Query         gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 503
No_of_seqs    421 out of 678
Neff          10.1
Searched_HMMs 13730
Date          Wed Jun  1 10:02:03 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780612.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1udsa2 d.101.1.1 (A:151-255)   66.8     3.3 0.00024   17.9   5.4   61  426-496     7-70  (105)
  2 d1e5da2 d.157.1.3 (A:2-250) Ru  55.3     2.2 0.00016   19.0   1.4   12  486-497   231-242 (249)
  3 d2hevf1 b.22.1.1 (F:58-183) Tu  54.0     1.3 9.3E-05   20.7   0.0   37  435-483    39-75  (126)
  4 d1ycga2 d.157.1.3 (A:2-250) Ni  50.0     1.9 0.00014   19.5   0.4   41  451-499   206-247 (249)
  5 d2hewf1 b.22.1.1 (F:58-185) Tu  46.9     2.6 0.00019   18.6   0.7   37  435-483    40-78  (128)
  6 d1t1ua1 c.43.1.3 (A:20-401) Ch  45.2     7.2 0.00053   15.5   3.1  119  366-487   151-321 (382)
  7 d1nm8a1 c.43.1.3 (A:9-385) Car  43.3     6.7 0.00049   15.7   2.3   61  435-495   250-331 (377)
  8 d2f1fa2 d.58.18.6 (A:78-163) A  36.5     9.7 0.00071   14.6   5.9   51  428-483    31-81  (86)
  9 d2pc6a1 d.58.18.6 (A:78-163) A  34.5      10 0.00076   14.4   4.4   47  429-478    32-78  (86)
 10 d1in0a2 d.58.49.1 (A:90-163) H  31.3     5.3 0.00039   16.4   0.3   28  446-474    46-73  (74)
 11 d1wjka_ c.47.1.1 (A:) Thioredo  30.7     9.4 0.00068   14.7   1.4   48  448-500    50-97  (100)
 12 d1xl7a1 c.43.1.3 (A:11-392) Pe  30.5      10 0.00074   14.5   1.6  129  366-494   154-333 (382)
 13 d1uwka_ e.51.1.1 (A:) Urocanat  30.2     8.8 0.00064   14.9   1.2   29  438-466   357-393 (554)
 14 d1vqos1 d.12.1.1 (S:1-81) Ribo  27.8      13 0.00098   13.6   6.2   54  439-492    25-80  (81)
 15 d1r6la2 d.101.1.1 (A:152-239)   27.3      14 0.00099   13.6   6.3   61  426-496     7-70  (88)
 16 d1thfd_ c.1.2.1 (D:) Cyclase s  24.8      15  0.0011   13.3   2.6   79  412-491    18-108 (253)
 17 d2al3a1 d.15.1.2 (A:10-85) Tet  24.8      15  0.0011   13.3   4.0   31  466-496     3-33  (76)
 18 d1zfja4 d.37.1.1 (A:95-220) Ty  23.6      16  0.0012   13.1   3.2   42  436-480    67-109 (126)
 19 d1geha1 c.1.14.1 (A:137-443) R  23.6      16  0.0012   13.1   1.9   19  484-502   266-284 (307)
 20 d1g62a_ d.126.1.1 (A:) Ribosom  23.0      16  0.0012   13.1   1.4   21  425-445     9-29  (224)
 21 d1ub9a_ a.4.5.28 (A:) Hypothet  22.7      17  0.0012   13.0   6.6   52  447-500    43-94  (100)
 22 d1n8yc1 c.10.2.5 (C:1-165) Pro  21.0     8.1 0.00059   15.1  -0.4   27  438-464    60-86  (165)
 23 d1ykwa1 c.1.14.1 (A:146-428) R  20.6      18  0.0013   12.7   2.1   18  484-501   248-265 (283)
 24 d1dgsa3 d.142.2.2 (A:1-314) Ad  20.1      15  0.0011   13.3   0.8   13  362-374   164-176 (314)

No 1  
>d1udsa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]}
Probab=66.79  E-value=3.3  Score=17.89  Aligned_cols=61  Identities=13%  Similarity=0.057  Sum_probs=44.9

Q ss_pred             CCCCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECC-CCEEE--EEECCCCCHHHHHHHHHHH
Q ss_conf             63110016746982899817882568877999730781168788379-96789--9961587689999999999
Q gi|254780612|r  426 VLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS-GQKIL--FTIDKGKKGADIFKSAIMQ  496 (503)
Q Consensus       426 ~~l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~n-grra~--~~~ekg~~g~~~f~~a~~~  496 (503)
                      .++.++.|=+-||.|++=|+. .+         .+.+++|+.++... |+-..  ++-|+|.--+.-|.++|..
T Consensus         7 ~~VaAVsvG~idg~~vldp~~-~E---------d~~~~~dl~va~t~~g~~~ei~~~~e~~~~see~~~eal~~   70 (105)
T d1udsa2           7 DFVAAVSVGIVNDRILLDLNF-EE---------DSAAQVDMNVVGTGSGRLSEVHTMGEEYSFTKDELIKMLDL   70 (105)
T ss_dssp             CCEEEEEEEEETTEEEESCCH-HH---------HHTCSEEEEEEEETTSCEEEEEEEESSCCCCHHHHHHHHHH
T ss_pred             CCCEEEEEEEECCEEEECCCH-HH---------HHCCCCCEEEEEECCCCCHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             883499999999998646888-88---------84376532699716874046644522456559999999999


