVEKMICSDHKLSRLDDYLSQNYKIAMGPDMPE 66

Query: 61 HQRELFEKSQMAWEIYR----GSEC 81
            +    KSQ+ W   R     ++C
Sbjct: 67 EAKSKIRKSQIDWLNKRNACTDAQC 91


>gi|330446354|ref|ZP_08310006.1| putative uncharacterized protein [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
 gi|328490545|dbj|GAA04503.1| putative uncharacterized protein [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
          Length = 403

 Score = 41.0 bits (95), Expect = 0.059,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 35/83 (42%), Gaps = 6/83 (7%)

Query: 1  MCRKIIFALTIIAIAFQSM------ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKV 54
          M R +     ++A+   ++      A +C+    + D   C      ++ ++L   Y++ 
Sbjct: 1  MKRLVPLLAGVVAMFSPALMAASLDASDCHSPSSELDKLICHDAELVVLNKQLSGVYQQA 60

Query: 55 LEKVEKHQRELFEKSQMAWEIYR 77
          L +    + ++ +++Q  W   R
Sbjct: 61 LTQSMVSEADVMKETQKNWLATR 83


>gi|170733147|ref|YP_001765094.1| hypothetical protein Bcenmc03_1811 [Burkholderia cenocepacia
          MC0-3]
 gi|169816389|gb|ACA90972.1| conserved hypothetical protein [Burkholderia cenocepacia MC0-3]
          Length = 280

 Score = 41.0 bits (95), Expect = 0.061,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 27/69 (39%), Gaps = 1/69 (1%)

Query: 12 IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ-RELFEKSQ 70
          + +A  S A+NC + +   +   C   +      +L A Y   L+       R++  +SQ
Sbjct: 23 VGLALPSFAMNCAKAVQPIEKRICASPALRAADTRLSAAYAGALKAAPDTAIRDMLVRSQ 82

Query: 71 MAWEIYRGS 79
            W   R  
Sbjct: 83 RRWLDARNK 91


>gi|238563405|ref|ZP_00438916.2| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|238520751|gb|EEP84208.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
          Length = 76

 Score = 40.7 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 7/71 (9%), Positives = 20/71 (28%), Gaps = 13/71 (18%)

Query: 46  KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGH 105
            +   Y+K+  ++          +Q  W  +R +                ++  +     
Sbjct: 12  DMNRYYEKLRARMPADSLPTLVAAQREWAAFRDA-------------MTPLVSESERVDL 58

Query: 106 AIERNEKLESY 116
              R   L+ +
Sbjct: 59  IGARVATLKRF 69


>gi|52842644|ref|YP_096443.1| hypothetical protein lpg2435 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629755|gb|AAU28496.1| hypothetical protein lpg2435 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 347

 Score = 40.7 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 5/49 (10%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQ-----RELFEKSQMAWEIYRGS 79
           T   +  +  +L + YKK++      Q     +E  +K+++AW  YR +
Sbjct: 262 TTKQYEELDRQLNSIYKKLMADTTSFQYTTITKEGIKKTEIAWIKYRDA 310


>gi|251773242|gb|EES53792.1| hypothetical protein UBAL3_48660005 [Leptospirillum
           ferrodiazotrophum]
          Length = 318

 Score = 40.7 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 31/98 (31%), Gaps = 13/98 (13%)

Query: 26  TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAA 85
              Q  MN     +  + +++L+       E+  +   +  E  +  W+ +    C  +A
Sbjct: 216 PRTQTTMNLMAIEATKIAQKELDELRGGNKERFNEPNTKE-EDLEYHWDRF----CELSA 270

Query: 86  SGAEE--------GTAQSMIYANCLQGHAIERNEKLES 115
                        GT   +I +   +     R   LE 
Sbjct: 271 QKEAGYLKDSKWHGTIAPLIASRTAERLIRWRISDLEQ 308


>gi|309779123|ref|ZP_07673888.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308922084|gb|EFP67716.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 151

 Score = 40.7 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 24  NETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           ++    AD +  C     A   ++L+ TYK +L  ++    +    S+ AW+ +     A
Sbjct: 52  DKAPDNADAIGACLSAEKAAQTKRLDRTYKTLLGTLDGKANDALVSSEQAWQDFHTRTAA 111

Query: 83  FAASGAEEG 91
           F  +   +G
Sbjct: 112 FETAIYGKG 120


>gi|186471119|ref|YP_001862437.1| lipoprotein [Burkholderia phymatum STM815]
 gi|184197428|gb|ACC75391.1| conserved hypothetical lipoprotein [Burkholderia phymatum STM815]
          Length = 296

 Score = 40.7 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 17/117 (14%), Positives = 34/117 (29%), Gaps = 19/117 (16%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           +C+  +      + A     L+C++ +       C       +   L   Y +  +    
Sbjct: 196 LCKPGLLESRYTSQASPMHGLDCSKLISVQARLICGDEELTRIDRTLAKIYAQ--KMNAS 253

Query: 61  HQRELFEKSQMAWE-IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             +      Q AW    R + C   A               CL     +R ++L+  
Sbjct: 254 SNKSRLRADQRAWIRSSRDA-CDDKA---------------CLLRSYRQRIDELKRM 294


>gi|328675920|gb|AEB28595.1| hypothetical protein FN3523_0738 [Francisella cf. novicida 3523]
          Length = 97

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 45/115 (39%), Gaps = 18/115 (15%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M + I+  L I+     +  + C+    Q  +N C  +   +   KL           + 
Sbjct: 1   MKKHIVMTLAILPTLVLADKV-CDGNTYQ--INACLKSQMQIYDTKLNDV--------QN 49

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
           H  + F+K       YR + C   +S  + GT Q++ Y NC+        ++L+ 
Sbjct: 50  HDIKNFKK-------YRDNLCYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLKP 97


>gi|16127216|ref|NP_421780.1| hypothetical protein CC_2986 [Caulobacter crescentus CB15]
 gi|221236017|ref|YP_002518454.1| hypothetical protein CCNA_03081 [Caulobacter crescentus NA1000]
 gi|13424618|gb|AAK24948.1| hypothetical protein CC_2986 [Caulobacter crescentus CB15]
 gi|220965190|gb|ACL96546.1| hypothetical protein CCNA_03081 [Caulobacter crescentus NA1000]
          Length = 171

 Score = 40.7 bits (94), Expect = 0.071,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 31/88 (35%), Gaps = 7/88 (7%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKS--QMAWEIYRGSECAF--AASGAEE 90
           C          +L   YK  L  + K           Q AW ++R ++     A SG+  
Sbjct: 86  CALVECDFQDRRLNRAYKAALADLAKKPAAKAALIKAQRAWLVFRNADVDAVKALSGSPG 145

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
            +  ++I       H   R ++LE  L 
Sbjct: 146 PSFDALIREL---EHTTRRAQELEDMLK 170


>gi|294670919|ref|ZP_06735775.1| hypothetical protein NEIELOOT_02623 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307406|gb|EFE48649.1| hypothetical protein NEIELOOT_02623 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 302

 Score = 40.7 bits (94), Expect = 0.072,   Method: Composition-based stats.
 Identities = 11/81 (13%), Positives = 27/81 (33%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
             + +     ++   ++     ++   ++     Q  W   + + C  AA+ A+      
Sbjct: 223 AHSDYRAADREINNVWRD----LDSVIQQGLRDEQREWINRKNAACRRAAAQADSPERAE 278

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 279 YLRLQCDSRQTRERIQYLRDY 299


>gi|183982377|ref|YP_001850668.1| lipoprotein, LprL [Mycobacterium marinum M]
 gi|183175703|gb|ACC40813.1| lipoprotein, LprL [Mycobacterium marinum M]
          Length = 211

 Score = 40.7 bits (94), Expect = 0.074,   Method: Composition-based stats.
 Identities = 11/68 (16%), Positives = 24/68 (35%), Gaps = 2/68 (2%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           +  +  L+C           C       +  +L+  Y++ L++     +     +Q  W 
Sbjct: 39  STAAPLLDCTNPEDDTQRLVCNDPQLTELDRRLDTAYQQALDR-PGTDKAALTLAQGHWA 97

Query: 75  IYRGSECA 82
             R  +CA
Sbjct: 98  ETRD-QCA 104


>gi|118617191|ref|YP_905523.1| lipoprotein, LprL [Mycobacterium ulcerans Agy99]
 gi|118569301|gb|ABL04052.1| lipoprotein, LprL [Mycobacterium ulcerans Agy99]
          Length = 211

 Score = 40.7 bits (94), Expect = 0.077,   Method: Composition-based stats.
 Identities = 11/68 (16%), Positives = 24/68 (35%), Gaps = 2/68 (2%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           +  +  L+C           C       +  +L+  Y++ L++     +     +Q  W 
Sbjct: 39  STAAPLLDCTNPEDDTQRLVCNDPQLTELDRRLDTAYQQALDR-PGTDKAALTLAQGHWA 97

Query: 75  IYRGSECA 82
             R  +CA
Sbjct: 98  ETRD-QCA 104


>gi|184159636|ref|YP_001847975.1| hypothetical protein ACICU_03318 [Acinetobacter baumannii ACICU]
 gi|332876121|ref|ZP_08443905.1| hypothetical protein HMPREF0022_03551 [Acinetobacter baumannii
           6014059]
 gi|183211230|gb|ACC58628.1| hypothetical protein ACICU_03318 [Acinetobacter baumannii ACICU]
 gi|322509546|gb|ADX05000.1| Putative uncharacterized protein precursor [Acinetobacter baumannii
           1656-2]
 gi|323519566|gb|ADX93947.1| hypothetical protein ABTW07_3530 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332735739|gb|EGJ66782.1| hypothetical protein HMPREF0022_03551 [Acinetobacter baumannii
           6014059]
          Length = 138

 Score = 40.7 bits (94), Expect = 0.081,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 54/138 (39%), Gaps = 26/138 (18%)

Query: 2   CRKIIFALTIIAI--AFQSMALNCNE---------TLMQAD------MNQCTGNSFALVK 44
           C+ I+ +    +     Q+ A   +E           MQ +      ++ C+  +    +
Sbjct: 6   CKLIVLSSLFGSPWLYAQTEADEQDEYNQCVDQTIKEMQLESINNMVVHSCSEQAKKTYE 65

Query: 45  EKLEATYKKVLEKVE----KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYAN 100
           EK+ A   ++  + E      + +   KSQ  W+ Y   EC    +G+  G+   M Y+ 
Sbjct: 66  EKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQECN--NAGSYIGS--PM-YSY 120

