BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780614|ref|YP_003065027.1| F0F1 ATP synthase subunit
epsilon [Candidatus Liberibacter asiaticus str. psy62]
         (135 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780614|ref|YP_003065027.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040291|gb|ACT57087.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 135

 Score =  269 bits (688), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE
Sbjct: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120
           EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM
Sbjct: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120

Query: 121 EQLLVDLSCLRRRIQ 135
           EQLLVDLSCLRRRIQ
Sbjct: 121 EQLLVDLSCLRRRIQ 135


>gi|315121814|ref|YP_004062303.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495216|gb|ADR51815.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 140

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           MSL+N  HFELVSP++C+FSGEV+SV+LPSE GD+T LVGH+ VL T+K GI+T+SLSC 
Sbjct: 1   MSLINSFHFELVSPKRCIFSGEVKSVILPSESGDMTALVGHSAVLATMKPGIITVSLSCG 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120
           + HRYVVIGG+CDI+PS CTVL+ET+  +D  CL+ LE R+DE    L +I D DQR Q+
Sbjct: 61  DAHRYVVIGGVCDIMPSRCTVLTETVFSIDQVCLKTLENRMDETRDVLGSIYDSDQRSQL 120

Query: 121 EQLLVDLSCLRRRIQ 135
           EQ LVDLS L  R++
Sbjct: 121 EQFLVDLSYLYSRVR 135


>gi|319780918|ref|YP_004140394.1| ATP synthase F1 subunit epsilon [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166806|gb|ADV10344.1| ATP synthase F1, epsilon subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 135

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 79/132 (59%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S +V+SVV+P   G++TV+  HAPV+TTIK G+VT+  +    
Sbjct: 1   MAEAFKFELVSPERLLVSEQVESVVIPGAEGEMTVMAHHAPVMTTIKPGVVTVKTAAGGE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            RYVV GG  DIVP+ CT+L+E+ + + +     L +RI E   D  +  D + R + EQ
Sbjct: 61  ERYVVFGGFADIVPAGCTLLAESAVAVKDVDRADLARRIQEAKEDATDAKDDEARSKAEQ 120

Query: 123 LLVDLSCLRRRI 134
            L  L+ L   I
Sbjct: 121 FLSQLTTLEGAI 132


>gi|15889876|ref|NP_355557.1| F0F1 ATP synthase subunit epsilon [Agrobacterium tumefaciens str.
           C58]
 gi|22095474|sp|Q8UC77|ATPE_AGRT5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|15157823|gb|AAK88342.1| ATP synthase epsilon chain [Agrobacterium tumefaciens str. C58]
          Length = 136

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 81/131 (61%), Gaps = 1/131 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +   F+LVSPE+ + S  V  VV+P+ LG++TVL  HAP +TTIK G+VT+  +  E 
Sbjct: 1   MADSFKFDLVSPERLLVSETVTEVVIPATLGEMTVLANHAPTMTTIKPGLVTVKFASGET 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRF-QME 121
           H+YVV GG  DI+P+ CT+L+E+ +  D+     L+KRID   +++       +   ++E
Sbjct: 61  HKYVVFGGFADILPTGCTLLAESAVSADDMSPDTLQKRIDAAKAEIQEGNHHHEHLTKLE 120

Query: 122 QLLVDLSCLRR 132
           + L +L+ L  
Sbjct: 121 KHLYELTNLHE 131


>gi|227823625|ref|YP_002827598.1| F0F1 ATP synthase subunit epsilon [Sinorhizobium fredii NGR234]
 gi|254809378|sp|C3M9S0|ATPE_RHISN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|227342627|gb|ACP26845.1| ATP synthase F1, epsilon subunit [Sinorhizobium fredii NGR234]
          Length = 134

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 81/128 (63%), Gaps = 1/128 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +  +FELVSPE+ + S     VV+P+  G++TV+  HAP +TT+K G+VT+  +  + 
Sbjct: 1   MADSFNFELVSPERLLLSASATEVVIPATEGEMTVMANHAPTMTTVKPGVVTVKTADGKT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            R+ V GG  DI+P+ CT+L+E+ + +D      LE RIDE  ++L    D +++ ++EQ
Sbjct: 61  ERFAVFGGFADILPTGCTLLAESAVHVDELDRTVLENRIDEARAELEGAID-EKKTRIEQ 119

Query: 123 LLVDLSCL 130
            + +L+ L
Sbjct: 120 FIAELTTL 127


>gi|15966786|ref|NP_387139.1| F0F1 ATP synthase subunit epsilon [Sinorhizobium meliloti 1021]
 gi|15076058|emb|CAC47612.1| Probable ATP synthase epsilon chain [Sinorhizobium meliloti 1021]
          Length = 136

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 81/130 (62%), Gaps = 1/130 (0%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           M +    +FELVSPE+ + S +V  VV+P+  G++TV+  HAP +TTIK G+V +  +  
Sbjct: 1   MVMAESFNFELVSPERLLVSEKVTEVVIPATEGEMTVMANHAPTMTTIKPGVVAVKTAAG 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120
           +  RY V GG  DI+PS CT+L+E+ + +D      LE RI+   ++L    D +++ ++
Sbjct: 61  KTERYAVFGGFADILPSGCTLLAESAVHVDELDPTVLENRIEAARAELEGAGD-EKKTRL 119