No 2  
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
Probab=55.26  E-value=2.2  Score=19.03  Aligned_cols=12  Identities=33%  Similarity=0.512  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             899999999998
Q gi|254780612|r  486 GADIFKSAIMQW  497 (503)
Q Consensus       486 g~~~f~~a~~~w  497 (503)
                      |.....+++..|
T Consensus       231 ~~~~i~~~l~~y  242 (249)
T d1e5da2         231 GADQCTFAVQKY  242 (249)
T ss_dssp             SHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHH
T ss_conf             978899999999


No 3  
>d2hevf1 b.22.1.1 (F:58-183) Tumor necrosis factor ligand superfamily member 4,  OX40L {Human (Homo sapiens) [TaxId: 9606]}
Probab=53.95  E-value=1.3  Score=20.70  Aligned_cols=37  Identities=35%  Similarity=0.517  Sum_probs=28.0

Q ss_pred             ECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCC
Q ss_conf             4698289981788256887799973078116878837996789996158
Q gi|254780612|r  435 ISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKG  483 (503)
Q Consensus       435 v~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg  483 (503)
                      =.||||||-|...-.-            =+.|-|-|+|||--|..+-|+
T Consensus        39 ~CDG~YlisLKG~fsq------------elsi~L~yrkg~~Pl~~Ln~~   75 (126)
T d2hevf1          39 NCDGFYLISLKGYFSQ------------EVDISLHYQKDEEPLFQLKKV   75 (126)
T ss_dssp             CBCEEEEEEEEEEEEE------------EEEEEEESSTTSCCSEEEEEE
T ss_pred             ECCCEEEEEEEEEECC------------EEEEEEEEECCCCCHHHHCCC
T ss_conf             5696699999666233------------047999985699860101355


No 4  
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}
Probab=50.02  E-value=1.9  Score=19.47  Aligned_cols=41  Identities=15%  Similarity=0.293  Sum_probs=20.5

Q ss_pred             HHHHHHHHHCCCCEEEE-EEECCCCEEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             88779997307811687-88379967899961587689999999999852
Q gi|254780612|r  451 PFRNSKILEEYRFIDIP-ITYRSGQKILFTIDKGKKGADIFKSAIMQWEN  499 (503)
Q Consensus       451 ~~~n~~ll~~~~w~dip-~~y~ngrra~~~~ekg~~g~~~f~~a~~~w~~  499 (503)
                      ..+.|..|+.++ +|+= |+-.-|.  +  | +|. .++++ +.+..|.-
T Consensus       206 ~~~~l~~l~~l~-l~~~~i~PgHGp--v--~-~~~-~~~~l-~~y~~w~~  247 (249)
T d1ycga2         206 ITKKLDEIQKIN-LAIKTIAPSHGI--I--W-RKD-PGRII-EAYARWAE  247 (249)
T ss_dssp             HHHHHHHHHHTT-CCCSEEEESSSC--B--B-CSC-HHHHH-HHHHHHHH
T ss_pred             HHHHHHHHHCCC-CCCCEEEECCCC--H--H-HCC-HHHHH-HHHHHHHH
T ss_conf             999999997069-998999908980--4--7-479-99999-99999972


No 5  
>d2hewf1 b.22.1.1 (F:58-185) Tumor necrosis factor ligand superfamily member 4,  OX40L {Mouse (Mus musculus) [TaxId: 10090]}
Probab=46.91  E-value=2.6  Score=18.60  Aligned_cols=37  Identities=24%  Similarity=0.407  Sum_probs=25.4

Q ss_pred             ECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEE--EECCC
Q ss_conf             46982899817882568877999730781168788379967899--96158
Q gi|254780612|r  435 ISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILF--TIDKG  483 (503)
Q Consensus       435 v~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~--~~ekg  483 (503)
                      =.||||||-|...-.-            -+.|=|-|+|||--+.  .+-|+
T Consensus        40 ~CDG~YlisLKG~fsq------------elsi~L~yrkg~~p~~~p~ln~~   78 (128)
T d2hewf1          40 KCDGLYIIYLKGSFFQ------------EVKIDLHFREDHNPISIPMLNDG   78 (128)
T ss_dssp             CBCEEEEEEEEEEESS------------CCCEEEECCTTSCCEEECCCTTS
T ss_pred             ECCCEEEEEEEEEECC------------EEEEEEEEECCCCCCCHHHHCCC
T ss_conf             5696699999666133------------04799988368885320121466


