RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62] (131 letters) >3gi7_A Secreted protein of unknown function DUF1311; NP_742474.1, structural genomics, joint center for structural genomics, JCSG; 1.85A {Pseudomonas putida KT2440} Length = 122 Score = 66.3 bits (161), Expect = 2e-12 Identities = 21/120 (17%), Positives = 46/120 (38%), Gaps = 8/120 (6%) Query: 15 AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH------QRELFEK 68 A + + C+ C + + + +L++ Y +++E++ E Sbjct: 2 ADEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERMRDQFGDEAGLMSRIEA 61 Query: 69 SQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127 ++ W R ++C + G+ A + + +C+ + ER E L S L D P Sbjct: 62 AEKVWSQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYLRS-LGSQNSDEPAP 120 >3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} Length = 252 Score = 26.1 bits (57), Expect = 2.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 52 KKVLEKVEKHQRELFEKSQM 71 +V +++EK QRE + QM Sbjct: 222 NRVKKQMEKSQREYYLNEQM 241 >2rag_A Dipeptidase; aminohydrolase, structural genomics, NYSGXRC, target 9257A, PSI-2, protein structure initiative; 2.00A {Caulobacter crescentus CB15} Length = 417 Score = 25.1 bits (54), Expect = 4.6 Identities = 8/26 (30%), Positives = 16/26 (61%) Query: 1 MCRKIIFALTIIAIAFQSMALNCNET 26 M R ++FALT +++ S+A ++ Sbjct: 1 MSRPLLFALTALSLTAASLAHAADKK 26 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 25.0 bits (53), Expect = 5.3 Identities = 7/30 (23%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Query: 62 QRELFEKSQMAWEIYR-GSECAFAASGAEE 90 +++ +K Q + ++Y S A A E Sbjct: 18 EKQALKKLQASLKLYADDSAPALAIKATME 47 Score = 24.6 bits (52), Expect = 7.2 Identities = 6/12 (50%), Positives = 9/12 (75%), Gaps = 2/12 (16%) Query: 41 ALVKEKLEATYK 52 AL +KL+A+ K Sbjct: 21 AL--KKLQASLK 30 >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 24.5 bits (52), Expect = 7.0 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Query: 44 KEKLEATYKKVLEKVEKHQRELFEKSQM 71 +EK KK LE+ + Q E EK+++ Sbjct: 113 REKA----KKDLEEWNQRQSEQVEKNKI 136 >1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* Length = 1122 Score = 24.4 bits (52), Expect = 7.2 Identities = 9/43 (20%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Query: 35 CTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYR 77 F L + + +VL ++ K F K M+W++ Sbjct: 57 AANIDFPLPASFIWDMFVRVLPEIPK--ESAFNKQSMSWKLMT 97 >1v0d_A DNA fragmentation factor 40 kDa subunit; hydrolase, nuclease, caspase-activated DNAse; HET: DNA; 2.6A {Mus musculus} SCOP: d.4.1.7 PDB: 1f2r_C 1c9f_A 1ibx_A* Length = 329 Score = 24.4 bits (53), Expect = 8.7 Identities = 8/23 (34%), Positives = 10/23 (43%) Query: 104 GHAIERNEKLESYLTCPEGDLLC 126 G +R + S L PEG C Sbjct: 207 GSYFDRGAEASSRLCTPEGWFSC 229 >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 1apx_A* Length = 261 Score = 24.3 bits (52), Expect = 9.3 Identities = 8/27 (29%), Positives = 14/27 (51%) Query: 46 KLEATYKKVLEKVEKHQRELFEKSQMA 72 + A Y+K +EK +K R + + A Sbjct: 18 TVSADYQKAVEKAKKKLRGFIAEKRCA 44 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.320 0.131 0.386 Gapped Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,043,944 Number of extensions: 40042 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 129 Number of HSP's successfully gapped: 15 Length of query: 131 Length of database: 5,693,230 Length adjustment: 82 Effective length of query: 49 Effective length of database: 3,705,222 Effective search space: 181555878 Effective search space used: 181555878 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.1 bits)