Query: 121 EQLLVDLSCL 130
           EQ + +L+ L
Sbjct: 120 EQFIAELTKL 129


>gi|325293990|ref|YP_004279854.1| F0F1 ATP synthase subunit epsilon [Agrobacterium sp. H13-3]
 gi|325061843|gb|ADY65534.1| F0F1 ATP synthase subunit epsilon [Agrobacterium sp. H13-3]
          Length = 136

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 81/131 (61%), Gaps = 1/131 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +   F+LVSPE+ + S  V  VV+P+ LG++TVL  HAP +TTIK G+VT+  +  E 
Sbjct: 1   MADSFKFDLVSPERLLVSETVTEVVIPATLGEMTVLANHAPTMTTIKPGLVTVKFASGET 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRF-QME 121
           H+YVV GG  DI+P+ CT+L+E+ +  D+     L+KRID   +++       +   ++E
Sbjct: 61  HKYVVFGGFADILPTGCTLLAESAVSADDMSPDTLQKRIDLAKAEIQEGNHHHEHLTKLE 120

Query: 122 QLLVDLSCLRR 132
           + L +L+ L  
Sbjct: 121 KHLYELTNLHE 131


>gi|307301614|ref|ZP_07581373.1| ATP synthase F1, epsilon subunit [Sinorhizobium meliloti BL225C]
 gi|307316362|ref|ZP_07595806.1| ATP synthase F1, epsilon subunit [Sinorhizobium meliloti AK83]
 gi|20137399|sp|Q92LK9|ATPE_RHIME RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|306898202|gb|EFN28944.1| ATP synthase F1, epsilon subunit [Sinorhizobium meliloti AK83]
 gi|306903312|gb|EFN33901.1| ATP synthase F1, epsilon subunit [Sinorhizobium meliloti BL225C]
          Length = 134

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 80/128 (62%), Gaps = 1/128 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +    +FELVSPE+ + S +V  VV+P+  G++TV+  HAP +TTIK G+V +  +  + 
Sbjct: 1   MAESFNFELVSPERLLVSEKVTEVVIPATEGEMTVMANHAPTMTTIKPGVVAVKTAAGKT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            RY V GG  DI+PS CT+L+E+ + +D      LE RI+   ++L    D +++ ++EQ
Sbjct: 61  ERYAVFGGFADILPSGCTLLAESAVHVDELDPTVLENRIEAARAELEGAGD-EKKTRLEQ 119

Query: 123 LLVDLSCL 130
            + +L+ L
Sbjct: 120 FIAELTKL 127


>gi|222150024|ref|YP_002550981.1| F0F1 ATP synthase subunit epsilon [Agrobacterium vitis S4]
 gi|254809341|sp|B9JTR1|ATPE_AGRVS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|221737006|gb|ACM37969.1| ATP synthase C chain [Agrobacterium vitis S4]
          Length = 135

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 80/128 (62%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FE VSPE+ + S +V  VV+P+  G++TV+  HAP +T IK G+VT+  +  + 
Sbjct: 1   MADNFNFEFVSPERLLISEKVSEVVIPATEGEMTVMAHHAPTMTVIKPGVVTVKFASGKT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            +YV+ GG  DI P   T+L+E+ +P+D      L KRI+   ++L++  + + R ++EQ
Sbjct: 61  GKYVIFGGFADITPERLTLLAESAVPVDELSRDTLMKRIELAKAELDDTENHEHRTKLEQ 120

Query: 123 LLVDLSCL 130
            L  ++ L
Sbjct: 121 FLNAMTHL 128


>gi|190893715|ref|YP_001980257.1| ATP synthase, epsilon subunit [Rhizobium etli CIAT 652]
 gi|226740277|sp|B3PQ67|ATPE_RHIE6 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|190698994|gb|ACE93079.1| ATP synthase protein, epsilon subunit [Rhizobium etli CIAT 652]
          Length = 135

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 83/133 (62%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TTIK GIV++     + 
Sbjct: 1   MADNFNFELVSPERLLLSEMVTEVVIPATEGEMTVMAHHAPTMTTIKPGIVSVRSGSGKK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI+P+ CT+L+E+ +P++      L +RI+    +L +    + + ++E 
Sbjct: 61  QDYVVFGGFADILPTGCTLLAESAVPVEELNKDELTRRIEAAKKELEDAVHHEHKSKLEH 120

Query: 123 LLVDLSCLRRRIQ 135
            +++L+ LR  +Q
Sbjct: 121 FILELTHLRGVVQ 133


>gi|222087436|ref|YP_002545973.1| ATP synthase F1, epsilon subunit [Agrobacterium radiobacter K84]
 gi|254809340|sp|B9JBZ4|ATPE_AGRRK RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|221724884|gb|ACM28040.1| ATP synthase F1, epsilon subunit [Agrobacterium radiobacter K84]
          Length = 135

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 85/133 (63%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S +V  VV+P+  G++TV+  HAP +TTIK G+V +  +  + 
Sbjct: 1   MADNFNFELVSPERLLLSEQVIDVVIPASEGEMTVMAHHAPTMTTIKPGVVKVHSASGKK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI+P+ CT+L+E+ +P+++     L +RI+   ++L +    + + ++E 
Sbjct: 61  QDYVVFGGFADILPTGCTLLAESAIPVEDLNQDELTRRINAAKAELEDAEHHEHKSRLEH 120

Query: 123 LLVDLSCLRRRIQ 135
            +++L+ L   IQ
Sbjct: 121 FIMELTHLSGSIQ 133