No 6  
>d1t1ua1 c.43.1.3 (A:20-401) Choline O-acetyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=45.18  E-value=7.2  Score=15.48  Aligned_cols=119  Identities=17%  Similarity=0.212  Sum_probs=63.5

Q ss_pred             EEEECCCCCEEEEEEECCCCCCCCCE-EEEEEE----EEECCC-CCCCC-----H-HHCCCCEEC-CCCCCCCCCCCCEE
Q ss_conf             76307877717999951789877781-288999----971688-88732-----1-103231021-33212466311001
Q gi|254780612|r  366 GDIPMIDNAFSASMTLKCNADISLSI-THVMEI----MFSFPK-ESQDA-----V-VDLRRISMR-KTDNSPSVLIDSNI  432 (503)
Q Consensus       366 a~i~iP~~~~~~~~~~rrn~d~slpa-sh~~e~----~f~~~~-~~~~~-----v-~~v~~~~~k-~~e~~~g~~l~~~~  432 (503)
                      +..=||..+.--   |+++++...|. .|||=|    .|.+.= +.|+-     | .+++.|... .+++.++.++..+.
T Consensus       151 ~t~RiP~~~~D~---l~~~~~~~~~~~~HIvVl~~g~~y~v~v~~~~~~l~~~ei~~~l~~I~~~~~~~~~~~~~ig~LT  227 (382)
T d1t1ua1         151 SSYRLPGHTQDT---LVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLT  227 (382)
T ss_dssp             TEEEECCSSSCE---EEECCCSSSSCCCEEEEEETTEEEEEESEETTEECCHHHHHHHHHHHHHHHTCSTTCCCCGGGGG
T ss_pred             CCEECCCCCCCE---EEECCCCCCCCCCEEEEEECCEEEEEEEEECCEECCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             867056899874---66557677889877999989989999999899068899999999999962445555688845055


Q ss_pred             -----------------------E-EECCCEEEEECCCCC----HHHHHHHHHHHC--------CCCEEEE---EEECCC
Q ss_conf             -----------------------6-746982899817882----568877999730--------7811687---883799
Q gi|254780612|r  433 -----------------------F-VISKNSYLISLKGSE----EDPFRNSKILEE--------YRFIDIP---ITYRSG  473 (503)
Q Consensus       433 -----------------------~-kv~~~~f~v~l~~~~----~~~~~n~~ll~~--------~~w~dip---~~y~ng  473 (503)
                                             . .|.--.|.|.|-+..    .+..+..++|..        --|+|-.   ||++||
T Consensus       228 ~~~Rd~Wa~~r~~L~~~~~N~~~L~~Ie~alfvv~LDd~~~~~~~e~~~~~~~l~g~~~~~~~~NRW~DKslq~IV~~nG  307 (382)
T d1t1ua1         228 SDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDG  307 (382)
T ss_dssp             GSCHHHHHHHHHHHTTSHHHHHHHHHHHTCSCEEEECCCCSSCCCHHHHHHHHHHTTSTTTTTTSCCTTBSEEEEECTTS
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHHHHHHHHCEEEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCC
T ss_conf             58719999999998559615899999986648999279998870168999998617877899861067787379997898


Q ss_pred             CEEEEEECCCCCHH
Q ss_conf             67899961587689
Q gi|254780612|r  474 QKILFTIDKGKKGA  487 (503)
Q Consensus       474 rra~~~~ekg~~g~  487 (503)
                      +-+++.=-=+..|-
T Consensus       308 ~~g~~~EHS~~DG~  321 (382)
T d1t1ua1         308 TCGVVCEHSPFDGI  321 (382)
T ss_dssp             CEEEEECSTTCCHH
T ss_pred             CEEEECCCCCCCHH
T ss_conf             68985046762499


No 7  
>d1nm8a1 c.43.1.3 (A:9-385) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
Probab=43.32  E-value=6.7  Score=15.71  Aligned_cols=61  Identities=23%  Similarity=0.373  Sum_probs=38.3