Query: 101 CLQGHAIERNEKLESYLT 118
           C       R ++LE Y+ 
Sbjct: 121 CPMQEYAARVKQLEEYVN 138


>gi|229031506|ref|ZP_04187506.1| hypothetical protein bcere0028_35600 [Bacillus cereus AH1271]
 gi|228729795|gb|EEL80775.1| hypothetical protein bcere0028_35600 [Bacillus cereus AH1271]
          Length = 272

 Score = 40.3 bits (93), Expect = 0.081,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 27/74 (36%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+    A+    GT + +  A
Sbjct: 193 YQLWDNKLNELYSTLKNTMSADAFQSLKTKQVAWIKEKESKVKAIATDENNGTMKYIEAA 252

Query: 100 NCLQGHAIERNEKL 113
           +        R  +L
Sbjct: 253 DEKYKMTKARCYEL 266


>gi|238750878|ref|ZP_04612375.1| hypothetical protein yrohd0001_16300 [Yersinia rohdei ATCC 43380]
 gi|238710792|gb|EEQ03013.1| hypothetical protein yrohd0001_16300 [Yersinia rohdei ATCC 43380]
          Length = 329

 Score = 40.3 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 3  RKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
          R I+F L ++ I+  S A+NC       +   C       + +     Y+ +L K +   
Sbjct: 5  RGILF-LLMMIISSSSFAINCQRATTPVEYTVCGNEDLHWLDQTFSGIYQAMLVKYDTET 63


>gi|54295271|ref|YP_127686.1| hypothetical protein lpl2356 [Legionella pneumophila str. Lens]
 gi|53755103|emb|CAH16596.1| hypothetical protein lpl2356 [Legionella pneumophila str. Lens]
          Length = 347

 Score = 40.3 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 5/49 (10%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQ-----RELFEKSQMAWEIYRGS 79
           T   +  +  +L + YKK++      Q     +E  +K+++AW  YR +
Sbjct: 262 TTKQYEELDRQLNSIYKKLMVDTTSFQYTTITKEGIKKTEIAWIKYRDA 310


>gi|315636877|ref|ZP_07892101.1| hypothetical protein HMPREF9401_1512 [Arcobacter butzleri JV22]
 gi|315478707|gb|EFU69416.1| hypothetical protein HMPREF9401_1512 [Arcobacter butzleri JV22]
          Length = 236

 Score = 40.3 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 44/122 (36%), Gaps = 20/122 (16%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQA-DMNQCTGNSFALVKEKLEATYKKVLEKVE 59
           + +  IF   +IA    S + +C+    +  + + C   + +L+   L   YK+  E   
Sbjct: 6   LIKLFIFFNILIANEQFSPSFDCSNVKKETVESHICDNENLSLLDNTLAELYKQAYEL-- 63

Query: 60  KHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTC 119
            +     ++SQ  W   R   C                   C+Q   +ER + L + L  
Sbjct: 64  -NLNNNLKQSQKKWLKKRD-NCK---------------TIGCIQKSYLERVDYLGNLLVK 106

Query: 120 PE 121
            +
Sbjct: 107 ED 108


>gi|237750278|ref|ZP_04580758.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229374172|gb|EEO24563.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 231

 Score = 40.3 bits (93), Expect = 0.096,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 30/98 (30%), Gaps = 24/98 (24%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQR-----------------ELFEKSQMAWEIYRGSECA 82
           +    + L   YK    +V+K  +                 +   + Q AW   R S  A
Sbjct: 107 YDEYDKLLNKYYKLYRAEVKKQNKTTPTGAFSHEPSIQKGQDTLLEEQRAWLKLRDSYEA 166

Query: 83  FAASGAE-------EGTAQSMIYANCLQGHAIERNEKL 113
           +  +           GT  S+  +N   G    R  +L
Sbjct: 167 YTKAHHAHIYDINGGGTIYSIEASNARLGLLKMRVNEL 204


>gi|291563230|emb|CBL42046.1| Protein of unknown function (DUF1311) [butyrate-producing bacterium
           SS3/4]
          Length = 293

 Score = 40.3 bits (93), Expect = 0.097,   Method: Composition-based stats.
 Identities = 13/101 (12%), Positives = 38/101 (37%), Gaps = 2/101 (1%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALV--KEKLEATYKKVLEKVEKHQRELFEKSQMA 72
           A ++ A    +    +  ++     +       +L   Y  + +++++   E   + ++ 
Sbjct: 180 AVRTEAEKYQDDQTMSQTSRYATAEYVRNLWDRELNLIYSSIHKEMDESAAEALRREEVE 239

Query: 73  WEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
           W   R      A++ +    +QS+ Y        ++R  +L
Sbjct: 240 WIRKRDLAADKASAKSNSTPSQSIEYVRTSASVTMDRCYEL 280


>gi|56414348|ref|YP_151423.1| hypothetical protein SPA2225 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197363268|ref|YP_002142905.1| hypothetical protein SSPA2068 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56128605|gb|AAV78111.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094745|emb|CAR60278.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 259

 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 7/46 (15%), Positives = 14/46 (30%), Gaps = 4/46 (8%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
               F     +L   +K     +    R   ++ Q  W   +  +C
Sbjct: 196 AAKKFESRDRELNQVWKS----LPASARTALKQEQRVWVTKKEQQC 237


>gi|187478054|ref|YP_786078.1| hypothetical protein BAV1554 [Bordetella avium 197N]
 gi|115422640|emb|CAJ49166.1| putative exported protein [Bordetella avium 197N]
          Length = 146

 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 40/122 (32%), Gaps = 14/122 (11%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQ--CTGNSFALVKEKLEATYKKVLEKVEKHQR 63
           + A  +   +  ++A +C+  L +       C   +    K  L+A Y  +  K+   + 
Sbjct: 11  LTAAVLCLASQPALADDCDAPLSEESHQALVCVQTALDRQKSALQARYDALRSKLPGEEA 70

Query: 64  ELFEKSQMAWEIYRGSECAFAASGAEE---------GTAQSMIYANCLQGHAIERNEKLE 114
              ++ Q +W  +  ++C      A           G         C       R E+L 
Sbjct: 71  SKLDRDQASWASFVEADCEVFTDMAGGENDTWRQTWGEI---ALNACRVEMMSAREERLG 127

Query: 115 SY 116
            Y
Sbjct: 128 QY 129


>gi|293610786|ref|ZP_06693086.1| predicted protein [Acinetobacter sp. SH024]
 gi|292827130|gb|EFF85495.1| predicted protein [Acinetobacter sp. SH024]
          Length = 138

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVE----KHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           C+  +    +EK+ A   ++  + E      + +   KSQ  W+ Y   EC    +G+  
Sbjct: 56  CSEQAKKTYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQECN--NAGSYI 113

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
           G+   M Y+ C      ER ++LE Y+ 
Sbjct: 114 GS--PM-YSYCPMQEYAERVKQLEEYVN 138


>gi|296164418|ref|ZP_06846992.1| lipoprotein, LprL [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295900200|gb|EFG79632.1| lipoprotein, LprL [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 211

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 15/113 (13%), Positives = 29/113 (25%), Gaps = 21/113 (18%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG-- 78
           L+C +    A    C       +  +L+A Y++ L +    Q      +Q  W   R   
Sbjct: 45  LDCGKPANAAQQLVCGEPHLTDLDHRLQAAYQQALARPGADQ-AALTAAQNTWAAARDGC 103

Query: 79  ------SECAFAASGAE---------EGTAQSMIYANCLQG---HAIERNEKL 113
                   C   A                +  ++   C         +   + 
Sbjct: 104 AQNPQPGTCLAEAYQTRLVELAIADPGTLSPPLVTYQCPADAGPLTAQFYNEF 156


>gi|296504371|ref|YP_003666071.1| hypothetical protein BMB171_C3541 [Bacillus thuringiensis BMB171]
 gi|296325423|gb|ADH08351.1| hypothetical protein BMB171_C3541 [Bacillus thuringiensis BMB171]
          Length = 378

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 299 YELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 358

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 359 EEKYKMTKARCYEL 372


>gi|46093562|dbj|BAD14976.1| hypothetical protein [Escherichia coli]
          Length = 148

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 3  RKIIFALTIIAIAFQ-SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL-EKVEK 60
          +K +F L+++A +   + + +CN      +   C+ +  + + + L   YK  +   + +
Sbjct: 7  KKSLFILSMMACSTSYAASFDCNTVASGVEKMICSDHKLSRLDDYLSQNYKIAMGPDMPE 66

Query: 61 HQRELFEKSQMAWEIYRGS 79
           ++   +K+Q+ W   R +
Sbjct: 67 EEKSKIKKAQIDWLNKRNA 85


>gi|295095862|emb|CBK84952.1| Protein of unknown function (DUF1311) [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 280

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 25/82 (30%), Gaps = 10/82 (12%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
              +++    +L   +K     +    +   +K Q  W   +  +C   +  +   T   
Sbjct: 197 AARNYSDSDRQLNELWK----YLPDSVKASMKKEQNMWINEKAKKCGKISDASSATT--P 250

Query: 96  MI----YANCLQGHAIERNEKL 113
           +       +C      ER   L
Sbjct: 251 LATRIGIYDCQTKMTDERFRYL 272


>gi|228960092|ref|ZP_04121756.1| hypothetical protein bthur0005_35630 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228799608|gb|EEM46561.1| hypothetical protein bthur0005_35630 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 393

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|228973893|ref|ZP_04134468.1| hypothetical protein bthur0003_36480 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228980483|ref|ZP_04140793.1| hypothetical protein bthur0002_36510 [Bacillus thuringiensis Bt407]
 gi|228779303|gb|EEM27560.1| hypothetical protein bthur0002_36510 [Bacillus thuringiensis Bt407]
 gi|228785759|gb|EEM33763.1| hypothetical protein bthur0003_36480 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|326941645|gb|AEA17541.1| hypothetical protein CT43_CH3876 [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 393

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|187926083|ref|YP_001892428.1| conserved hypothetical protein [Ralstonia pickettii 12J]
 gi|241665571|ref|YP_002983930.1| hypothetical protein Rpic12D_4005 [Ralstonia pickettii 12D]
 gi|187727837|gb|ACD29001.1| conserved hypothetical protein [Ralstonia pickettii 12J]
 gi|240867598|gb|ACS65258.1| protein of unknown function DUF1311 [Ralstonia pickettii 12D]
          Length = 151

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 24  NETLMQAD-MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECA 82
           ++    AD +  C     A   E+L+ TYK +L  +     +    S+ AW+ +     A
Sbjct: 52  DKAPDNADAIGACLSAEKAAQNERLDRTYKTLLGTLNSKANDALVSSEQAWQDFHTRTAA 111

Query: 83  FAASGAEEG 91
           F  +   +G
Sbjct: 112 FETAIYGKG 120


>gi|262280262|ref|ZP_06058046.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258040|gb|EEY76774.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 138