>gi|260466815|ref|ZP_05813000.1| ATP synthase F1, epsilon subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259029427|gb|EEW30718.1| ATP synthase F1, epsilon subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 135

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 78/132 (59%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S EV+SVV+P   G++TV+  HAPV+TTI+ G+VT+  +    
Sbjct: 1   MAEAFKFELVSPERLLVSAEVESVVIPGAEGEMTVMAHHAPVMTTIQPGVVTVKNASGSE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            RYVV GG  DIVP+ CT+L+E+ + + +     L +RI E   D  +  D   R + EQ
Sbjct: 61  ERYVVFGGFADIVPAGCTLLAESAVAVKDVDRADLARRIQEAKEDAADAKDDQARSKAEQ 120

Query: 123 LLVDLSCLRRRI 134
            L  L+ L   I
Sbjct: 121 FLSQLTTLEGAI 132


>gi|150398118|ref|YP_001328585.1| F0F1 ATP synthase subunit epsilon [Sinorhizobium medicae WSM419]
 gi|166222498|sp|A6UDM0|ATPE_SINMW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|150029633|gb|ABR61750.1| ATP synthase F1, epsilon subunit [Sinorhizobium medicae WSM419]
          Length = 134

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 79/128 (61%), Gaps = 1/128 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +    +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TT++ G+V +  +    
Sbjct: 1   MAETFNFELVSPERLLVSETVTEVVIPATEGEMTVMANHAPTMTTVRPGVVAVKTAAGNT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            RY V GG  DI+P+ CT+L+E+ + +D      LE RI+   ++L    D +++ ++EQ
Sbjct: 61  ERYAVFGGFADILPTGCTLLAESAVHVDELDSTVLENRIEAARAELEGASD-EKKTRLEQ 119

Query: 123 LLVDLSCL 130
           L+ +L+ L
Sbjct: 120 LVAELTKL 127


>gi|13473455|ref|NP_105022.1| F0F1 ATP synthase subunit epsilon [Mesorhizobium loti MAFF303099]
 gi|20137426|sp|Q98EV9|ATPE_RHILO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|14024204|dbj|BAB50808.1| ATP synthase epsilon subunit (atp-9) [Mesorhizobium loti
           MAFF303099]
          Length = 135

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 78/132 (59%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S +V+SVV+P   G++TV+  HAPV+TTIK G+VT+  +    
Sbjct: 1   MAEAFKFELVSPERLLVSEQVESVVIPGAEGEMTVMAHHAPVMTTIKPGVVTVKTASGGE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            RYVV GG  DIVP+ CT+L+E+ + + +     L +RI E   D  +  D   R + EQ
Sbjct: 61  ERYVVFGGFADIVPAGCTLLAESAVAVKDVDRADLARRIQEAKEDAADAKDDQARSKAEQ 120

Query: 123 LLVDLSCLRRRI 134
            L  L+ L   I
Sbjct: 121 FLSQLTTLEGAI 132


>gi|241206623|ref|YP_002977719.1| F0F1 ATP synthase subunit epsilon [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860513|gb|ACS58180.1| ATP synthase F1, epsilon subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 135

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 84/133 (63%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TTIK G+V++  +  + 
Sbjct: 1   MADNFNFELVSPERLLLSEMVTEVVIPATEGEMTVMANHAPTMTTIKPGVVSVRSASGKK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI+P+ CT+L+E+ +P++      L +RI+    +L +    + + ++E 
Sbjct: 61  QDYVVFGGFADILPTGCTLLAESAVPVEELHKDELTRRIEAARKELEHAELHEHKSKLEH 120

Query: 123 LLVDLSCLRRRIQ 135
            +++L+ LR  +Q
Sbjct: 121 FIMELTHLRGVVQ 133


>gi|209551222|ref|YP_002283139.1| F0F1 ATP synthase subunit epsilon [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226740278|sp|B5ZSN5|ATPE_RHILW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|209536978|gb|ACI56913.1| ATP synthase F1, epsilon subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 135

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 84/133 (63%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TTIK G+V++  +  + 
Sbjct: 1   MADNFNFELVSPERLLLSEMVTEVVIPATEGEMTVMAHHAPTMTTIKPGVVSVRSASGKK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI+P+ CT+L+E+ +P++      L +RI+    +L +    + + ++E 
Sbjct: 61  QDYVVFGGFADILPTGCTLLAESAVPVEELHKDELTRRIEAARKELEDTELHEHKSKLEH 120

Query: 123 LLVDLSCLRRRIQ 135
            +++L+ LR  +Q
Sbjct: 121 FIMELTHLRGVVQ 133


>gi|86359450|ref|YP_471342.1| F0F1 ATP synthase subunit epsilon [Rhizobium etli CFN 42]
 gi|119367767|sp|Q2K3H1|ATPE_RHIEC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|86283552|gb|ABC92615.1| ATP synthase protein, epsilon subunit [Rhizobium etli CFN 42]
          Length = 135

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 84/133 (63%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TTIK G+V++  +  + 
Sbjct: 1   MADNFNFELVSPERLLLSEMVTEVVVPATEGEMTVMANHAPTMTTIKPGVVSVRSASGKK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI+P+ CT+L+E+ +P++      L +RI+    +L +    + + ++E 
Sbjct: 61  QDYVVFGGFADILPTGCTLLAESAVPVEELHKDELTRRIEAARKELEHAELHEHKSRLEH 120

