>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family; InterPro: IPR014284 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes. With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognized by the major sigma factors , . This entry is found in all varieties of the sigma-70 type sigma factors, including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (IPR000394 from INTERPRO) are included within this entry. ; GO: 0003677 DNA binding, 0003700 transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, 0006355 regulation of transcription DNA-dependent.

Probab=99.92 E-value=5.1e-24 Score=180.06 Aligned_cols=162 Identities=24% Similarity=0.320 Sum_probs=129.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHC Q ss_conf 99999999430778756555579999888999999888998986218534568999757789999998532024600110 Q gi|254780611|r 48 SAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIG 127 (302) Q Consensus 48 ~Ar~~Li~~nlrlV~~iA~~y~~~g~~~~DLiQeG~iGLi~Ai~kFDp~kG~~FsTYA~~wIr~~I~~~i~~~~~~IRiP 127 (302) T Consensus 1 ~a~~~l~~~~~~~~~~~a~~~~~~~~~aeDl~Qe~~~~~~~~~~~~~~~-~~~f~~wl~~~~~n~~~d~~R~~~~~~~~~ 79 (162) T TIGR02937 1 EAFEELVERYLPLLYRYARRYLGDDADAEDLVQEAFLKLLEALDRFDPE-GGSFKAWLFRIARNLILDYLRRKRRRVRRL 79 (162) T ss_pred CHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9788999999999999999971787579999999999999878624878-765389999999999999999866442001 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCHHCCCCCC Q ss_conf 23003589999999978878662447888246778886189832110000001223433552023234532000001235 Q gi|254780611|r 128 TTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYD 207 (302) Q Consensus 128 ~~~~~r~l~~~~rk~~~~~~~~~~~~~~~~~~~eiA~~Lgis~~~v~~l~~~~~~~~SLd~~i~~~d~~~~~~~d~l~~~ 207 (302) T Consensus 80 ~~---------------~~~-------------------------------------~~------------~~~~~~-~- 93 (162) T TIGR02937 80 RV---------------ELD-------------------------------------ED------------DELEEL-E- 93 (162) T ss_pred HH---------------HHC-------------------------------------CH------------HHHHHH-C- T ss_conf 45---------------412-------------------------------------21------------344321-3- Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 68705655666666677799999962199999999999827888889899999977899999999999999999999 Q gi|254780611|r 208 HDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESI 284 (302) Q Consensus 208 ~~~~~~~~~e~~e~~~~~~~L~~~l~~L~~rEr~II~~ry~~~~~~Tl~EIa~~lgiS~eRVrQI~~~AL~kLR~~l 284 (302) T Consensus 94 ~~~----~~~-~~-~~~~~~l~~al~~Lp~~~r~~~~l~~~~~--~s~~eIA~~lg~s~~~v~~~~~ra~~~L~~~l 162 (162) T TIGR02937 94 DPS----PEE-LE-EEEREALREALEKLPEREREVLVLRYLEG--LSYKEIAEILGISEGTVKSRLKRARKKLRELL 162 (162) T ss_pred CCC----HHH-HH-HHHHHHHHHHHHHCCHHHHHHHHHHHHHC--CCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHC T ss_conf 578----778-99-99999999998747998999999999718--99889999868999999999999999998529

HHsearch alignment for GI: 254780611 and conserved domain: TIGR02937