 Score = 39.9 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVEKHQREL----FEKSQMAWEIYRGSECAFAASGAEE 90
           C+  +    +EK+ A   ++  + E++++        KSQ  W+ Y   EC  + +G+  
Sbjct: 56  CSEQAKKTYEEKIVALIDQIRTQSEEYKQPQRYQDILKSQRLWKAYVDQEC--SNAGSYI 113

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
           G+   M Y+ C       R ++LE Y+ 
Sbjct: 114 GS--PM-YSYCPMQEYAARVKQLEEYIN 138


>gi|289661662|ref|ZP_06483243.1| hypothetical protein XcampvN_00830 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 392

 Score = 39.9 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 34/97 (35%), Gaps = 12/97 (12%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C +     +   C   + A + ++L+  Y++VLE   +         Q  W   R + 
Sbjct: 28  FDCKQVSTPVEKRLCAVPALANLDDQLDEAYRRVLEATPRASIAAVRDQQRTWLRQRNA- 86

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           CA  A              +CLQ     R + L   L
Sbjct: 87  CAQDAK-----------LDDCLQRSLKARVDVLGKAL 112


>gi|229146447|ref|ZP_04274818.1| hypothetical protein bcere0012_35900 [Bacillus cereus BDRD-ST24]
 gi|228637080|gb|EEK93539.1| hypothetical protein bcere0012_35900 [Bacillus cereus BDRD-ST24]
          Length = 393

 Score = 39.9 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|30021963|ref|NP_833594.1| hypothetical protein BC3874 [Bacillus cereus ATCC 14579]
 gi|229129152|ref|ZP_04258125.1| hypothetical protein bcere0015_35970 [Bacillus cereus BDRD-Cer4]
 gi|29897519|gb|AAP10795.1| hypothetical protein BC_3874 [Bacillus cereus ATCC 14579]
 gi|228654389|gb|EEL10254.1| hypothetical protein bcere0015_35970 [Bacillus cereus BDRD-Cer4]
          Length = 393

 Score = 39.9 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKSTMSPDAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|294651681|ref|ZP_06728983.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292822400|gb|EFF81301.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 138

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVEKHQREL----FEKSQMAWEIYRGSECAFAASGAEE 90
           C+  +    +EK+     ++  + E++++        KSQ  W+ Y   EC    +G   
Sbjct: 56  CSDKAKKAYEEKIVVLIDQIRAQSEEYKQPKRYQDILKSQRLWKAYVEQECH--NAGEYI 113

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
           G+   M Y+ C      ER ++LE Y+ 
Sbjct: 114 GS--PM-YSYCPMQKYAERVKQLEEYIH 138


>gi|299768630|ref|YP_003730656.1| hypothetical protein AOLE_01900 [Acinetobacter sp. DR1]
 gi|298698718|gb|ADI89283.1| hypothetical protein AOLE_01900 [Acinetobacter sp. DR1]
          Length = 138

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVE----KHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           C+  +    +EK+ A   ++  + E      + +   KSQ  W+ Y   EC  + +G+  
Sbjct: 56  CSEQAKKTYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQEC--SNAGSYI 113

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
           G+   M Y+ C       R ++LE Y+ 
Sbjct: 114 GS--PM-YSYCPMQEYAARVKQLEEYVN 138


>gi|172065126|ref|YP_001815838.1| hypothetical protein BamMC406_5844 [Burkholderia ambifaria
          MC40-6]
 gi|171997368|gb|ACB68285.1| conserved hypothetical protein [Burkholderia ambifaria MC40-6]
          Length = 341

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 10/75 (13%), Positives = 25/75 (33%), Gaps = 3/75 (4%)

Query: 5  IIFALTIIAI-AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR 63
          +I A+ +IA  A  +   +C +     +   C   + + +  +            +    
Sbjct: 15 MILAVLMIAPMAAHAAGFDCTKAASPTEKAICADPALSSLDGQ--LAAAWKKALAKGGDT 72

Query: 64 ELFEKSQMAWEIYRG 78
             + +Q+ W   R 
Sbjct: 73 AALKAAQLQWLKQRD 87


>gi|228909702|ref|ZP_04073525.1| hypothetical protein bthur0013_38540 [Bacillus thuringiensis IBL
           200]
 gi|228849991|gb|EEM94822.1| hypothetical protein bthur0013_38540 [Bacillus thuringiensis IBL
           200]
          Length = 393

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YQLWDNKLNEIYSTLRSTMSVDAFQSLKTKQIAWVKEKESKVKVIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|239503273|ref|ZP_04662583.1| hypothetical protein AbauAB_13263 [Acinetobacter baumannii AB900]
          Length = 138

 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 9/88 (10%)

Query: 35  CTGNSFALVKEKLEATYKKVLEKVE----KHQRELFEKSQMAWEIYRGSECAFAASGAEE 90
           C+  +    +EK+ A   ++  + E      + +   KSQ  W+ Y   EC    +G+  
Sbjct: 56  CSEQAKKTYEEKIVALIDQIRTQSEEYKQPERYQDILKSQRLWKAYVDQECN--NAGSYI 113

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLT 118
           G+   M Y+ C       R ++LE Y+ 
Sbjct: 114 GS--PM-YSYCPMQEYAARVKQLEEYVN 138


>gi|163733878|ref|ZP_02141320.1| hypothetical protein RLO149_06183 [Roseobacter litoralis Och 149]
 gi|161392989|gb|EDQ17316.1| hypothetical protein RLO149_06183 [Roseobacter litoralis Och 149]
          Length = 203

 Score = 39.5 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 12/83 (14%), Positives = 28/83 (33%), Gaps = 7/83 (8%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------ 58
          +  A T ++      + +C +   Q +   C   + A++  ++   Y   L+        
Sbjct: 10 LTLAATCVSAETTGPSFDCAKAGSQTEDLICNDTALAVLDRRMALRYAAALKAAGNIQGG 69

Query: 59 EKHQRELFEKSQMAWEIYRGSEC 81
           ++        Q  W   R  +C
Sbjct: 70 TENALNTLRAMQRGWIKGRD-DC 91


>gi|119386343|ref|YP_917398.1| hypothetical protein Pden_3635 [Paracoccus denitrificans PD1222]
 gi|119376938|gb|ABL71702.1| protein of unknown function DUF1311 [Paracoccus denitrificans
           PD1222]
          Length = 154

 Score = 39.5 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 30/87 (34%), Gaps = 7/87 (8%)

Query: 32  MNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEG 91
           M  C   S    + KL A Y+  LE      +E   + + +W  +R   C    +    G
Sbjct: 73  MANCLDASHQAWEVKLTAVYQAALE--GGEAQETLRRVERSWIDFREILC--ERARETGG 128

Query: 92  TAQSMIYANCLQGHAIERNEKLESYLT 118
               + +  C++     +   L S   
Sbjct: 129 D---LAHGRCIRDETARQAALLTSLAE 152


>gi|300703272|ref|YP_003744874.1| hypothetical protein RCFBP_10940 [Ralstonia solanacearum CFBP2957]
 gi|299070935|emb|CBJ42241.1| conserved membrane protein of unknown function [Ralstonia
           solanacearum CFBP2957]
          Length = 566

 Score = 39.5 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 25/73 (34%), Gaps = 2/73 (2%)

Query: 9   LTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEK 68
           +T      Q  + +C +    A+   C+    A    +L A Y K            F++
Sbjct: 467 ITAPPAPSQQASFDCTKARSDAEHIICSDPELAAADVQLAAIYTKAKAAATDPIG--FKE 524

Query: 69  SQMAWEIYRGSEC 81
              A   YR  +C
Sbjct: 525 RTRAQWNYRERQC 537


>gi|70730382|ref|YP_260123.1| hypothetical protein PFL_3017 [Pseudomonas fluorescens Pf-5]
 gi|68344681|gb|AAY92287.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 199

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 35/110 (31%), Gaps = 14/110 (12%)

Query: 7   FALTIIAIAFQSMALNCNETLM-QADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
              T +A A Q  + NC+E +        C     A +  KL   Y+  L+     +  +
Sbjct: 17  LLATSLATAEQGPSFNCSEKMTGSITALICQNPGLAALDRKLATIYRDALKNA-GKRGNV 75

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLES 115
            +  Q  W   R  EC                   C+      R  +L++
Sbjct: 76  LKAEQRGWIKGRD-ECWKIDDQQA-----------CVADSYRRRIVELQT 113


>gi|47569503|ref|ZP_00240183.1| conserved hypothetical protein protein [Bacillus cereus G9241]
 gi|47553832|gb|EAL12203.1| conserved hypothetical protein protein [Bacillus cereus G9241]
          Length = 393

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 31/99 (31%), Gaps = 3/99 (3%)

Query: 18  SMALNCNETLMQADMNQCTGN---SFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWE 74
           +   N       A  N        ++ L   KL   Y  +   +     +  +  Q+AW 
Sbjct: 289 AALENQETHANVASDNDIVNEIEGNYELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWV 348

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             + S+     +    GT + +  +        ER  +L
Sbjct: 349 KEKESKVKAIGTDTNNGTMRRIDASEEKYKMTKERCYEL 387


>gi|34497629|ref|NP_901844.1| hypothetical protein CV_2174 [Chromobacterium violaceum ATCC 12472]
 gi|34103485|gb|AAQ59847.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 128

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 42/127 (33%), Gaps = 14/127 (11%)

Query: 2   CRKIIFALTIIAIAFQSMALNCNETLMQAD---MNQCTGNSFALVKEKLEATYKKVLEKV 58
            R ++  + + A A+     +C  T  QAD   +  C     A    +L A   K L+ +
Sbjct: 3   LRPLLIGVLLAAPAWSGALEDC--TRSQADTPAIAACLQQRHAEAGRQLAAQEDKALDAM 60

Query: 59  EK---------HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIER 109
            K         H      +S+ A+  YR   C +  +    G         C      +R
Sbjct: 61  RKLDGATDGRFHAARELRRSRQAYRDYRRQHCDWVEASYASGNGAGRARLACEIDLDTQR 120

Query: 110 NEKLESY 116
              L  +
Sbjct: 121 LADLAGH 127


>gi|226328197|ref|ZP_03803715.1| hypothetical protein PROPEN_02089 [Proteus penneri ATCC 35198]
 gi|225202930|gb|EEG85284.1| hypothetical protein PROPEN_02089 [Proteus penneri ATCC 35198]
          Length = 115

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 29/87 (33%), Gaps = 7/87 (8%)