Query: 123 LLVDLSCLRRRIQ 135
            +++L+ LR  +Q
Sbjct: 121 FIMELTHLRGIVQ 133


>gi|218660807|ref|ZP_03516737.1| F0F1 ATP synthase subunit epsilon [Rhizobium etli IE4771]
          Length = 135

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 84/133 (63%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TTIK G+V++  +  + 
Sbjct: 1   MADNFNFELVSPERLLLSEMVTEVVIPATEGEMTVMAHHAPTMTTIKPGVVSVRSASGKK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI+P+ CT+L+E+ +P++      L +RI+    +L +    + + ++E 
Sbjct: 61  QDYVVFGGFADILPTGCTLLAESAVPVEELHKDELTRRIEAARKELEHAELHEHKSKLEH 120

Query: 123 LLVDLSCLRRRIQ 135
            +++L+ LR  +Q
Sbjct: 121 FIMELTHLRGIVQ 133


>gi|116254138|ref|YP_769976.1| F0F1 ATP synthase subunit epsilon [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|119367768|sp|Q1MAZ3|ATPE_RHIL3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|115258786|emb|CAK09892.1| putative ATP synthase epsilon chain [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 135

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 82/129 (63%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TTIK G+V++  +  + 
Sbjct: 1   MADNFNFELVSPERLLLSEMVTEVVIPATEGEMTVMANHAPTMTTIKPGVVSVRSASGKK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI+P+ CT+L+E+ +P++      L +RI+    +L +    + + ++E 
Sbjct: 61  QDYVVFGGFADILPTGCTLLAESAVPVEELQKDELTRRIEAARQELEHAELHEHKSKLEH 120

Query: 123 LLVDLSCLR 131
            +++++ LR
Sbjct: 121 FIMEMTHLR 129


>gi|110635548|ref|YP_675756.1| F0F1 ATP synthase subunit epsilon [Mesorhizobium sp. BNC1]
 gi|119367745|sp|Q11DD4|ATPE_MESSB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|110286532|gb|ABG64591.1| ATP synthase F1 subcomplex epsilon subunit [Chelativorans sp. BNC1]
          Length = 135

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 75/128 (58%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S EV+ VV+P   G++TV+  HAPV+T IK G++T+  +  E 
Sbjct: 1   MAKTFTFELVSPERLLLSEEVEQVVIPGTEGEMTVMAEHAPVMTGIKPGVITVVRAGSER 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            ++VV GG  DI P  C +L+E+   +       L +RI+EV +++    D + R + E+
Sbjct: 61  EQFVVFGGFADITPDGCRLLAESATRVKELDRADLARRIEEVRAEVQGARDHETRTKAEE 120

Query: 123 LLVDLSCL 130
            L  L+ L
Sbjct: 121 FLGQLTTL 128


>gi|98971623|gb|ABF59714.1| ATP synthase protein epsilon subunit [Rhizobium leguminosarum bv.
           trifolii TA1]
          Length = 135

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 82/129 (63%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TTIK G+V++  +  + 
Sbjct: 1   MADNFNFELVSPERLLLSEMVTEVVIPATEGEMTVMANHAPTMTTIKPGVVSVRSASGKK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI+P+ CT+L+E+ +P++      L +RI+    +L +    + + ++E 
Sbjct: 61  QDYVVFGGFADILPTGCTLLAESAVPVEELQKDELTRRIEAARLELEHAELHEHKSKLEH 120

Query: 123 LLVDLSCLR 131
            +++++ LR
Sbjct: 121 FIMEMTHLR 129


>gi|217976538|ref|YP_002360685.1| F0F1 ATP synthase subunit epsilon [Methylocella silvestris BL2]
 gi|254809373|sp|B8EQQ2|ATPE_METSB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|217501914|gb|ACK49323.1| ATP synthase F1, epsilon subunit [Methylocella silvestris BL2]
          Length = 133

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 73/118 (61%), Gaps = 1/118 (0%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           D HFELVSPE+ VF+G V+SVV+P   G  TVL  HAP++TT+K G++ I+ S   +HR+
Sbjct: 3   DFHFELVSPERLVFAGAVESVVVPGTEGQFTVLKDHAPLMTTLKPGVIDIAESKALLHRF 62

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNIC-DVDQRFQMEQ 122
            V GG  ++ P+  T+L+E  +P+++     ++  I +   D+ +   D  +R   E+
Sbjct: 63  FVRGGFAEVSPAGLTILAEQAIPLESLDAARIDADIKDAEEDIADASVDETRRLAAEK 120


>gi|323137977|ref|ZP_08073051.1| ATP synthase F1, epsilon subunit [Methylocystis sp. ATCC 49242]
 gi|322396696|gb|EFX99223.1| ATP synthase F1, epsilon subunit [Methylocystis sp. ATCC 49242]
          Length = 133

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 74/128 (57%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HFELVSPEK +FSG+V+SVV P   G  TVL  HAPV+TT+KSG+VT++    ++ +  
Sbjct: 4   FHFELVSPEKLLFSGDVESVVAPGAEGQFTVLKDHAPVMTTLKSGVVTVAGGDGKVEKLF 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  D+  +  T+L+E  +P+    +  ++  + +   DL +    + R    + +V 
Sbjct: 64  VRGGFADVSAAGFTILAELAIPLSEIDVAKVDADLKDAREDLADAKTEEARHAAAEKIVQ 123