Q ss_pred             ECCCEEEEECCCC----CHHHHHHH---HHHHCC--------CCEEEE---EEECCCCEEEEEECCCCCH---HHHHHHH
Q ss_conf             4698289981788----25688779---997307--------811687---8837996789996158768---9999999
Q gi|254780612|r  435 ISKNSYLISLKGS----EEDPFRNS---KILEEY--------RFIDIP---ITYRSGQKILFTIDKGKKG---ADIFKSA  493 (503)
Q Consensus       435 v~~~~f~v~l~~~----~~~~~~n~---~ll~~~--------~w~dip---~~y~ngrra~~~~ekg~~g---~~~f~~a  493 (503)
                      |..-.|+|.|-+.    ..+..++.   ++|-+-        -|+|-.   ||++||+-+++-=-=...|   -+.++.+
T Consensus       250 Iesalfvv~LDd~~p~~~~e~~~~~~~~~~lhG~g~~~~~~NRW~DKs~q~IV~~nG~~g~~~EHS~~DG~~v~~~~~~v  329 (377)
T d1nm8a1         250 IQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYV  329 (377)
T ss_dssp             HHHSSCEEEEECCCSCCCSTTHHHHHHHHHHHCSCTTTTTTSCCTTBSEEEEEETTSCEEEEECTTSCCHHHHHHHHHHH
T ss_pred             HHHCEEEEEECCCCCCCCCHHHHHHHHHHHEECCCCCCCCCCCCCCCCEEEEEECCCCEEEECCCCCCCHHHHHHHHHHH
T ss_conf             97547888833788888613666666555033687557987726665517999789877862267761289999999999


Q ss_pred             HH
Q ss_conf             99
Q gi|254780612|r  494 IM  495 (503)
Q Consensus       494 ~~  495 (503)
                      +.
T Consensus       330 ~~  331 (377)
T d1nm8a1         330 IE  331 (377)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             98


No 8  
>d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit,  IlvH {Escherichia coli [TaxId: 562]}
Probab=36.48  E-value=9.7  Score=14.58  Aligned_cols=51  Identities=20%  Similarity=0.230  Sum_probs=40.3

Q ss_pred             CCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCC
Q ss_conf             11001674698289981788256887799973078116878837996789996158
Q gi|254780612|r  428 IDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKG  483 (503)
Q Consensus       428 l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg  483 (503)
                      .-|-.+-+++++|+|=|++.....+.-+.+|+..+  +|-=+-++|+-||   .||
T Consensus        31 f~a~ivd~~~~~~iie~tG~~~~id~fi~~l~~~g--~I~EivRSG~iai---~rg   81 (86)
T d2f1fa2          31 FRGQIIDVTPSLYTVQLAGTSGKLDAFLASIRDVA--KIVEVARSGVVGL---SRG   81 (86)
T ss_dssp             TTCEEEEECSSEEEEEEEECHHHHHHHHHHHTTTS--EEEEEEECCCEEE---EST
T ss_pred             CCEEEEECCCCEEEEEEECCHHHHHHHHHHHHCCC--CEEEEECCCHHHH---HCC
T ss_conf             38199985699899999689999999999860429--7899973787551---146


No 9  
>d2pc6a1 d.58.18.6 (A:78-163) Acetolactate synthase small subunit,  IlvH {Nitrosomonas europaea [TaxId: 915]}
Probab=34.54  E-value=10  Score=14.37  Aligned_cols=47  Identities=21%  Similarity=0.173  Sum_probs=38.0

Q ss_pred             CCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCEEEE
Q ss_conf             10016746982899817882568877999730781168788379967899
Q gi|254780612|r  429 DSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILF  478 (503)
Q Consensus       429 ~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~  478 (503)
                      -|-.+-+++++|+|=|++.....+.-+.+|+..+   |-=+-+.|+-||-
T Consensus        32 ~a~ivd~~~~~~iie~tG~~~~id~fi~~l~~~g---i~Ei~RSG~vai~   78 (86)
T d2pc6a1          32 RGNIIDVTNELYTIELTGTRSKLDGFLQAVDCNL---ILEIARTGVSGLS   78 (86)
T ss_dssp             TCEEEEEETTEEEEEEEECHHHHHHHHHHSCGGG---EEEEEECCCEEEE
T ss_pred             CCEEEECCCCEEEEEEECCHHHHHHHHHHHCCCC---CEEEEECCHHHHH
T ss_conf             9589984798599999689899999999744318---7899944885621


No 10 
>d1in0a2 d.58.49.1 (A:90-163) Hypothetical protein HI1034 {Haemophilus influenzae [TaxId: 727]}
Probab=31.30  E-value=5.3  Score=16.39  Aligned_cols=28  Identities=11%  Similarity=0.208  Sum_probs=23.1

Q ss_pred             CCCHHHHHHHHHHHCCCCEEEEEEECCCC
Q ss_conf             88256887799973078116878837996
Q gi|254780612|r  446 GSEEDPFRNSKILEEYRFIDIPITYRSGQ  474 (503)
Q Consensus       446 ~~~~~~~~n~~ll~~~~w~dip~~y~ngr  474 (503)
                      -...|.+.=+.|||+.+ |++||.|.|=|
T Consensus        46 KkrDdLQ~vi~llk~~d-~~~pLQF~NfR   73 (74)
T d1in0a2          46 KSRDDLQAVIQLVKSAE-LGQPFQFNNFR   73 (74)
T ss_dssp             SCHHHHHHHHHHHHHSC-CSSCCEEEEEE
T ss_pred             CCHHHHHHHHHHHHHCC-CCCCEEECCCC
T ss_conf             88799999999998327-69970342578