Query: 34  QCTGNSFALVKEKLEATYKKVLEKVEKHQR-------ELFEKSQMAWEIYRGSECAFAAS 86
            C  +   L ++++   Y K    +E           +    SQ  +  +R +EC   ++
Sbjct: 26  ACLLDELKLAEQQMNVIYDKSKSDLEDTDSIAAKSAIDALASSQQHFIQFRSAECQRQSA 85

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKL 113
               GT    +   C       R + L
Sbjct: 86  LLMGGTGAGDVLLACEIKLNQWRAKVL 112


>gi|228922630|ref|ZP_04085930.1| hypothetical protein bthur0011_36150 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228837059|gb|EEM82400.1| hypothetical protein bthur0011_36150 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 393

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKSMMSADAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|170023396|ref|YP_001719901.1| hypothetical protein YPK_1150 [Yersinia pseudotuberculosis YPIII]
 gi|169749930|gb|ACA67448.1| conserved hypothetical protein [Yersinia pseudotuberculosis
          YPIII]
          Length = 122

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 11/71 (15%), Positives = 25/71 (35%), Gaps = 1/71 (1%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +I +   +A+   + + +C+      + + CT    + + + L + Y K        Q  
Sbjct: 9  LIISTFFLAVPGYAASFDCDNAKGYVETSICTNPVLSKLDDTLLSVYAKAQA-AAPDQEI 67

Query: 65 LFEKSQMAWEI 75
               Q  W  
Sbjct: 68 NIRNEQREWLK 78


>gi|229197987|ref|ZP_04324701.1| hypothetical protein bcere0001_35220 [Bacillus cereus m1293]
 gi|228585466|gb|EEK43570.1| hypothetical protein bcere0001_35220 [Bacillus cereus m1293]
          Length = 393

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 26/74 (35%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIDAS 373

Query: 100 NCLQGHAIERNEKL 113
                   ER  +L
Sbjct: 374 EEKYKMTKERCYEL 387


>gi|229157453|ref|ZP_04285530.1| hypothetical protein bcere0010_36350 [Bacillus cereus ATCC 4342]
 gi|228625903|gb|EEK82653.1| hypothetical protein bcere0010_36350 [Bacillus cereus ATCC 4342]
          Length = 393

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 26/74 (35%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIDAS 373

Query: 100 NCLQGHAIERNEKL 113
                   ER  +L
Sbjct: 374 EEKYKMTKERCYEL 387


>gi|238025236|ref|YP_002909468.1| hypothetical protein bglu_2g19080 [Burkholderia glumae BGR1]
 gi|237879901|gb|ACR32233.1| Hypothetical protein bglu_2g19080 [Burkholderia glumae BGR1]
          Length = 352

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 17/59 (28%), Gaps = 6/59 (10%)

Query: 21 LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           +C +     +   C     +   + L   Y +V           +   Q AW   R +
Sbjct: 36 FDCTKAATPTEKRICADPRLSKQDDTLHQLYARV------SGSPAWRDDQRAWRATRDA 88


>gi|114569292|ref|YP_755972.1| hypothetical protein Mmar10_0741 [Maricaulis maris MCS10]
 gi|114339754|gb|ABI65034.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 132

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 24/62 (38%), Gaps = 11/62 (17%)

Query: 61  HQRELFEKSQMAWEIYRGSECA------FAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             R  F+ +Q AW  YR +EC+      F ++ + E      I  +C       R  +L 
Sbjct: 76  GARAAFDTAQSAWLTYRDAECSRRAATMFLSADSREE-----ITLDCQISLTRSRAHELA 130

Query: 115 SY 116
             
Sbjct: 131 EL 132


>gi|228987020|ref|ZP_04147145.1| hypothetical protein bthur0001_36940 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228772614|gb|EEM21055.1| hypothetical protein bthur0001_36940 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 393

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 26/74 (35%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKNTMSPDAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIDAS 373

Query: 100 NCLQGHAIERNEKL 113
                   ER  +L
Sbjct: 374 EEKYKMTKERCYEL 387


>gi|171322079|ref|ZP_02910948.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
 gi|171092607|gb|EDT37914.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
          Length = 341

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 24/74 (32%), Gaps = 2/74 (2%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          I+  LTI  +A Q+   +C +     +   C     + +  +            +     
Sbjct: 16 ILAVLTISPMAAQAAGFDCTKAASPTEKAICADPGLSSLDGQ--LAAAWKKALAKGGDTA 73

Query: 65 LFEKSQMAWEIYRG 78
            + +Q+ W   R 
Sbjct: 74 ALKAAQLQWLKQRD 87


>gi|229071375|ref|ZP_04204597.1| hypothetical protein bcere0025_35470 [Bacillus cereus F65185]
 gi|228711666|gb|EEL63619.1| hypothetical protein bcere0025_35470 [Bacillus cereus F65185]
          Length = 393

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKSTMSADAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|229192046|ref|ZP_04319015.1| hypothetical protein bcere0002_37020 [Bacillus cereus ATCC 10876]
 gi|228591372|gb|EEK49222.1| hypothetical protein bcere0002_37020 [Bacillus cereus ATCC 10876]
          Length = 393

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKSTMSADAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|22125156|ref|NP_668579.1| hypothetical protein y1256 [Yersinia pestis KIM 10]
 gi|45442269|ref|NP_993808.1| hypothetical protein YP_2486 [Yersinia pestis biovar Microtus
          str. 91001]
 gi|51597241|ref|YP_071432.1| hypothetical protein YPTB2925 [Yersinia pseudotuberculosis IP
          32953]
 gi|108808406|ref|YP_652322.1| hypothetical protein YPA_2412 [Yersinia pestis Antiqua]
 gi|108811332|ref|YP_647099.1| hypothetical protein YPN_1169 [Yersinia pestis Nepal516]
 gi|145598873|ref|YP_001162949.1| hypothetical protein YPDSF_1591 [Yersinia pestis Pestoides F]
 gi|149365425|ref|ZP_01887460.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|165939915|ref|ZP_02228453.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|167469450|ref|ZP_02334154.1| hypothetical protein YpesF_16539 [Yersinia pestis FV-1]
 gi|186896343|ref|YP_001873455.1| hypothetical protein YPTS_3041 [Yersinia pseudotuberculosis
          PB1/+]
 gi|218929757|ref|YP_002347632.1| hypothetical protein YPO2684 [Yersinia pestis CO92]
 gi|229838241|ref|ZP_04458400.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          PEXU2]
 gi|229895564|ref|ZP_04510735.1| putative exported protein [Yersinia pestis Pestoides A]
 gi|229898806|ref|ZP_04513951.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          India 195]
 gi|229901580|ref|ZP_04516702.1| putative exported protein [Yersinia pestis Nepal516]
 gi|21958017|gb|AAM84830.1|AE013728_10 hypothetical [Yersinia pestis KIM 10]
 gi|45437133|gb|AAS62685.1| putative exported protein [Yersinia pestis biovar Microtus str.
          91001]
 gi|51590523|emb|CAH22163.1| putative exported protein [Yersinia pseudotuberculosis IP 32953]
 gi|108774980|gb|ABG17499.1| hypothetical protein YPN_1169 [Yersinia pestis Nepal516]
 gi|108780319|gb|ABG14377.1| hypothetical protein YPA_2412 [Yersinia pestis Antiqua]
 gi|115348368|emb|CAL21303.1| putative exported protein [Yersinia pestis CO92]
 gi|145210569|gb|ABP39976.1| hypothetical protein YPDSF_1591 [Yersinia pestis Pestoides F]
 gi|149291838|gb|EDM41912.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|165912134|gb|EDR30773.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|186699369|gb|ACC89998.1| conserved hypothetical protein [Yersinia pseudotuberculosis
          PB1/+]
 gi|229681509|gb|EEO77603.1| putative exported protein [Yersinia pestis Nepal516]
 gi|229688354|gb|EEO80425.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          India 195]
 gi|229694607|gb|EEO84654.1| putative exported protein [Yersinia pestis biovar Orientalis str.
          PEXU2]
 gi|229701370|gb|EEO89398.1| putative exported protein [Yersinia pestis Pestoides A]
 gi|320016109|gb|ADV99680.1| putative exported protein [Yersinia pestis biovar Medievalis str.
          Harbin 35]
          Length = 122

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 11/71 (15%), Positives = 25/71 (35%), Gaps = 1/71 (1%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE 64
          +I +   +A+   + + +C+      + + CT    + + + L + Y K        Q  
Sbjct: 9  LIISTFFLAVPGYAASFDCDNAKGYVETSICTNPVLSKLDDTLLSVYAKAQA-AAPDQEI 67

Query: 65 LFEKSQMAWEI 75
               Q  W  
Sbjct: 68 NIRNEQREWLK 78


>gi|257093166|ref|YP_003166807.1| hypothetical protein CAP2UW1_1563 [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
 gi|257045690|gb|ACV34878.1| protein of unknown function DUF1311 [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
          Length = 213

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 34/89 (38%), Gaps = 9/89 (10%)

Query: 1  MCRK-------IIFALTI-IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYK 52
          M ++       I  AL + +A+  Q    NC +   + +   C+  S A +  KL+  YK
Sbjct: 1  MKKRVPVVPSFIACALGLPMAVLAQGPTFNCAKATGEVETLICSDASLAALDRKLDEAYK 60

Query: 53 KVLEKVEKHQRELFEKSQMAWEIYRGSEC 81
              K +        + Q  W   R  +C
Sbjct: 61 AAAAKAKGKLATRLREEQRGWVKGRN-DC 88


>gi|229180152|ref|ZP_04307496.1| hypothetical protein bcere0005_34980 [Bacillus cereus 172560W]
 gi|228603361|gb|EEK60838.1| hypothetical protein bcere0005_34980 [Bacillus cereus 172560W]
          Length = 393

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 314 YELWDNKLNEIYSTLKSTMSADAFQSLKTKQIAWVKEKESKVKAIGTDTNNGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                    R  +L
Sbjct: 374 EEKYKMTKARCYEL 387


>gi|229061479|ref|ZP_04198824.1| hypothetical protein bcere0026_35650 [Bacillus cereus AH603]
 gi|228717902|gb|EEL69550.1| hypothetical protein bcere0026_35650 [Bacillus cereus AH603]
          Length = 393

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 26/74 (35%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   +  +     +   +GT + +  +
Sbjct: 314 YQLWDNKLNEIYSTLKNTMSADAFQSLKTKQIAWVKEKERKVTAIGTDPNKGTMRRIEAS 373

Query: 100 NCLQGHAIERNEKL 113
                   ER  +L
Sbjct: 374 EEKYKMTKERCYEL 387


>gi|295698850|ref|YP_003606743.1| hypothetical protein BC1002_3187 [Burkholderia sp. CCGE1002]
 gi|295438063|gb|ADG17232.1| hypothetical protein BC1002_3187 [Burkholderia sp. CCGE1002]
          Length = 132

