RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] (503 letters) >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Score = 27.0 bits (59), Expect = 3.5 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 7/82 (8%) Query: 341 SILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIM-- 398 ++G L SL + GD+P ++NA A ++ +A + +I H + M Sbjct: 3 IQVNGPRLESLVLTYVNAIS----SGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQ 58 Query: 399 -FSFPKESQDAVVDLRRISMRK 419 P ES ++DL R S R+ Sbjct: 59 KVQLPTESLQELLDLHRDSERE 80 >d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Score = 27.2 bits (59), Expect = 3.5 Identities = 9/29 (31%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Query: 300 FKNYIGGDENSTFVLGKKEIEEGNPLIGE 328 +KNY+ G+ + L + EI+ P G Sbjct: 4 YKNYVNGE----WKLSENEIKIYEPASGA 28 >d3c9ua2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 163 Score = 26.8 bits (58), Expect = 4.1 Identities = 13/86 (15%), Positives = 29/86 (33%), Gaps = 3/86 (3%) Query: 346 KILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKES 405 L Q ++ L K + + + +L +++F+ PKE Sbjct: 77 ADANHLAQRSGVKIEILSEKLPLSNELKMYCEKYGKNPI-EYALFGGEDYQLLFTHPKER 135 Query: 406 QDAVVDLRRISMRKTDNSPSVLIDSN 431 + +D+ I + + V +D Sbjct: 136 WNPFLDMTEIG--RVEEGEGVFVDGK 159 >d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 340 Score = 26.1 bits (57), Expect = 6.5 Identities = 11/43 (25%), Positives = 13/43 (30%), Gaps = 8/43 (18%) Query: 95 FLEPRLRSISSILRSNK-HKKLANILSVQGKSRTNTNLSPKNF 136 FLE ISS+L H L S L+ Sbjct: 6 FLETEPTEISSVLAGGYNHPLLRQWQS-------ERQLTKNML 41 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.134 0.374 Gapped Lambda K H 0.267 0.0444 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,756,188 Number of extensions: 81401 Number of successful extensions: 173 Number of sequences better than 10.0: 1 Number of HSP's gapped: 173 Number of HSP's successfully gapped: 8 Length of query: 503 Length of database: 2,407,596 Length adjustment: 89 Effective length of query: 414 Effective length of database: 1,185,626 Effective search space: 490849164 Effective search space used: 490849164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.7 bits)