>TIGR00431 TruB tRNA pseudouridine synthase B; InterPro: IPR014780 TruB, the tRNA pseudouridine 55 synthase, converts uracil to pseudouridine in the T loop of most tRNAs of all three domains of life. This model is built on a seed alignment of bacterial proteins only. Saccharomyces cerevisiae protein YNL292w (Pus4) has been shown to be the pseudouridine 55 synthase of both cytosolic and mitochondrial compartments, active at no other position on tRNA and the only enzyme active at that position in the species. A distinct yeast protein YLR175w, (centromere/microtubule-binding protein CBF5) is an rRNA pseudouridine synthase, and the archaeal set is much more similar to CBF5 than to Pus4. It is unclear whether the archaeal proteins found by this model are tRNA pseudouridine 55 synthases like TruB, rRNA pseudouridine synthases like CBF5, or (as suggested by the absence of paralogs in the Archaea) both. CBF5 likely has additional, eukaryotic-specific functions.; GO: 0003723 RNA binding, 0016439 tRNA-pseudouridine synthase activity, 0031119 tRNA pseudouridine synthesis.

Probab=93.75 E-value=0.014 Score=36.41 Aligned_cols=70 Identities=20% Similarity=0.192 Sum_probs=47.0 Q ss_pred CCEEEECCCCCCEEECCCCCCCCCCCCHHHCCCC-CCCCCCCCCCCCCCCCCEEEEECCCCHHHHHCCCCCCCCCCCCCC Q ss_conf 8568841765311223578533233201101111-100133354453422240462123101222102333322111200 Q gi|254780608|r 106 SKIYVFNKPAGISVQGGSGIAYHIDGFLKSWVDS-KGQKPRLTHRLDQETSGILVVARTRAAAQHLTESFRMRRIQKIYW 184 (346) Q Consensus 106 ~~livinKPaGl~vhp~~g~~~~~~~~l~~~~~~-~~~~~~lVHRLDr~TSGlll~AK~~~a~~~l~~~f~~~~v~K~Y~ 184 (346) T Consensus 2 ~GvLll~Kp~G~TSfd----------~~~~v~rLl~~kkvGHtGTLDp~A~G~L~~~vGr~aTkl~~yl~---~~dK~Y~ 68 (236) T TIGR00431 2 NGVLLLDKPQGMTSFD----------ALAKVRRLLGVKKVGHTGTLDPFATGVLPILVGRKATKLSPYLT---DLDKEYE 68 (236) T ss_pred CCCCCCCCCCCCCHHH----------HHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC---CCCCEEE T ss_conf 7204155788878899----------99999998707852206665302410354223001343433312---6476179 Q ss_pred CCCC Q ss_conf 0134 Q gi|254780608|r 185 SLVW 188 (346) Q Consensus 185 Aiv~ 188 (346) T Consensus 69 A~~~ 72 (236) T TIGR00431 69 AEIR 72 (236) T ss_pred EEEE T ss_conf 9998

HHsearch alignment for GI: 254780608 and conserved domain: TIGR00431