Query: 127 LSCLRRRI 134
           L  LR  +
Sbjct: 124 LQELRASV 131


>gi|239832876|ref|ZP_04681205.1| ATP synthase F1, epsilon subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239825143|gb|EEQ96711.1| ATP synthase F1, epsilon subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 138

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 75/133 (56%)

Query: 2   SLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
           ++     FELVSPE+ + S +V  VV+P   G +T L GH+P++TTI  G+V++ L+  +
Sbjct: 3   TMAQAFQFELVSPERLLLSAQVTEVVIPGSEGYLTALAGHSPLMTTIMPGVVSVKLADGK 62

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
              YVV GG  DI P  CTVL+E+   +D+     +++RI+E    L +    + R + E
Sbjct: 63  SDSYVVFGGFADITPQSCTVLAESATHVDDINPADIQRRIEEARKHLEDASTNEHRTKAE 122

Query: 122 QLLVDLSCLRRRI 134
             L  L  L+  I
Sbjct: 123 IFLHQLMTLQGTI 135


>gi|225628352|ref|ZP_03786386.1| ATP synthase F1, epsilon subunit [Brucella ceti str. Cudo]
 gi|237816164|ref|ZP_04595159.1| ATP synthase F1, epsilon subunit [Brucella abortus str. 2308 A]
 gi|297249055|ref|ZP_06932763.1| ATP synthase F1, epsilon subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|225616198|gb|EEH13246.1| ATP synthase F1, epsilon subunit [Brucella ceti str. Cudo]
 gi|237788626|gb|EEP62839.1| ATP synthase F1, epsilon subunit [Brucella abortus str. 2308 A]
 gi|297174188|gb|EFH33545.1| ATP synthase F1, epsilon subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 138

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (54%)

Query: 2   SLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
           ++     FELVSPE+ + S +V  VV+P   G +T L GH+P++TTI  G+V++ L+  +
Sbjct: 3   TMAQAFQFELVSPERLLLSAQVTEVVIPGSEGYLTALAGHSPLMTTIMPGVVSVKLADGK 62

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
              YVV GG  DI P  CTVL+E+   +D+     ++ RID     L +    + R + E
Sbjct: 63  TDSYVVFGGFADITPQGCTVLAESATHVDDIDPADIQHRIDHARKVLEDASSNEHRTKAE 122

Query: 122 QLLVDLSCLRRRI 134
             L  L  L+  I
Sbjct: 123 IFLHQLMTLQGAI 135


>gi|153008440|ref|YP_001369655.1| F0F1 ATP synthase subunit epsilon [Ochrobactrum anthropi ATCC
           49188]
 gi|166222480|sp|A6WXX2|ATPE_OCHA4 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|151560328|gb|ABS13826.1| ATP synthase F1, epsilon subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 135

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 74/132 (56%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S +V  VV+P   G +T L GH+P++TTI  G+V++ L+  + 
Sbjct: 1   MAQAFQFELVSPERLLLSAQVTEVVIPGSEGYLTALAGHSPLMTTIMPGVVSVKLADGKS 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI P  CTVL+E+   +D+     +++RI+     L++    + R + E 
Sbjct: 61  DSYVVFGGFADITPQGCTVLAESATHVDDIDPADIQRRIEHARKALDDASSNEHRTKAEI 120

Query: 123 LLVDLSCLRRRI 134
            L  L  L+  I
Sbjct: 121 FLHQLMTLQGTI 132


>gi|294851036|ref|ZP_06791712.1| ATP synthase F1 [Brucella sp. NVSL 07-0026]
 gi|294821679|gb|EFG38675.1| ATP synthase F1 [Brucella sp. NVSL 07-0026]
          Length = 138

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (54%)

Query: 2   SLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
           ++     FELVSPE+ + S +V  VV+P   G +T L GH+P++TTI  G+V++ L+  +
Sbjct: 3   TMAQAFQFELVSPERLLLSAQVTEVVIPGSEGYLTALAGHSPLMTTIMPGVVSVKLADGK 62

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
              YVV GG  DI P  CTVL+E+   +D+     ++ RID     L +    + R + E
Sbjct: 63  TDSYVVFGGFADITPQGCTVLAESATHVDDIDPADIQHRIDHARKVLEDASSNEHRTKAE 122

Query: 122 QLLVDLSCLRRRI 134
             L  L  L+  I
Sbjct: 123 IFLHQLMTLQGTI 135


>gi|306841511|ref|ZP_07474210.1| ATP synthase F1, epsilon subunit [Brucella sp. BO2]
 gi|306288422|gb|EFM59779.1| ATP synthase F1, epsilon subunit [Brucella sp. BO2]
          Length = 159

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (54%)

Query: 2   SLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
           ++     FELVSPE+ + S +V  VV+P   G +T L GH+P++TTI  G+V++ L+  +
Sbjct: 24  TMAQAFQFELVSPERLLLSAQVTEVVIPGSEGYLTALAGHSPLMTTIMPGVVSVKLADGK 83

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
              YVV GG  DI P  CTVL+E+   +D+     ++ RID     L +    + R + E
Sbjct: 84  TDSYVVFGGFADITPQGCTVLAESATHVDDIDPADIQHRIDHARKVLEDASSNEHRTKAE 143

Query: 122 QLLVDLSCLRRRI 134
             L  L  L+  I
Sbjct: 144 IFLHQLMTLQGAI 156