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 39/96 (40%), Gaps = 15/96 (15%)

Query: 40  FALVKEKLEA----TYKKVLEKVEKH--QRELFEK---SQMAWEIY----RGSECAFAAS 86
           ++ +++KL A     YKK+   + K     +L ++   +Q A   Y    R +   +   
Sbjct: 38  YSELQKKLVADSQILYKKLRATIPKGNIHAKLLDEYMATQNASVKYCELPRNAGAEWET- 96

Query: 87  GAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEG 122
               G+    + A C+      +NE L+  L   +G
Sbjct: 97  -EHGGSMFPALQAECIYNLRKTQNEFLKGLLDMADG 131


>gi|84501005|ref|ZP_00999240.1| hypothetical protein OB2597_02682 [Oceanicola batsensis HTCC2597]
 gi|84391072|gb|EAQ03490.1| hypothetical protein OB2597_02682 [Oceanicola batsensis HTCC2597]
          Length = 202

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 27/73 (36%), Gaps = 7/73 (9%)

Query: 15 AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE---KVEKHQREL---FEK 68
          A +  A +C +    A+   C   + A +  +L   +   L     ++   +E+      
Sbjct: 21 AQEGPAFDCAKAESSAEKLVCDDPALAALDRRLADRFAAALSVTRGLDTGAKEVEDNLRA 80

Query: 69 SQMAWEIYRGSEC 81
          +Q  W   R  EC
Sbjct: 81 TQRGWIKGRD-EC 92


>gi|50123143|ref|YP_052310.1| hypothetical protein ECA4223 [Pectobacterium atrosepticum
          SCRI1043]
 gi|49613669|emb|CAG77120.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 266

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 9/77 (11%), Positives = 22/77 (28%), Gaps = 5/77 (6%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----EKH 61
            L  +    Q+ +  C +     +   C       + ++L   +K     +        
Sbjct: 13 VTLASLCHPAQAASFPCEKAASVQEKLICASPLLGQLDKELAQAWKTSRTFLTAYDNSAP 72

Query: 62 QRELFEKSQMAWEIYRG 78
            +   + Q +W   R 
Sbjct: 73 WEKTLNQFQRSWLTTRD 89


>gi|229134684|ref|ZP_04263493.1| hypothetical protein bcere0014_35930 [Bacillus cereus BDRD-ST196]
 gi|228648730|gb|EEL04756.1| hypothetical protein bcere0014_35930 [Bacillus cereus BDRD-ST196]
          Length = 171

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 26/74 (35%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYA 99
           + L   KL   Y  +   +     +  +  Q+AW   + S+     +    GT + +  +
Sbjct: 92  YQLWDNKLNEIYSTLKNTMSADAFQSLKTKQIAWVKEKESKVTAIGTDPNNGTMRRIEAS 151

Query: 100 NCLQGHAIERNEKL 113
                   ER  +L
Sbjct: 152 EEKYKMTKERCYEL 165


>gi|148653770|ref|YP_001280863.1| hypothetical protein PsycPRwf_1973 [Psychrobacter sp. PRwf-1]
 gi|148572854|gb|ABQ94913.1| hypothetical protein PsycPRwf_1973 [Psychrobacter sp. PRwf-1]
          Length = 310

 Score = 38.3 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 27/83 (32%), Gaps = 7/83 (8%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
               +     +    +     K  K  ++  E  Q  W  +R   C   A  AE    Q 
Sbjct: 233 AEMDYKRS--EFNKLW----GKASKEAQDSLEYDQKDWVEWRDEVCVDEARSAEPAR-QE 285

Query: 96  MIYANCLQGHAIERNEKLESYLT 118
           ++   C+     ER  +++ Y  
Sbjct: 286 IVRMQCITRLLSERYYEVKEYFD 308


>gi|262376562|ref|ZP_06069791.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262308701|gb|EEY89835.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 215

 Score = 38.3 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 5/84 (5%)

Query: 1  MCRKI--IFALTIIAIAFQSMALNC-NETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
          M + I  +  L +I+    ++ ++C +++   A MN+    S A  + KL   Y      
Sbjct: 7  MLKIIGLMLGLGMISTGSSAITMDCSDDSKKTAAMNKVCSASLAESRAKLADQYFTAFLI 66

Query: 58 VEKHQRELFEKSQMAWEIYRGSEC 81
           +   R L + SQ  W   R  +C
Sbjct: 67 TDAPVR-LLQDSQQLWAT-RLQQC 88


>gi|237750707|ref|ZP_04581187.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229373797|gb|EEO24188.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 208

 Score = 38.3 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 30/101 (29%), Gaps = 27/101 (26%)

Query: 40  FALVKEKLEATYKKVLEKVEKHQR--------------------ELFEKSQMAWEIYRGS 79
           +    + L   YK    +V+K  +                    +   + Q AW   R S
Sbjct: 104 YDEYDKLLNKYYKLYRAEVKKQNKTTPTGAFSHEPNIQSIKNGQDTLLEEQRAWLKLRDS 163

Query: 80  ECAFAASGAE-------EGTAQSMIYANCLQGHAIERNEKL 113
             A+  +           GT  S+  +N   G    R  +L
Sbjct: 164 YEAYTKAHHAHIYDINGGGTIYSIEASNARLGLLKMRVNEL 204


>gi|261379142|ref|ZP_05983715.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
 gi|269144367|gb|EEZ70785.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
          Length = 339

 Score = 38.3 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 260 ARIQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 315

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 316 YLKLQCETRMTRERIQYLRGY 336


>gi|325203210|gb|ADY98663.1| putative lipoprotein [Neisseria meningitidis M01-240355]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|325131129|gb|EGC53850.1| putative lipoprotein [Neisseria meningitidis OX99.30304]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|308388305|gb|ADO30625.1| putative lipoprotein [Neisseria meningitidis alpha710]
 gi|325137152|gb|EGC59747.1| putative lipoprotein [Neisseria meningitidis M0579]
 gi|325201271|gb|ADY96725.1| putative lipoprotein [Neisseria meningitidis M01-240149]
 gi|325205189|gb|ADZ00642.1| putative lipoprotein [Neisseria meningitidis M04-240196]
 gi|325207130|gb|ADZ02582.1| putative lipoprotein [Neisseria meningitidis NZ-05/33]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|325197385|gb|ADY92841.1| putative lipoprotein [Neisseria meningitidis G2136]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|121633964|ref|YP_974209.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|120865670|emb|CAM09394.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|261391629|emb|CAX49071.1| hypothetical lipoprotein [Neisseria meningitidis 8013]
 gi|325129132|gb|EGC51980.1| putative lipoprotein [Neisseria meningitidis N1568]
 gi|325133159|gb|EGC55830.1| putative lipoprotein [Neisseria meningitidis M6190]
 gi|325138775|gb|EGC61327.1| putative lipoprotein [Neisseria meningitidis ES14902]
 gi|325145418|gb|EGC67694.1| putative lipoprotein [Neisseria meningitidis M01-240013]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|262373988|ref|ZP_06067265.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262310999|gb|EEY92086.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 116

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 35/113 (30%), Gaps = 15/113 (13%)

Query: 6   IFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
                +   + ++ +  C++     +   C          KL  TY+ +L  +    R+ 
Sbjct: 10  FILFPLFISSVEAASFPCHQAKSTVEHQICNQRELNDADVKLATTYQIILHALPMGVRDA 69

Query: 66  FEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLT 118
            +  Q  W   R   C                   CL    ++R ++L+  L 
Sbjct: 70  EKDKQFQWLKQRN-RCGAKT--------------LCLSKAYLQRQQQLDRILQ 107


>gi|15676018|ref|NP_273148.1| hypothetical protein NMB0086 [Neisseria meningitidis MC58]
 gi|304388891|ref|ZP_07370940.1| probable lipoprotein [Neisseria meningitidis ATCC 13091]
 gi|7225304|gb|AAF40549.1| hypothetical protein NMB0086 [Neisseria meningitidis MC58]
 gi|254671519|emb|CBA09117.1| hypothetical protein NME_2088 [Neisseria meningitidis alpha153]
 gi|254673882|emb|CBA09665.1| hypothetical protein NMW_2109 [Neisseria meningitidis alpha275]
 gi|304337152|gb|EFM03337.1| probable lipoprotein [Neisseria meningitidis ATCC 13091]
 gi|316985932|gb|EFV64871.1| lipoprotein [Neisseria meningitidis H44/76]
 gi|325141242|gb|EGC63741.1| putative lipoprotein [Neisseria meningitidis CU385]
 gi|325143308|gb|EGC65644.1| putative lipoprotein [Neisseria meningitidis 961-5945]
 gi|325199309|gb|ADY94764.1| putative lipoprotein [Neisseria meningitidis H44/76]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|218767216|ref|YP_002341728.1| putative lipoprotein [Neisseria meningitidis Z2491]
 gi|121051224|emb|CAM07497.1| putative lipoprotein [Neisseria meningitidis Z2491]
 gi|319411423|emb|CBY91835.1| hypothetical lipoprotein [Neisseria meningitidis WUE 2594]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|255068452|ref|ZP_05320307.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
 gi|255047294|gb|EET42758.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.39,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 34/89 (38%), Gaps = 5/89 (5%)

Query: 28  MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASG 87
            Q+D++    +     + ++    K V + +E+  ++     Q AW   +   C  AA+ 
Sbjct: 252 SQSDLDN-ARSQNHQAEAEI----KGVWDGMERTVQQEMLAEQRAWIQTKNQNCQQAAAR 306

Query: 88  AEEGTAQSMIYANCLQGHAIERNEKLESY 116
           A+       +   C      ER + L  Y
Sbjct: 307 ADSPAQNEYLKLQCDTRMTRERTQYLRGY 335


>gi|221209744|ref|ZP_03582725.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221170432|gb|EEE02898.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 205

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 26/76 (34%), Gaps = 7/76 (9%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR--- 77
            +C     + ++  C     A +  +L   Y   +  V + +     +SQ  W I R   
Sbjct: 111 FDCARATAEDEIAICGDAGLAAMDRQLGQLYTAAMRTVSEPR--ALRRSQSDWVITRHMC 168

Query: 78  --GSECAFAASGAEEG 91
               +C   A G   G
Sbjct: 169 NSDIDCLRRAYGERIG 184


>gi|254805857|ref|YP_003084078.1| hypothetical protein NMO_1941 [Neisseria meningitidis alpha14]
 gi|254669399|emb|CBA08574.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
          Length = 338

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|325135206|gb|EGC57831.1| putative lipoprotein [Neisseria meningitidis M13399]
          Length = 338