No 11 
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}
Probab=30.71  E-value=9.4  Score=14.70  Aligned_cols=48  Identities=19%  Similarity=0.291  Sum_probs=31.9

Q ss_pred             CHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             25688779997307811687883799678999615876899999999998522
Q gi|254780612|r  448 EEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENR  500 (503)
Q Consensus       448 ~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg~~g~~~f~~a~~~w~~~  500 (503)
                      ..|.+.|-.|.+..+ ++||+++-||+-.+    .|.--+.-+.++|..=.++
T Consensus        50 ~vd~~~~~~l~~~y~-~~VPvl~idg~~~~----~g~~d~~~L~~~L~~l~~~   97 (100)
T d1wjka_          50 DITLPENSTWYERYK-FDIPVFHLNGQFLM----MHRVNTSKLEKQLRKLSGP   97 (100)
T ss_dssp             ETTSSTTHHHHHHSS-SSCSEEEESSSEEE----ESSCCHHHHHHHHHSSSCS
T ss_pred             ECCCCCCHHHHHHHC-CCCCCEEECCCEEE----ECCCCHHHHHHHHHHHHCC
T ss_conf             635645799999856-65773364696479----6789999999999997667


No 12 
>d1xl7a1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]}
Probab=30.47  E-value=10  Score=14.45  Aligned_cols=129  Identities=13%  Similarity=0.080  Sum_probs=63.4

Q ss_pred             EEEECCCCCEEEEEEECCCCCCCCCEEEEEEE----EEECCC-CCC-----CCH-HHCCCCEECCCCCCCCCCCCCEE--
Q ss_conf             76307877717999951789877781288999----971688-887-----321-10323102133212466311001--
Q gi|254780612|r  366 GDIPMIDNAFSASMTLKCNADISLSITHVMEI----MFSFPK-ESQ-----DAV-VDLRRISMRKTDNSPSVLIDSNI--  432 (503)
Q Consensus       366 a~i~iP~~~~~~~~~~rrn~d~slpash~~e~----~f~~~~-~~~-----~~v-~~v~~~~~k~~e~~~g~~l~~~~--  432 (503)
                      +..=||..+.--.+.+-++....-..+||+=|    .|.++= +.|     .-| ..++.|..+.+++..|.+|..+.  
T Consensus       154 ~t~RiPg~~~D~~~~~~~~~~~~~~~~HIvVl~~g~~ykv~v~~~~~~~s~~el~~~l~~I~~~~~~~~~~~~vg~LTt~  233 (382)
T d1xl7a1         154 STCKVPGITRDSIMNYFKTESEGHCPTHIAVLCRGRAFVFDVLHEGCLITPPELLRQLTYIHKKCSNEPVGPSIAALTSE  233 (382)
T ss_dssp             SEEEECCSSCCEEEECCCCTTTCCCCCEEEEEETTEEEEEESEETTEECCHHHHHHHHHHHHHHHHTSCCCCCGGGGGGS
T ss_pred             CCEECCCCCCCCEEECCCCCCCCCCCCEEEEEECCCEEEEEEEECCEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             27716899877200235555678988669999789308999932990888999999999999735467888775506765


Q ss_pred             ----------------------E-EECCCEEEEECCCCCH-----HHHHHHHHHHC----CCCEEEE---EEECCCCEEE
Q ss_conf             ----------------------6-7469828998178825-----68877999730----7811687---8837996789
Q gi|254780612|r  433 ----------------------F-VISKNSYLISLKGSEE-----DPFRNSKILEE----YRFIDIP---ITYRSGQKIL  477 (503)
Q Consensus       433 ----------------------~-kv~~~~f~v~l~~~~~-----~~~~n~~ll~~----~~w~dip---~~y~ngrra~  477 (503)
                                            . .|-.-.|+|-|-+...     +...=++.|..    --|+|-+   ||++||+-++
T Consensus       234 ~Rd~WA~~R~~L~~~~~~N~~~L~~Ie~AlfvvcLD~~~~~~~~e~~~~~~~~~l~G~~~NRW~DKs~q~IV~~nG~~G~  313 (382)
T d1xl7a1         234 ERTRWAKAREYLISLDPENLTLLEKIQTSLFVYSIEDSSPHATPEEYSQVFEMLLGGDPSVRWGDKSYNLISFANGIFGC  313 (382)
T ss_dssp             CHHHHHHHHHHHHHHCHHHHHHHHHHHHSSCEEEECCCCCCCCSSCCHHHHHHHHSSCGGGCCTTBSCEEEECTTSCEEE
T ss_pred             CCHHHHHHHHHHHHCCHHHHHHHHHHHHCEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCEEE
T ss_conf             64799999999761784269999998744688861356888985899999996385987332776671389968988898