>gi|114706548|ref|ZP_01439449.1| ATP synthase subunit epsilon [Fulvimarina pelagi HTCC2506]
 gi|114537940|gb|EAU41063.1| ATP synthase subunit epsilon [Fulvimarina pelagi HTCC2506]
          Length = 134

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 69/125 (55%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +   FELVSPEK + S +  SVV+P   G+ TV+  HAP +TT+K G+VT  LS  E 
Sbjct: 1   MADSFKFELVSPEKLLLSEDANSVVVPGNEGEFTVMSNHAPFMTTLKPGMVTAKLSGGEE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            +  V GG  D+  +  T+L+E   P DN     L++ I+     +++    D RF+ E+
Sbjct: 61  KKLFVRGGFADVNENGLTLLAEHAEPADNMTASQLDEHIEAARKRMDDAEHDDTRFKAEE 120

Query: 123 LLVDL 127
            L  L
Sbjct: 121 YLSQL 125


>gi|163845374|ref|YP_001623029.1| F0F1 ATP synthase subunit epsilon [Brucella suis ATCC 23445]
 gi|189081357|sp|A9WWS1|ATPE_BRUSI RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|163676097|gb|ABY40207.1| ATP synthase F1, epsilon subunit [Brucella suis ATCC 23445]
          Length = 135

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 72/132 (54%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S +V  VV+P   G +T L GH+P++TTI  G+V++ L+  + 
Sbjct: 1   MAQAFQFELVSPERLLLSAQVTEVVIPGNEGYLTALAGHSPLMTTIMPGVVSVKLADGKT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI P  CTVL+E+   +D+     ++ RID     L +    + R + E 
Sbjct: 61  DSYVVFGGFADITPQGCTVLAESATHVDDIDPADIQHRIDHARKVLEDASSNEHRTKAEI 120