 Score = 38.0 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|161869104|ref|YP_001598270.1| lipoprotein [Neisseria meningitidis 053442]
 gi|161594657|gb|ABX72317.1| lipoprotein [Neisseria meningitidis 053442]
          Length = 338

 Score = 38.0 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|291042726|ref|ZP_06568467.1| lipoprotein [Neisseria gonorrhoeae DGI2]
 gi|291013160|gb|EFE05126.1| lipoprotein [Neisseria gonorrhoeae DGI2]
          Length = 352

 Score = 38.0 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 273 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 328

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 329 YLKLQCDTRMTRERIQYLRGY 349


>gi|59802206|ref|YP_208918.1| hypothetical protein NGO1889 [Neisseria gonorrhoeae FA 1090]
 gi|194099859|ref|YP_002002996.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
 gi|239997876|ref|ZP_04717800.1| Lipoprotein [Neisseria gonorrhoeae 35/02]
 gi|240015143|ref|ZP_04722056.1| Lipoprotein [Neisseria gonorrhoeae DGI18]
 gi|240017591|ref|ZP_04724131.1| Lipoprotein [Neisseria gonorrhoeae FA6140]
 gi|240081735|ref|ZP_04726278.1| Lipoprotein [Neisseria gonorrhoeae FA19]
 gi|240116747|ref|ZP_04730809.1| Lipoprotein [Neisseria gonorrhoeae PID18]
 gi|240118968|ref|ZP_04733030.1| Lipoprotein [Neisseria gonorrhoeae PID1]
 gi|240122214|ref|ZP_04735176.1| Lipoprotein [Neisseria gonorrhoeae PID24-1]
 gi|240124504|ref|ZP_04737460.1| Lipoprotein [Neisseria gonorrhoeae PID332]
 gi|240124623|ref|ZP_04737509.1| Lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|268593722|ref|ZP_06127889.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268597833|ref|ZP_06132000.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268602418|ref|ZP_06136585.1| lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268604681|ref|ZP_06138848.1| lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268683137|ref|ZP_06149999.1| lipoprotein [Neisseria gonorrhoeae PID332]
 gi|268683190|ref|ZP_06150052.1| lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|293398249|ref|ZP_06642454.1| lipoprotein [Neisseria gonorrhoeae F62]
 gi|59719101|gb|AAW90506.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193935149|gb|ACF30973.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
 gi|268547111|gb|EEZ42529.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268551621|gb|EEZ46640.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268586549|gb|EEZ51225.1| lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268588812|gb|EEZ53488.1| lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268623421|gb|EEZ55821.1| lipoprotein [Neisseria gonorrhoeae PID332]
 gi|268623474|gb|EEZ55874.1| lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|291611512|gb|EFF40582.1| lipoprotein [Neisseria gonorrhoeae F62]
 gi|317165326|gb|ADV08867.1| hypothetical protein NGTW08_1912 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 338

 Score = 38.0 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|251787795|ref|YP_003002516.1| hypothetical protein Dd1591_0144 [Dickeya zeae Ech1591]
 gi|247536416|gb|ACT05037.1| conserved hypothetical protein [Dickeya zeae Ech1591]
          Length = 254

 Score = 38.0 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 36/103 (34%), Gaps = 14/103 (13%)

Query: 1   MCRKIIFALTIIAIAFQSM-----ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL 55
           M R +   L  + +   ++     +  C +     +   C   + + + ++L   ++K  
Sbjct: 1   MKRLLATWLLPLVVGGSALPALAASFPCQQASSAQEKLICQTPALSQLDDELAKEWQKSR 60

Query: 56  EKVEKH-----QRELFEKSQMAWE----IYRGSECAFAASGAE 89
             +  +     Q ++  + Q +W       R  EC   +   +
Sbjct: 61  AFLTGNPERVAQEKILTQFQRSWLSSRNTCRDEECLRQSYQQQ 103


>gi|301513869|ref|ZP_07239106.1| hypothetical protein AbauAB05_19884 [Acinetobacter baumannii
          AB058]
          Length = 84

 Score = 38.0 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 2/54 (3%)

Query: 40 FALVKEKLEATYKKVLEKVEKHQREL--FEKSQMAWEIYRGSECAFAASGAEEG 91
          ++  + +L + Y  +   +  ++ E+     +Q  W   R  +C F    A  G
Sbjct: 25 YSNSEHELNSVYSDIKGYISDNKNEVKYLVDTQRFWLKNRNLKCNFNGKEANSG 78


>gi|240114011|ref|ZP_04728501.1| Lipoprotein [Neisseria gonorrhoeae MS11]
 gi|240129183|ref|ZP_04741844.1| Lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|254494769|ref|ZP_05107940.1| lipoprotein [Neisseria gonorrhoeae 1291]
 gi|268600076|ref|ZP_06134243.1| lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268687566|ref|ZP_06154428.1| lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|226513809|gb|EEH63154.1| lipoprotein [Neisseria gonorrhoeae 1291]
 gi|268584207|gb|EEZ48883.1| lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268627850|gb|EEZ60250.1| lipoprotein [Neisseria gonorrhoeae SK-93-1035]
          Length = 338

 Score = 38.0 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|71278831|ref|YP_269035.1| hypothetical protein CPS_2315 [Colwellia psychrerythraea 34H]
 gi|71144571|gb|AAZ25044.1| hypothetical protein CPS_2315 [Colwellia psychrerythraea 34H]
          Length = 143

 Score = 38.0 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 49/133 (36%), Gaps = 19/133 (14%)

Query: 4   KIIFA----LTIIAIAFQSMALNCNETLMQ-------ADMNQCTGNSFALVKEKL----E 48
           KI+ A      ++ I     A N  E   Q       A M++C     +LV  +L     
Sbjct: 5   KILLASTFLCPLLMINPVHAAKNIEECQQQNAEKISSAPMSRCLDGVISLVDRELQTWVN 64

Query: 49  ATYKKVLEKVEKHQR----ELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG 104
                + EK   + R    ++F++SQ  +  YR ++C +            ++Y  C   
Sbjct: 65  LHTFNLEEKALVNGRYSALKMFKRSQNNFITYRENDCRWQYLAVSPERGADLVYKTCYVQ 124

Query: 105 HAIERNEKLESYL 117
            +  R  +L   +
Sbjct: 125 SSQNRITELSKII 137


>gi|260439492|ref|ZP_05793308.1| Lipoprotein [Neisseria gonorrhoeae DGI2]
          Length = 338

 Score = 38.0 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 4/81 (4%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
                   + ++   +      ++   ++     Q  W   + S C  AA+ A+      
Sbjct: 259 ARVQNQRAESEITKLW----GGLDTDVQKELVGEQRKWAQEKISNCRQAAAQADRQEYAE 314

Query: 96  MIYANCLQGHAIERNEKLESY 116
            +   C      ER + L  Y
Sbjct: 315 YLKLQCDTRMTRERIQYLRGY 335


>gi|157827944|ref|YP_001494186.1| hypothetical protein A1G_00450 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932632|ref|YP_001649421.1| hypothetical protein RrIowa_0093 [Rickettsia rickettsii str. Iowa]
 gi|157800425|gb|ABV75678.1| hypothetical protein A1G_00450 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907719|gb|ABY72015.1| hypothetical protein RrIowa_0093 [Rickettsia rickettsii str. Iowa]
          Length = 50

 Score = 38.0 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 3/32 (9%)

Query: 96  MIYANCLQGHAIERN---EKLESYLTCPEGDL 124
           MI   CL  +   R    ++ E+ L C EGDL
Sbjct: 1   MILLMCLTSYRKNRRAYKKEFEAMLKCEEGDL 32


>gi|311108845|ref|YP_003981698.1| hypothetical protein AXYL_05684 [Achromobacter xylosoxidans A8]
 gi|310763534|gb|ADP18983.1| hypothetical protein AXYL_05684 [Achromobacter xylosoxidans A8]
          Length = 878

 Score = 38.0 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 28/65 (43%), Gaps = 6/65 (9%)

Query: 66  FEKSQMAWEIYRGS----ECAFAASGAEEGTAQSMIYANCLQGHAIERN--EKLESYLTC 119
             K+ +AW   + +    EC + ++ A+ G     ++A C+ G   +R   ++   +L  
Sbjct: 410 LAKAHVAWITCQKTLDSFECNYDSNNADSGAVYQTVFALCIDGTQDKRICFKQYADWLQG 469

Query: 120 PEGDL 124
              D 
Sbjct: 470 EPDDT 474


>gi|152998664|ref|YP_001364345.1| hypothetical protein Shew185_0111 [Shewanella baltica OS185]
 gi|151363282|gb|ABS06282.1| conserved hypothetical protein [Shewanella baltica OS185]
          Length = 212

 Score = 38.0 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 39/114 (34%), Gaps = 15/114 (13%)

Query: 5   IIFALTIIAIAFQSMALNCNE--TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQ 62
           ++ +L+  A+A    + +C +        M  C     + +   L   Y + LEK +  Q
Sbjct: 24  MVSSLSTGAMAADVPSFDCTKVDAGSIEAM-VCKDAGLSQLDNNLAEVYSQALEKAKNEQ 82

Query: 63  RELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
               +  Q  W   R  EC  +                C++     R  +L++ 
Sbjct: 83  PPTLKAMQRGWVKGRN-ECWKSDDK-----------HACIEASYQTRIAELQAQ 124


>gi|168215058|ref|ZP_02640683.1| putative lipoprotein [Clostridium perfringens CPE str. F4969]
 gi|170713520|gb|EDT25702.1| putative lipoprotein [Clostridium perfringens CPE str. F4969]
          Length = 290

 Score = 38.0 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 28/84 (33%), Gaps = 1/84 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
             + F  + + L   +  +   +   + +  +  Q+ W   R       +   +  + + 
Sbjct: 203 AKDYFDYLDKVLNEEWADLRRVLTYKEFDKLKAEQINWIKERDRIAKEESDSNKNTSYRK 262

Query: 96  MIYANCLQGHAIERNEKL-ESYLT 118
           + Y         +R  +L E YL 
Sbjct: 263 VTYVIVQGKETEKRIRELNEKYLN 286


>gi|256419752|ref|YP_003120405.1| hypothetical protein Cpin_0706 [Chitinophaga pinensis DSM 2588]
 gi|256034660|gb|ACU58204.1| hypothetical protein Cpin_0706 [Chitinophaga pinensis DSM 2588]
          Length = 135

 Score = 38.0 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 37/89 (41%), Gaps = 10/89 (11%)

Query: 1  MCRKIIFALTIIAIAFQSM----ALNCNETLMQADMNQ------CTGNSFALVKEKLEAT 50
          M R I+     I +   +     A++  E   Q  +++      C    +  +   L + 
Sbjct: 1  MKRLILCLPLCICLNVFAQTSKTAVDSLEKRYQQCLSEGKSNFNCALQYYTQMDSLLHSV 60

