BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780607|ref|YP_003065020.1| hypothetical protein
CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62]
         (131 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 131

 Score =  271 bits (693), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK
Sbjct: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
           HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP
Sbjct: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120

Query: 121 EGDLLCPFINN 131
           EGDLLCPFINN
Sbjct: 121 EGDLLCPFINN 131


>gi|255764508|ref|YP_003065363.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 242

 Score = 25.8 bits (55), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query: 80  ECAFAASGAE---EGTAQSMIYANCLQGHAIERNE-KLES 115
            C    SG +    G A+S++Y N L    +ER++ KLE+
Sbjct: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152


>gi|254781204|ref|YP_003065617.1| hypothetical protein CLIBASIA_05555 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 707

 Score = 25.8 bits (55), Expect = 0.30,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 22/49 (44%)

Query: 27  LMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEI 75
           L + D    +  S +L    +   YK++LEK  +   +   +  ++W I
Sbjct: 364 LQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGI 412


>537021.9.peg.410_1 
          Length = 952

 Score = 25.4 bits (54), Expect = 0.33,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 37/93 (39%), Gaps = 5/93 (5%)

Query: 25  ETLMQADMNQCTGNSFALVK-----EKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGS 79
           +TL QA   QC    F+L+      +K       + +++ K   +L EK + + + +   
Sbjct: 51  QTLQQASQTQCIEERFSLLSSFFLTQKFTPQKNIITQEINKKSPDLKEKLKKSQDEFIKI 110

Query: 80  ECAFAASGAEEGTAQSMIYANCLQGHAIERNEK 112
              F      + T  S+  A  L  H  E  +K
Sbjct: 111 RDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKK 143


>gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus
          Liberibacter asiaticus str. psy62]
          Length = 820

 Score = 22.7 bits (47), Expect = 2.5,   Method: Composition-based stats.
 Identities = 11/37 (29%), Positives = 20/37 (54%)

Query: 33 NQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKS 69
          + C GN+  L K+K++  ++    K E    + FE+S
Sbjct: 16 SNCKGNTQDLSKKKIDNGFETEKSKKENPCHDSFEQS 52


>gi|254780375|ref|YP_003064788.1| hypothetical protein CLIBASIA_01300 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 175

 Score = 21.9 bits (45), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 24 NETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
          + TL+  ++ Q   N    V+E+   + KKVLE ++K
Sbjct: 37 DPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQK 73


>gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 440

 Score = 21.6 bits (44), Expect = 5.1,   Method: Composition-based stats.
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 43  VKEKLEATYKKVLEKVEKHQRELFEKSQ 70
           +K  L   +KK+   +  H+R L+  SQ
Sbjct: 358 IKSILSNKFKKLPFSIPSHKRHLYHLSQ 385


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.320    0.131    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 74,741
Number of Sequences: 1233
Number of extensions: 2556
Number of successful extensions: 11
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of query: 131
length of database: 328,796
effective HSP length: 65
effective length of query: 66
effective length of database: 248,651
effective search space: 16410966
effective search space used: 16410966
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 34 (17.7 bits)