Q ss_pred             EEECCCCCH---HHHHHHHH
Q ss_conf             996158768---99999999
Q gi|254780612|r  478 FTIDKGKKG---ADIFKSAI  494 (503)
Q Consensus       478 ~~~ekg~~g---~~~f~~a~  494 (503)
                      +-=-=+..|   -+.++..+
T Consensus       314 ~~EHS~~DG~~~~~l~~~i~  333 (382)
T d1xl7a1         314 CCDHAPYDAMVMVNIAHYVD  333 (382)
T ss_dssp             EECSSSCCTHHHHHHHHHHH
T ss_pred             EEECCCHHHHHHHHHHHHHH
T ss_conf             73687166999999999999


No 13 
>d1uwka_ e.51.1.1 (A:) Urocanate hydratase HutU {Pseudomonas putida [TaxId: 303]}
Probab=30.22  E-value=8.8  Score=14.89  Aligned_cols=29  Identities=24%  Similarity=0.483  Sum_probs=22.4

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHCC--------CCEEE
Q ss_conf             828998178825688779997307--------81168
Q gi|254780612|r  438 NSYLISLKGSEEDPFRNSKILEEY--------RFIDI  466 (503)
Q Consensus       438 ~~f~v~l~~~~~~~~~n~~ll~~~--------~w~di  466 (503)
                      =|=||+||..++|..+-=+++++.        .||+.
T Consensus       357 PFRWValSGdpeDi~~TD~~~~e~fp~~~~l~rWI~~  393 (554)
T d1uwka_         357 PFRWAALSGEAEDIYKTDAKVKELIPDDAHLHRWLDM  393 (554)
T ss_dssp             CEEEEETTCCHHHHHHHHHHHHHHSTTCHHHHHHHHH
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             8613551588442256679998767421778899998


No 14 
>d1vqos1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
Probab=27.75  E-value=13  Score=13.61  Aligned_cols=54  Identities=6%  Similarity=0.140  Sum_probs=45.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEC-CC-CEEEEEECCCCCHHHHHHH
Q ss_conf             289981788256887799973078116878837-99-6789996158768999999
Q gi|254780612|r  439 SYLISLKGSEEDPFRNSKILEEYRFIDIPITYR-SG-QKILFTIDKGKKGADIFKS  492 (503)
Q Consensus       439 ~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~-ng-rra~~~~ekg~~g~~~f~~  492 (503)
                      -|+|..+....+..+-+..|=.-.=++|=.... +| +||+++|.+|..-.++++.
T Consensus        25 ~F~V~~~A~K~~IK~AVe~lf~VkV~~Vnt~~~~~~~KkA~V~L~~~~~a~dia~k   80 (81)
T d1vqos1          25 QFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR   80 (81)
T ss_dssp             EEEECTTCCHHHHHHHHHHHHCCCEEEEEEEECTTSSEEEEEEECTTSCHHHHHTT
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEECCCCCHHHHHHC
T ss_conf             99976858989999999998499301899767389957899994899968999735


No 15 
>d1r6la2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=27.30  E-value=14  Score=13.56  Aligned_cols=61  Identities=11%  Similarity=0.034  Sum_probs=40.8

Q ss_pred             CCCCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECC-CCEEEEEEC--CCCCHHHHHHHHHHH
Q ss_conf             63110016746982899817882568877999730781168788379-967899961--587689999999999
Q gi|254780612|r  426 VLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRS-GQKILFTID--KGKKGADIFKSAIMQ  496 (503)
Q Consensus       426 ~~l~~~~~kv~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~n-grra~~~~e--kg~~g~~~f~~a~~~  496 (503)
                      .+++++.|=+-||.|++=|+..+ |         ..+..|++++-.. |+..+|-++  +..--++.|.+||..
T Consensus         7 ~~VaavsvG~idg~~vld~~~~E-~---------~~~~~Dl~va~t~~g~i~~iq~~ge~~~~sed~~~~al~~   70 (88)
T d1r6la2           7 QMVAAVSVGIYQGVPVLDLDYLE-D---------SAAETDLNVVMTDAGGFIEVQGTAEGAPFRPAELNAMLEL   70 (88)
T ss_dssp             CCEEEEEEEEETTEEEESCCHHH-H---------HHCSEEEEEEEETTSCEEEEEEEESSSCCCHHHHHHHHHH
T ss_pred             CCCCEEEEEEECCEEEECCCHHH-H---------CCCCEEEEEEEECCCCEEEEHHHCCCCCCCHHHHHHHHHH
T ss_conf             87539999999988985585776-3---------0574669999958997875412066689799999999999


No 16 
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
Probab=24.80  E-value=15  Score=13.25  Aligned_cols=79  Identities=15%  Similarity=0.146  Sum_probs=48.4