Query: 51 YKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
          Y ++ + ++ ++R+  + SQ  WE  R +
Sbjct: 61 YTELYDNLDNNRRQTLQISQQQWEEKRET 89


>gi|289667082|ref|ZP_06488157.1| hypothetical protein XcampmN_00747 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 388

 Score = 38.0 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 32/97 (32%), Gaps = 12/97 (12%)

Query: 21  LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSE 80
            +C +     +   C   +   + ++L+  Y+ VLE   +         Q  W   R + 
Sbjct: 28  FDCKQVSTPVEKRLCAVPALGNLDDQLDEAYRGVLEATPRASIAAVRDQQRTWLRQRNA- 86

Query: 81  CAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYL 117
           CA  A              +CLQ     R + L   L
Sbjct: 87  CAQDAK-----------LDDCLQRSLKARVDVLGKAL 112


>gi|261823440|ref|YP_003261546.1| hypothetical protein Pecwa_4215 [Pectobacterium wasabiae WPP163]
 gi|261607453|gb|ACX89939.1| conserved hypothetical protein [Pectobacterium wasabiae WPP163]
          Length = 266

 Score = 37.6 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 9/69 (13%), Positives = 21/69 (30%), Gaps = 5/69 (7%)

Query: 15 AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----EKHQRELFEKS 69
            Q+ + +C +     +   C       + E+L   +K     +          +   + 
Sbjct: 21 PAQAASFSCEKAASAQEKLICASPLLGQLDEELAQAWKTSRAFLTAYDNSAPWEKTLNQF 80

Query: 70 QMAWEIYRG 78
          Q +W   R 
Sbjct: 81 QRSWLTTRD 89


>gi|312114009|ref|YP_004011605.1| peptidase C14 caspase catalytic subunit p20 [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219138|gb|ADP70506.1| peptidase C14 caspase catalytic subunit p20 [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 494

 Score = 37.6 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 36/100 (36%), Gaps = 18/100 (18%)

Query: 18  SMALNCNETL-MQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQR--ELFEKSQMAWE 74
           + + NCN+     A++  C  +  + +  +++  Y  +++ +  +    +L    Q  W 
Sbjct: 406 APSFNCNDANLNLAEIKVCQVDQLSRLDIEMQKLYDNLIQDLRSNVSAFKLLVSEQRQWL 465

Query: 75  IYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLE 114
             R S C                   CL      R ++L+
Sbjct: 466 KLR-SMCG--------------ANELCLTDTYKRRLQQLK 490


>gi|187920382|ref|YP_001889413.1| hypothetical protein Bphyt_5697 [Burkholderia phytofirmans PsJN]
 gi|187718820|gb|ACD20043.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 123

 Score = 37.6 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 32/102 (31%), Gaps = 9/102 (8%)

Query: 1   MCRKIIFALTIIAIAFQSMAL----NCNETLMQADMNQCTGNSFALVKEKLEATYKKVLE 56
           + R++  AL  +     + A     +C    +  +   C     + +  ++   Y+ +  
Sbjct: 9   IKRRLRCALFAMVTLSSATAFAASFDCGRARLADEKAICASRQLSEMDVEMAVRYQMLTG 68

Query: 57  KVEKHQRELFEKSQMAWEIYRGS-----ECAFAASGAEEGTA 93
            V    R   +  Q  W   R +      C   A     GT 
Sbjct: 69  LVAMGARGDMQDEQQVWLKSRKACGGNRSCLLNAYRRRIGTL 110


>gi|317405081|gb|EFV85427.1| hypothetical protein HMPREF0005_04235 [Achromobacter xylosoxidans
          C54]
          Length = 229

 Score = 37.6 bits (86), Expect = 0.61,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 19/58 (32%)

Query: 21 LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRG 78
           +C +    A+   C     A +   +   Y +  + ++    E   + Q  +   R 
Sbjct: 32 FDCAKARAGAEKAICANPQLAALDASIAKRYDEARKSLDAATAEALARDQRYFAKVRD 89


>gi|332969802|gb|EGK08813.1| hypothetical protein HMPREF9373_2297 [Psychrobacter sp. 1501(2011)]
          Length = 311

 Score = 37.6 bits (86), Expect = 0.64,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 27/83 (32%), Gaps = 7/83 (8%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
               +     +    +     K  K  +   E  Q  W  +R   C   A GAE    Q 
Sbjct: 234 AEMDYKRS--EFNKLW----GKASKEAQASIEYDQKEWVEWRDQVCVDEARGAEPAR-QE 286

Query: 96  MIYANCLQGHAIERNEKLESYLT 118
           ++   C+     +R  +++ Y  
Sbjct: 287 IVRMQCITRLLSDRYYEVKEYFD 309


>gi|237803818|ref|ZP_04591403.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|237805408|ref|ZP_04592112.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025798|gb|EGI05854.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331026515|gb|EGI06570.1| putative lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 38

 Score = 37.6 bits (86), Expect = 0.65,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 91  GTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           G+   ++ A CL  H + R ++L+  + C E D  CP
Sbjct: 3   GSMWPLVQAQCLAEHILVRLKQLQVCVACREED--CP 37


>gi|227325840|ref|ZP_03829864.1| hypothetical protein PcarcW_00385 [Pectobacterium carotovorum
          subsp. carotovorum WPP14]
          Length = 266

 Score = 37.6 bits (86), Expect = 0.65,   Method: Composition-based stats.
 Identities = 10/77 (12%), Positives = 22/77 (28%), Gaps = 5/77 (6%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV-----EKH 61
            L  +    Q+ +  C +     +   C       + E+L   +K     +        
Sbjct: 13 VTLASLCHTAQAASFPCEKAASAQEKLICASPLLGQLDEELAQAWKTSRASLTAYDNSAP 72

Query: 62 QRELFEKSQMAWEIYRG 78
            +   + Q +W   R 
Sbjct: 73 WEKTLNQFQRSWLTTRD 89


>gi|50121102|ref|YP_050269.1| hypothetical protein ECA2174 [Pectobacterium atrosepticum
          SCRI1043]
 gi|49611628|emb|CAG75076.1| conserved hypothetical protein [Pectobacterium atrosepticum
          SCRI1043]
          Length = 142

 Score = 37.6 bits (86), Expect = 0.65,   Method: Composition-based stats.
 Identities = 11/81 (13%), Positives = 30/81 (37%), Gaps = 11/81 (13%)

Query: 5  IIFALTIIAIAFQSMALN-CNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVE---K 60
          ++  +  +     + A + C++      + QC      L ++ L   Y    +++     
Sbjct: 7  LVVTILALGGITSAFADDICSKQPSDGALYQCMVQQKKLAEDDLNKEYAAAKKRIVQMYG 66

Query: 61 HQRELFEK-------SQMAWE 74
           Q++L ++       +Q  W 
Sbjct: 67 SQKQLGDQYVAIVVDTQRGWL 87


>gi|145597794|ref|YP_001161870.1| hypothetical protein YPDSF_0486 [Yersinia pestis Pestoides F]
 gi|145209490|gb|ABP38897.1| hypothetical protein YPDSF_0486 [Yersinia pestis Pestoides F]
          Length = 331

 Score = 37.6 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 7  FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH----Q 62
          F L ++ I+  S+A+NC       +   C+      + +   + Y+ +L K        Q
Sbjct: 10 FFLWMMLISTSSLAINCQRASTPVEYTVCSNEDLHWLAQTFNSIYQVLLVKYNTEMVYQQ 69

Query: 63 RELFEKS 69
          R+ +EKS
Sbjct: 70 RQTWEKS 76


>gi|114763747|ref|ZP_01443141.1| hypothetical protein 1100011001335_R2601_16610 [Pelagibaca
          bermudensis HTCC2601]
 gi|114543748|gb|EAU46761.1| hypothetical protein R2601_16610 [Roseovarius sp. HTCC2601]
          Length = 180

 Score = 37.6 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 9/77 (11%), Positives = 23/77 (29%), Gaps = 2/77 (2%)

Query: 5  IIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL--EKVEKHQ 62
          + F            + +C +    A+   C+ ++ A +  +L   +        ++   
Sbjct: 14 VAFVTLNHGATALEPSFDCAKAQSGAEEAVCSFDALAALDIELARLFTAASTGPNMDPDA 73

Query: 63 RELFEKSQMAWEIYRGS 79
                 Q  W   R +
Sbjct: 74 HATLRAMQRGWIKGRDA 90


>gi|290473182|ref|YP_003466045.1| hypothetical protein XBJ1_0094 [Xenorhabdus bovienii SS-2004]
 gi|289172478|emb|CBJ79245.1| putative secreted protein [Xenorhabdus bovienii SS-2004]
          Length = 108

 Score = 37.6 bits (86), Expect = 0.67,   Method: Composition-based stats.
 Identities = 14/90 (15%), Positives = 28/90 (31%), Gaps = 5/90 (5%)

Query: 2  CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           R  +F L I++    + + +C +  +  +   CT +    +  ++   Y  +       
Sbjct: 1  MRYTLFMLLILSPLSLAASFDCAKAKVPDEKAICTDHRLNDLDIEMSVKYHFLRGLFAMG 60

Query: 62 QRELFEKSQMAWEIYR-----GSECAFAAS 86
                 SQ AW   R        C     
Sbjct: 61 MSGEMYDSQQAWLKQRQKCKGDKTCLLQRY 90


>gi|296162314|ref|ZP_06845108.1| protein of unknown function DUF1311 [Burkholderia sp. Ch1-1]
 gi|295887468|gb|EFG67292.1| protein of unknown function DUF1311 [Burkholderia sp. Ch1-1]
          Length = 243

 Score = 37.2 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 53/124 (42%), Gaps = 13/124 (10%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQA-----DMN------QCTGNSFALVKEKLEATYKK 53
           ++F    +    +  A +  +  M+A     DM+      QC  N+    +  L+  +++
Sbjct: 26  VVFGAASLPAHAEVAAADPIDASMRACLARSDMSSTAGQVQCMDNARIGWRTALDNAWQQ 85

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMIYANCLQGHAIERNE 111
           + +KV   +R+ +EKSQ +W+  R +E    A+      G+   +  A+       +R  
Sbjct: 86  LQQKVPPARRKQWEKSQASWQASRDAEKPLLAAVFATTRGSMYVLAEADMQLQPVRDRAL 145

Query: 112 KLES 115
            L S
Sbjct: 146 ALRS 149



 Score = 34.1 bits (77), Expect = 6.6,   Method: Composition-based stats.
 Identities = 9/44 (20%), Positives = 15/44 (34%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
                      L   Y ++  K+  H R    ++Q AW  Y  +
Sbjct: 169 ADAQCEHAMFDLNRYYHRLQSKMPVHTRATLTRAQKAWTAYLNA 212


