RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] (503 letters) >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} (A:119-491) Length = 373 Score = 32.6 bits (72), Expect = 0.12 Identities = 5/47 (10%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Query: 48 EILERQFNKLEQAILQVEKQNQKSLHT-SKQDKESDIPKSSVTSKEN 93 L+++ I ++ Q+ + + + + DI + Sbjct: 3 VTLKQRVATQVNRIKALQNSIQEQVVEMKRLEVDIDIKIRACKGSCA 49 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 30.9 bits (70), Expect = 0.35 Identities = 10/31 (32%), Positives = 14/31 (45%), Gaps = 6/31 (19%) Query: 390 SITHVMEIMFSFPKESQDAVVDLRRISMRKT 420 S+ VM I ES VV R ++M+ Sbjct: 1 SLADVMSI------ESLVEVVFYRGMTMQVA 25 >2hye_C Cullin-4A, CUL-4A; beta propeller, ring finger, zinc finger, propeller cluster, helical repeats, cullin repeats, protein binding; HET: DNA; 3.10A {Homo sapiens} (C:1-228) Length = 228 Score = 26.9 bits (59), Expect = 6.2 Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 14 NLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQN 68 + ++ V + +PRLP + + KL +A+ V+ Sbjct: 24 PAALAAAPAKPGGAGGSKKLVIKNFR-DRPRLPDNYTQDTWRKLHEAVRAVQSST 77 >3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function, ribonuclease D, exonuclease; 2.10A {Bifidobacterium adolescentis ATCC15703} (A:220-337) Length = 118 Score = 26.8 bits (59), Expect = 6.8 Identities = 4/41 (9%), Positives = 11/41 (26%) Query: 3 DFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKP 43 + + +R + P +I + A + Sbjct: 76 EQDKMFERYAPIQRKIKPSMWKNIIQDALALPPSEWPDVDG 116 >2bmb_A Folic acid synthesis protein FOL1; folate biosynthesis, transferase, ligase, multifunctional enzyme; HET: PMM; 2.3A {Saccharomyces cerevisiae} (A:1-224) Length = 224 Score = 26.7 bits (58), Expect = 7.3 Identities = 13/79 (16%), Positives = 20/79 (25%), Gaps = 14/79 (17%) Query: 10 RAVDNLPENTPERRSHIYEHA----------RNSVARRLESMKPRLPKEILERQFNKLEQ 59 + + S I+E N ++ L L + K+E Sbjct: 41 QLLSREKTVKLRNISSIFESEPMYFKDQTPFMNGCVE----VETLLTPSELLKLCKKIEY 96 Query: 60 AILQVEKQNQKSLHTSKQD 78 LQ K T D Sbjct: 97 EELQRVKHFDNGPRTIDLD 115 >1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase, cobalamin, lyase; 1.46A {Salmonella enterica} (A:1-35,A:261-364) Length = 139 Score = 26.3 bits (58), Expect = 8.2 Identities = 9/83 (10%), Positives = 24/83 (28%), Gaps = 8/83 (9%) Query: 136 FSCRLREILSFSVNTQHEYDSSVSP-VAAIEHDKSRLRRG--KLAGIFSFPTGSIFWSVH 192 ++L FS N + + + + +R + +L + +P + + Sbjct: 19 LGISPDQLLDFSANINPQDSAWQQATWHWLREEGARFYQALCQLPLLTVYPGRANY---- 74 Query: 193 NYFFNKTRGLLSFYSALSEHHLF 215 R + L + Sbjct: 75 -LLLRCEREDIDLQRRLLTQRIL 96 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.134 0.374 Gapped Lambda K H 0.267 0.0649 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 3,537,948 Number of extensions: 154963 Number of successful extensions: 402 Number of sequences better than 10.0: 1 Number of HSP's gapped: 402 Number of HSP's successfully gapped: 9 Length of query: 503 Length of database: 4,956,049 Length adjustment: 92 Effective length of query: 411 Effective length of database: 1,845,989 Effective search space: 758701479 Effective search space used: 758701479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (25.5 bits)