Q ss_pred             CCCCEECCCCCCCCCCCCCEE---EEECCCEEEEECCCCCHHHHHHHHHHHC-CCCEEEEEEECCCCEEEEE----ECCC
Q ss_conf             323102133212466311001---6746982899817882568877999730-7811687883799678999----6158
Q gi|254780612|r  412 LRRISMRKTDNSPSVLIDSNI---FVISKNSYLISLKGSEEDPFRNSKILEE-YRFIDIPITYRSGQKILFT----IDKG  483 (503)
Q Consensus       412 v~~~~~k~~e~~~g~~l~~~~---~kv~~~~f~v~l~~~~~~~~~n~~ll~~-~~w~dip~~y~ngrra~~~----~ekg  483 (503)
                      |+++.+|. ..--|+|+.-+-   -.=.|.+|+|-|+........|+.+++. ..-+++||.|..|=|.+=.    |+.|
T Consensus        18 Vk~~~~~~-~~~~gdP~~~a~~~~~~g~dei~ivDld~~~~~~~~~~~~i~~i~~~~~~pi~vgGGIr~~e~i~~~l~~G   96 (253)
T d1thfd_          18 VKGSNFEN-LRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFTVGGGIHDFETASELILRG   96 (253)
T ss_dssp             CCCSCCTT-SSCTTCHHHHHHHHHHTTCCEEEEEESSCSSSHHHHHHHHHHHHHTTCCSCEEEESSCCSHHHHHHHHHTT
T ss_pred             EECCCCCE-EEECCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCCEEECCCCCCHHHHHHHHCC
T ss_conf             97777761-48898999999999986999899975213224763479999999841573002430300012446678628


Q ss_pred             ----CCHHHHHH
Q ss_conf             ----76899999
Q gi|254780612|r  484 ----KKGADIFK  491 (503)
Q Consensus       484 ----~~g~~~f~  491 (503)
                          .-|..+|+
T Consensus        97 a~kviigs~~~~  108 (253)
T d1thfd_          97 ADKVSINTAAVE  108 (253)
T ss_dssp             CSEEEESHHHHH
T ss_pred             CCEEEECHHHHH
T ss_conf             989998748850


No 17 
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]}
Probab=24.78  E-value=15  Score=13.25  Aligned_cols=31  Identities=3%  Similarity=0.145  Sum_probs=26.4

Q ss_pred             EEEEECCCCEEEEEECCCCCHHHHHHHHHHH
Q ss_conf             8788379967899961587689999999999
Q gi|254780612|r  466 IPITYRSGQKILFTIDKGKKGADIFKSAIMQ  496 (503)
Q Consensus       466 ip~~y~ngrra~~~~ekg~~g~~~f~~a~~~  496 (503)
                      |-+.+.||||+.+-...|..=-++..+|..-
T Consensus         3 V~Vl~~~~rR~~VKvtP~t~l~~VL~eaC~k   33 (76)
T d2al3a1           3 VSVLAPNGRRHTVKVTPSTVLLQVLEDTCRR   33 (76)
T ss_dssp             EEEECTTSCEEEECCCTTSBHHHHHHHHHHH
T ss_pred             EEEECCCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             8998789968899728985899999999998


No 18 
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]}
Probab=23.62  E-value=16  Score=13.11  Aligned_cols=42  Identities=29%  Similarity=0.345  Sum_probs=30.2

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCC-EEEEEE
Q ss_conf             698289981788256887799973078116878837996-789996
Q gi|254780612|r  436 SKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQ-KILFTI  480 (503)
Q Consensus       436 ~~~~f~v~l~~~~~~~~~n~~ll~~~~w~dip~~y~ngr-ra~~~~  480 (503)
                      +..++.|-.+   .....=+.+|++...--+|+|..||| .+|||.
T Consensus        67 ~~~~~~~~~~---~~l~~a~~~m~~~~~~~lpVVd~~g~lvGiiT~  109 (126)
T d1zfja4          67 SEHLVTAAVG---TDLETAERILHEHRIEKLPLVDNSGRLSGLITI  109 (126)
T ss_dssp             CSCCCCEETT---CCHHHHHHHHHHTTCSEEEEECTTSBEEEEEEH
T ss_pred             CCCEEECCCC---CCHHHHHHHHHHCCCCEEEEECCCCEEEEEEEH
T ss_conf             1440305799---879999999996198479898589959999989


No 19 
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]}
Probab=23.58  E-value=16  Score=13.10  Aligned_cols=19  Identities=21%  Similarity=0.116  Sum_probs=15.7

Q ss_pred             CCHHHHHHHHHHHHHHCCC
Q ss_conf             7689999999999852236
Q gi|254780612|r  484 KKGADIFKSAIMQWENRSN  502 (503)
Q Consensus       484 ~~g~~~f~~a~~~w~~~~~  502 (503)
                      ..|-++|.+|+.+|....+
T Consensus       266 aaGa~A~RqA~ea~~~g~~  284 (307)
T d1geha1         266 AAGARAVRQAIDAIMQGIP  284 (307)
T ss_dssp             HHHHHHHHHHHHHHTSSCC
T ss_pred             HHHHHHHHHHHHHHHHCCC
T ss_conf             8889999999999984999