>gi|261365652|ref|ZP_05978535.1| conserved hypothetical protein [Neisseria mucosa ATCC 25996]
 gi|288565815|gb|EFC87375.1| conserved hypothetical protein [Neisseria mucosa ATCC 25996]
          Length = 335

 Score = 37.2 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 37/99 (37%), Gaps = 5/99 (5%)

Query: 18  SMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77
           + A     +  Q+D++    +       +++  +  +   V   Q+EL  + Q AW   +
Sbjct: 239 AEAKREEPSFSQSDLDN-ARSQNRNADSEIQRIWDGMEHTV---QKELLTE-QRAWIQNK 293

Query: 78  GSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
              C  AA+ A+       +   C      ER + L  Y
Sbjct: 294 IQNCQQAAAQADSPAHAEYLKLQCDTRMTRERTQYLRGY 332


>gi|188532615|ref|YP_001906412.1| hypothetical protein ETA_04610 [Erwinia tasmaniensis Et1/99]
 gi|188027657|emb|CAO95507.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 344

 Score = 37.2 bits (85), Expect = 0.71,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 28/74 (37%), Gaps = 6/74 (8%)

Query: 2  CRKII----FALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK 57
           +KI+    FA  I AI   + AL+C  T   A+   CT      +       + + + +
Sbjct: 16 LKKILPLFVFAWLIAAID-PARALDCGRTSNMAEYTVCTNPQLLWLDRLYNDAFHQRMTE 74

Query: 58 VEKHQRELFEKSQM 71
           + H   L    Q 
Sbjct: 75 -DPHHAALLVAPQR 87


>gi|71415665|ref|XP_809892.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70874341|gb|EAN88041.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 382

 Score = 37.2 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 11/76 (14%), Positives = 30/76 (39%), Gaps = 4/76 (5%)

Query: 45  EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIY----AN 100
            ++   Y+ +  ++++ QR + E++++       + C          T  +M+     + 
Sbjct: 65  REMNTRYRDLRRRLKESQRVVLEEAEVVTRSLYPAGCVAKEYADALQTCAAMLTVSVPSQ 124

Query: 101 CLQGHAIERNEKLESY 116
            L      R ++L S 
Sbjct: 125 ALARFTEYRVQELASL 140


>gi|197103619|ref|YP_002128996.1| hypothetical protein PHZ_c0153 [Phenylobacterium zucineum HLK1]
 gi|196477039|gb|ACG76567.1| hypothetical protein PHZ_c0153 [Phenylobacterium zucineum HLK1]
          Length = 275

 Score = 37.2 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 10/102 (9%), Positives = 30/102 (29%), Gaps = 16/102 (15%)

Query: 12  IAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQM 71
           ++      + +C     +++   C     A +  +L+  +++ +     ++       Q 
Sbjct: 184 VSAPAPRPSFDCRYAGTRSERMVCGDPRLAGLDRRLDRAFERAVAAGIPYRE--LRAEQD 241

Query: 72  AWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
            W   R      +    E  +               +R  +L
Sbjct: 242 DWLAIREDAARHSPDAVE--SVY------------RQRIAEL 269


>gi|168206517|ref|ZP_02632522.1| putative lipoprotein [Clostridium perfringens E str. JGS1987]
 gi|170662014|gb|EDT14697.1| putative lipoprotein [Clostridium perfringens E str. JGS1987]
          Length = 290

 Score = 37.2 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 28/84 (33%), Gaps = 1/84 (1%)

Query: 36  TGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQS 95
             + F  + + L   +  +   +   + +  +  Q+ W   R       +   +  + + 
Sbjct: 203 AKDYFDYLDKILNEEWADLRRVLTYKEFDKLKAEQINWIKERDRIAKEESDSNKNTSYRK 262

Query: 96  MIYANCLQGHAIERNEKL-ESYLT 118
           + Y         +R  +L E YL 
Sbjct: 263 VTYVIVQGKETEKRIRELNEKYLN 286


>gi|83645783|ref|YP_434218.1| hypothetical protein HCH_03028 [Hahella chejuensis KCTC 2396]
 gi|83633826|gb|ABC29793.1| uncharacterized protein conserved in bacteria, putative
          lipoprotein [Hahella chejuensis KCTC 2396]
          Length = 236

 Score = 37.2 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 32/81 (39%), Gaps = 9/81 (11%)

Query: 7  FALTIIAIAFQSMA-LNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL 65
           A+  +  +  + A  +C +     +   C  +  + + E+L A YK+  E      +E+
Sbjct: 16 VAILALDGSVSAAASFDCAKASSSVEALICEDDQLSSLDERLAAAYKQARE--SGFGKEI 73

Query: 66 FEKSQMAWEI-----YRGSEC 81
           + SQ  W          +EC
Sbjct: 74 -KFSQTLWLNNSRNLCEDAEC 93


>gi|117918571|ref|YP_867763.1| hypothetical protein Shewana3_0113 [Shewanella sp. ANA-3]
 gi|117610903|gb|ABK46357.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 206

 Score = 37.2 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 18/109 (16%), Positives = 39/109 (35%), Gaps = 17/109 (15%)

Query: 11  IIAIAFQSMALNCNETLMQA---DMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFE 67
           + A+A +  + +C +   QA   +   C       + ++L   Y +  +K +  Q  + +
Sbjct: 24  VPAMAAEKPSFDCGKV--QAGSIEELVCQDAGLTKLDQQLAEVYAQAADKAKNEQPPMLK 81

Query: 68  KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
             Q  W   R  EC  +                C++     R  +L++ 
Sbjct: 82  AMQRGWVKGRN-ECWKSEDK-----------RACVESSYQTRIAELQAQ 118


>gi|283834529|ref|ZP_06354270.1| conserved hypothetical protein [Citrobacter youngae ATCC 29220]
 gi|291070081|gb|EFE08190.1| conserved hypothetical protein [Citrobacter youngae ATCC 29220]
          Length = 152

 Score = 37.2 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 65  LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKL 113
             +KS   +  YR ++C+FA S      + + IY+ C+     +R E+L
Sbjct: 92  RLDKSNQEFIRYRLAQCSFAESWGNGVGSFTRIYS-CMAELNRQRAEQL 139


>gi|91782355|ref|YP_557561.1| hypothetical protein Bxe_A3476 [Burkholderia xenovorans LB400]
 gi|91686309|gb|ABE29509.1| Hypothetical protein Bxe_A3476 [Burkholderia xenovorans LB400]
          Length = 243

 Score = 37.2 bits (85), Expect = 0.80,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 53/124 (42%), Gaps = 13/124 (10%)

Query: 5   IIFALTIIAIAFQSMALNCNETLMQA-----DMN------QCTGNSFALVKEKLEATYKK 53
           ++F    +    +  A +  +  M+A     DM+      QC  N+    +  L+  +++
Sbjct: 26  VVFGAASLPAHAEVAAADPIDASMRACLARSDMSSTAGQVQCMDNARIGWRTALDNAWQQ 85

Query: 54  VLEKVEKHQRELFEKSQMAWEIYRGSECAFAAS--GAEEGTAQSMIYANCLQGHAIERNE 111
           + +KV   +R+ +EKSQ +W+  R +E    A+      G+   +  A+       +R  
Sbjct: 86  LQQKVPPARRKQWEKSQASWQASRDAEKPLLAAVFATTRGSMYVLAEADMQLQPVRDRAL 145

Query: 112 KLES 115
            L S
Sbjct: 146 ALRS 149


>gi|113968458|ref|YP_732251.1| hypothetical protein Shewmr4_0113 [Shewanella sp. MR-4]
 gi|113883142|gb|ABI37194.1| conserved hypothetical protein [Shewanella sp. MR-4]
          Length = 128

 Score = 37.2 bits (85), Expect = 0.85,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 41/115 (35%), Gaps = 17/115 (14%)

Query: 6   IFALTIIAIAFQSM--ALNCNE--TLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH 61
           +FA+T+   A  +   + +C++       ++  C       + ++L   Y K  EK +  
Sbjct: 17  LFAMTLGTPAMAAEKPSFDCSKVRAGSIEEL-VCQDEGLIKLDQQLAEVYTKATEKAKNE 75

Query: 62  QRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESY 116
           Q    +  Q  W   R  EC  +                C++     R  +L++ 
Sbjct: 76  QPPTLKAMQRGWVKGRD-ECWKSEDK-----------RACVESTYQTRIAELQAQ 118


>gi|317479146|ref|ZP_07938286.1| outer membrane insertion protein [Bacteroides sp. 4_1_36]
 gi|316904718|gb|EFV26532.1| outer membrane insertion protein [Bacteroides sp. 4_1_36]
          Length = 717

 Score = 37.2 bits (85), Expect = 0.88,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 1  MCRKIIF--ALTIIAIAFQSMALNCNETLMQADMNQC-TGNSFALVKEKLEATYKKVLEK 57
          M R  +       ++I+  +   N   T   AD N+  + +S      +L++ Y+ + E 
Sbjct: 1  MKRFYLLPIVCCALSISLSAQENNGTATTSGADDNRILSADSLITTDARLDSLYQTLPEV 60

Query: 58 VEKHQRELFEKSQ 70
          +   +R + + +Q
Sbjct: 61 MITGERPIVKAAQ 73


>gi|270296878|ref|ZP_06203077.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270272865|gb|EFA18728.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 730

 Score = 37.2 bits (85), Expect = 0.88,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 1  MCRKIIF--ALTIIAIAFQSMALNCNETLMQADMNQC-TGNSFALVKEKLEATYKKVLEK 57
          M R  +       ++I+  +   N   T   AD N+  + +S      +L++ Y+ + E 
Sbjct: 14 MKRFYLLPIVCCALSISLSAQENNGTATTSGADDNRILSADSLITTDARLDSLYQTLPEV 73

Query: 58 VEKHQRELFEKSQ 70
          +   +R + + +Q
Sbjct: 74 MITGERPIVKAAQ 86


>gi|160890307|ref|ZP_02071310.1| hypothetical protein BACUNI_02748 [Bacteroides uniformis ATCC
          8492]
 gi|156860039|gb|EDO53470.1| hypothetical protein BACUNI_02748 [Bacteroides uniformis ATCC
          8492]
          Length = 730

 Score = 37.2 bits (85), Expect = 0.88,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 1  MCRKIIF--ALTIIAIAFQSMALNCNETLMQADMNQC-TGNSFALVKEKLEATYKKVLEK 57
          M R  +       ++I+  +   N   T   AD N+  + +S      +L++ Y+ + E 
S