Query: 123 LLVDLSCLRRRI 134
            L  L  L+  I
Sbjct: 121 FLHQLMTLQGAI 132


>gi|17986536|ref|NP_539170.1| F0F1 ATP synthase subunit epsilon [Brucella melitensis bv. 1 str.
           16M]
 gi|23502651|ref|NP_698778.1| F0F1 ATP synthase subunit epsilon [Brucella suis 1330]
 gi|62290663|ref|YP_222456.1| F0F1 ATP synthase subunit epsilon [Brucella abortus bv. 1 str.
           9-941]
 gi|82700578|ref|YP_415152.1| F0F1 ATP synthase subunit epsilon [Brucella melitensis biovar
           Abortus 2308]
 gi|161619718|ref|YP_001593605.1| F0F1 ATP synthase subunit epsilon [Brucella canis ATCC 23365]
 gi|189024875|ref|YP_001935643.1| F0F1 ATP synthase subunit epsilon [Brucella abortus S19]
 gi|225853242|ref|YP_002733475.1| F0F1 ATP synthase subunit epsilon [Brucella melitensis ATCC 23457]
 gi|254689951|ref|ZP_05153205.1| F0F1 ATP synthase subunit epsilon [Brucella abortus bv. 6 str. 870]
 gi|254694443|ref|ZP_05156271.1| F0F1 ATP synthase subunit epsilon [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698102|ref|ZP_05159930.1| F0F1 ATP synthase subunit epsilon [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700442|ref|ZP_05162270.1| F0F1 ATP synthase subunit epsilon [Brucella suis bv. 5 str. 513]
 gi|254703563|ref|ZP_05165391.1| F0F1 ATP synthase subunit epsilon [Brucella suis bv. 3 str. 686]
 gi|254708350|ref|ZP_05170178.1| F0F1 ATP synthase subunit epsilon [Brucella pinnipedialis
           M163/99/10]
 gi|254708798|ref|ZP_05170609.1| F0F1 ATP synthase subunit epsilon [Brucella pinnipedialis B2/94]
 gi|254714640|ref|ZP_05176451.1| F0F1 ATP synthase subunit epsilon [Brucella ceti M644/93/1]
 gi|254717538|ref|ZP_05179349.1| F0F1 ATP synthase subunit epsilon [Brucella ceti M13/05/1]
 gi|254719785|ref|ZP_05181596.1| F0F1 ATP synthase subunit epsilon [Brucella sp. 83/13]
 gi|254730986|ref|ZP_05189564.1| F0F1 ATP synthase subunit epsilon [Brucella abortus bv. 4 str. 292]
 gi|256030324|ref|ZP_05443938.1| F0F1 ATP synthase subunit epsilon [Brucella pinnipedialis
           M292/94/1]
 gi|256045394|ref|ZP_05448288.1| F0F1 ATP synthase subunit epsilon [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061822|ref|ZP_05451957.1| F0F1 ATP synthase subunit epsilon [Brucella neotomae 5K33]
 gi|256114362|ref|ZP_05455095.1| F0F1 ATP synthase subunit epsilon [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160495|ref|ZP_05458184.1| F0F1 ATP synthase subunit epsilon [Brucella ceti M490/95/1]
 gi|256255701|ref|ZP_05461237.1| F0F1 ATP synthase subunit epsilon [Brucella ceti B1/94]
 gi|256258206|ref|ZP_05463742.1| F0F1 ATP synthase subunit epsilon [Brucella abortus bv. 9 str. C68]
 gi|256263270|ref|ZP_05465802.1| ATP synthase subunit epsilon [Brucella melitensis bv. 2 str. 63/9]
 gi|256370202|ref|YP_003107713.1| ATP synthase subunit epsilon [Brucella microti CCM 4915]
 gi|260167998|ref|ZP_05754809.1| F0F1 ATP synthase subunit epsilon [Brucella sp. F5/99]
 gi|260547101|ref|ZP_05822839.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260565714|ref|ZP_05836197.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str.
           16M]
 gi|260568869|ref|ZP_05839337.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260755486|ref|ZP_05867834.1| F-ATPase epsilon subunit [Brucella abortus bv. 6 str. 870]
 gi|260758709|ref|ZP_05871057.1| F-ATPase epsilon subunit [Brucella abortus bv. 4 str. 292]
 gi|260762543|ref|ZP_05874880.1| F-ATPase epsilon subunit [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884507|ref|ZP_05896121.1| ATP synthase subunit epsilon [Brucella abortus bv. 9 str. C68]
 gi|261214757|ref|ZP_05929038.1| F-ATPase epsilon subunit [Brucella abortus bv. 3 str. Tulya]
 gi|261219372|ref|ZP_05933653.1| ATP synthase subunit epsilon [Brucella ceti M13/05/1]
 gi|261222912|ref|ZP_05937193.1| ATP synthase subunit epsilon [Brucella ceti B1/94]
 gi|261315849|ref|ZP_05955046.1| ATP synthase subunit epsilon [Brucella pinnipedialis M163/99/10]
 gi|261316291|ref|ZP_05955488.1| ATP synthase subunit epsilon [Brucella pinnipedialis B2/94]
 gi|261322434|ref|ZP_05961631.1| ATP synthase subunit epsilon [Brucella ceti M644/93/1]
 gi|261325826|ref|ZP_05965023.1| ATP synthase subunit epsilon [Brucella neotomae 5K33]
 gi|261750943|ref|ZP_05994652.1| ATP synthase subunit epsilon [Brucella suis bv. 5 str. 513]
 gi|261754197|ref|ZP_05997906.1| ATP synthase subunit epsilon [Brucella suis bv. 3 str. 686]
 gi|261757443|ref|ZP_06001152.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|265984805|ref|ZP_06097540.1| ATP synthase subunit epsilon [Brucella sp. 83/13]
 gi|265987358|ref|ZP_06099915.1| ATP synthase subunit epsilon [Brucella pinnipedialis M292/94/1]
 gi|265991823|ref|ZP_06104380.1| ATP synthase subunit epsilon [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995662|ref|ZP_06108219.1| ATP synthase subunit epsilon [Brucella melitensis bv. 3 str. Ether]
 gi|265998871|ref|ZP_06111428.1| ATP synthase subunit epsilon [Brucella ceti M490/95/1]
 gi|306839482|ref|ZP_07472290.1| ATP synthase F1, epsilon subunit [Brucella sp. NF 2653]
 gi|306844778|ref|ZP_07477363.1| ATP synthase F1, epsilon subunit [Brucella sp. BO1]
 gi|54036776|sp|P63661|ATPE_BRUSU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|54040846|sp|P63660|ATPE_BRUME RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|75505209|sp|Q57B89|ATPE_BRUAB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119361415|sp|Q2YLE7|ATPE_BRUA2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|189081356|sp|A9M836|ATPE_BRUC2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740227|sp|B2S7M2|ATPE_BRUA1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|254809348|sp|C0RF49|ATPE_BRUMB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|17982142|gb|AAL51434.1| ATP synthase epsilon chain [Brucella melitensis bv. 1 str. 16M]
 gi|23348659|gb|AAN30693.1| ATP synthase F1, epsilon subunit [Brucella suis 1330]
 gi|62196795|gb|AAX75095.1| AtpC, ATP synthase F1, epsilon subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82616679|emb|CAJ11762.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Brucella
           melitensis biovar Abortus 2308]
 gi|161336529|gb|ABX62834.1| ATP synthase F1, epsilon subunit [Brucella canis ATCC 23365]
 gi|189020447|gb|ACD73169.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Brucella
           abortus S19]
 gi|225641607|gb|ACO01521.1| ATP synthase F1, epsilon subunit [Brucella melitensis ATCC 23457]
 gi|256000365|gb|ACU48764.1| ATP synthase subunit epsilon [Brucella microti CCM 4915]
 gi|260095466|gb|EEW79344.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260151087|gb|EEW86182.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str.
           16M]
 gi|260154253|gb|EEW89335.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260669027|gb|EEX55967.1| F-ATPase epsilon subunit [Brucella abortus bv. 4 str. 292]
 gi|260672969|gb|EEX59790.1| F-ATPase epsilon subunit [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675594|gb|EEX62415.1| F-ATPase epsilon subunit [Brucella abortus bv. 6 str. 870]
 gi|260874035|gb|EEX81104.1| ATP synthase subunit epsilon [Brucella abortus bv. 9 str. C68]
 gi|260916364|gb|EEX83225.1| F-ATPase epsilon subunit [Brucella abortus bv. 3 str. Tulya]
 gi|260921496|gb|EEX88149.1| ATP synthase subunit epsilon [Brucella ceti B1/94]
 gi|260924461|gb|EEX91029.1| ATP synthase subunit epsilon [Brucella ceti M13/05/1]
 gi|261295124|gb|EEX98620.1| ATP synthase subunit epsilon [Brucella ceti M644/93/1]
 gi|261295514|gb|EEX99010.1| ATP synthase subunit epsilon [Brucella pinnipedialis B2/94]
 gi|261301806|gb|EEY05303.1| ATP synthase subunit epsilon [Brucella neotomae 5K33]
 gi|261304875|gb|EEY08372.1| ATP synthase subunit epsilon [Brucella pinnipedialis M163/99/10]
 gi|261737427|gb|EEY25423.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|261740696|gb|EEY28622.1| ATP synthase subunit epsilon [Brucella suis bv. 5 str. 513]
 gi|261743950|gb|EEY31876.1| ATP synthase subunit epsilon [Brucella suis bv. 3 str. 686]
 gi|262553560|gb|EEZ09329.1| ATP synthase subunit epsilon [Brucella ceti M490/95/1]
 gi|262766946|gb|EEZ12564.1| ATP synthase subunit epsilon [Brucella melitensis bv. 3 str. Ether]
 gi|263002779|gb|EEZ15182.1| ATP synthase subunit epsilon [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093234|gb|EEZ17331.1| ATP synthase subunit epsilon [Brucella melitensis bv. 2 str. 63/9]
 gi|264659555|gb|EEZ29816.1| ATP synthase subunit epsilon [Brucella pinnipedialis M292/94/1]
 gi|264663397|gb|EEZ33658.1| ATP synthase subunit epsilon [Brucella sp. 83/13]
 gi|306274950|gb|EFM56720.1| ATP synthase F1, epsilon subunit [Brucella sp. BO1]
 gi|306405427|gb|EFM61698.1| ATP synthase F1, epsilon subunit [Brucella sp. NF 2653]
          Length = 135