No 20 
>d1g62a_ d.126.1.1 (A:) Ribosome anti-association factor eIF6 (aIF6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=22.99  E-value=16  Score=13.11  Aligned_cols=21  Identities=5%  Similarity=-0.042  Sum_probs=9.1

Q ss_pred             CCCCCCEEEEECCCEEEEECC
Q ss_conf             663110016746982899817
Q gi|254780612|r  425 SVLIDSNIFVISKNSYLISLK  445 (503)
Q Consensus       425 g~~l~~~~~kv~~~~f~v~l~  445 (503)
                      |++-+|+=.++||+|-||...
T Consensus         9 gs~~IGVf~~~t~~~~lvp~~   29 (224)
T d1g62a_           9 NSNEIGVFSKLTNTYCLVAVG   29 (224)
T ss_dssp             TBCCHHHHEEECSSCEEEETT
T ss_pred             CCCCEEEEEEEECCEEEECCC
T ss_conf             888668999980779998599


No 21 
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
Probab=22.67  E-value=17  Score=12.98  Aligned_cols=52  Identities=10%  Similarity=0.087  Sum_probs=41.3

Q ss_pred             CCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             825688779997307811687883799678999615876899999999998522
Q gi|254780612|r  447 SEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENR  500 (503)
Q Consensus       447 ~~~~~~~n~~ll~~~~w~dip~~y~ngrra~~~~ekg~~g~~~f~~a~~~w~~~  500 (503)
                      ...-..++|.-|.+.+||..=-...++|+-++.|=  ..|.+.|++.+..|..-
T Consensus        43 s~~~vs~~l~~L~~~glV~~~~~~~d~r~~~~~LT--~~G~~~~~~~~~~~~~~   94 (100)
T d1ub9a_          43 TPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEIT--DFGMEEAKRFLSSLKAV   94 (100)
T ss_dssp             CHHHHHHHHHHHHHTTSEEEEEECSSSCEEEEEEC--HHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHCEEEEEECCCCCCCCCCCCC--HHHHHHHHHHHHHHHHH
T ss_conf             54323099998823103688875767765345578--99999999999999999


No 22 
>d1n8yc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=20.99  E-value=8.1  Score=15.14  Aligned_cols=27  Identities=15%  Similarity=0.285  Sum_probs=9.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCE
Q ss_conf             828998178825688779997307811
Q gi|254780612|r  438 NSYLISLKGSEEDPFRNSKILEEYRFI  464 (503)
Q Consensus       438 ~~f~v~l~~~~~~~~~n~~ll~~~~w~  464 (503)
                      ||.+|.-|.+.-....||.+.|++.++
T Consensus        60 GyL~I~~~~~~l~~l~nL~vIrG~~l~   86 (165)
T d1n8yc1          60 GYMLIAHNQVKRVPLQRLRIVRGTQLF   86 (165)
T ss_dssp             SCEEEESCCCSCCCCTTCCEECCSSCB
T ss_pred             EEEEEEEECCCCCCCCCCCEECCCCCC
T ss_conf             699999700331105686888585453


No 23 
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
Probab=20.64  E-value=18  Score=12.70  Aligned_cols=18  Identities=28%  Similarity=0.233  Sum_probs=15.4

Q ss_pred             CCHHHHHHHHHHHHHHCC
Q ss_conf             768999999999985223
Q gi|254780612|r  484 KKGADIFKSAIMQWENRS  501 (503)
Q Consensus       484 ~~g~~~f~~a~~~w~~~~  501 (503)
                      ..|-+||.+|+.+|.+..
T Consensus       248 ~aGa~A~rqA~ea~~~g~  265 (283)
T d1ykwa1         248 KAGAKSIRQAWEAIEQGI  265 (283)
T ss_dssp             HHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHCCC
T ss_conf             878999999999998299


No 24 
>d1dgsa3 d.142.2.2 (A:1-314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]}
Probab=20.08  E-value=15  Score=13.30  Aligned_cols=13  Identities=31%  Similarity=0.473  Sum_probs=5.8

Q ss_pred             CEEEEEEECCCCC
Q ss_conf             4236763078777
Q gi|254780612|r  362 LVIKGDIPMIDNA  374 (503)
Q Consensus       362 ~aira~i~iP~~~  374 (503)
                      ..|||+|-|+-..
T Consensus       164 l~IRGEl~i~~~~  176 (314)
T d1dgsa3         164 LEVRGEVYMPIEA  176 (314)
T ss_dssp             EEEEEEEECCHHH
T ss_pred             CEEEEEEEEECCH
T ss_conf             0663027852312


Done!