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 72/132 (54%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S +V  VV+P   G +T L GH+P++TTI  G+V++ L+  + 
Sbjct: 1   MAQAFQFELVSPERLLLSAQVTEVVIPGSEGYLTALAGHSPLMTTIMPGVVSVKLADGKT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  DI P  CTVL+E+   +D+     ++ RID     L +    + R + E 
Sbjct: 61  DSYVVFGGFADITPQGCTVLAESATHVDDIDPADIQHRIDHARKVLEDASSNEHRTKAEI 120

Query: 123 LLVDLSCLRRRI 134
            L  L  L+  I
Sbjct: 121 FLHQLMTLQGAI 132


>gi|188580720|ref|YP_001924165.1| F0F1 ATP synthase subunit epsilon [Methylobacterium populi BJ001]
 gi|179344218|gb|ACB79630.1| ATP synthase F1, epsilon subunit [Methylobacterium populi BJ001]
          Length = 133

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 71/121 (58%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+ V PE+ ++SGEV++V LP   G++TVL GHAPVLTT+K G++T++ +     R  
Sbjct: 4   FHFDFVGPERTLYSGEVEAVQLPGAEGEMTVLPGHAPVLTTLKVGVITVTETAGNGKRIY 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  DI P+  TVL+E   P++      ++K I+      +   D+ +R  +   +V 
Sbjct: 64  VQGGFADIGPTSVTVLAERAAPIEELTPAMIDKEIEAAELARDATQDLARREALNAQIVQ 123

Query: 127 L 127
           +
Sbjct: 124 M 124


>gi|170747036|ref|YP_001753296.1| ATP synthase F1, epsilon subunit [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653558|gb|ACB22613.1| ATP synthase F1, epsilon subunit [Methylobacterium radiotolerans
           JCM 2831]
          Length = 133

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 73/121 (60%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+ V PE+ ++SGEV +V LP   G++TV+ GHAPVLT+++ G++ I+ S     R  
Sbjct: 4   FHFDFVGPERTLYSGEVTAVQLPGTEGEMTVMPGHAPVLTSLRVGVIVITESQGSGKRIY 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  DI P+  TVL+E   P++    ++L++ I+ V    +   D+ +R ++   +V 
Sbjct: 64  VRGGFADIGPTAVTVLAERAAPIEELTHESLDRDIEAVEMQRDATEDLQKREELNGQIVQ 123

Query: 127 L 127
           L
Sbjct: 124 L 124


>gi|148558927|ref|YP_001259637.1| F0F1 ATP synthase subunit epsilon [Brucella ovis ATCC 25840]
 gi|148370184|gb|ABQ60163.1| ATP synthase F1, epsilon subunit [Brucella ovis ATCC 25840]
          Length = 138

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 72/133 (54%)

Query: 2   SLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
           ++     FELVSPE+ + S +V  VV+P     +T L GH+P++TTI  G+V++ L+  +
Sbjct: 3   TMAQAFQFELVSPERLLLSAQVTEVVIPGSESYLTALAGHSPLMTTIMPGVVSVKLADGK 62

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
              YVV GG  DI P  CTVL+E+   +D+     ++ RID     L +    + R + E
Sbjct: 63  TDSYVVFGGFADITPQGCTVLAESATHVDDIDPADIQHRIDHARKVLEDASSNEHRTKAE 122

Query: 122 QLLVDLSCLRRRI 134
             L  L  L+  I
Sbjct: 123 IFLHQLMTLQGAI 135


>gi|163850894|ref|YP_001638937.1| ATP synthase F1, epsilon subunit [Methylobacterium extorquens PA1]
 gi|218529717|ref|YP_002420533.1| F0F1 ATP synthase subunit epsilon [Methylobacterium
           chloromethanicum CM4]
 gi|240138024|ref|YP_002962496.1| ATP synthase F1 sector epsilon subunit [Methylobacterium extorquens
           AM1]
 gi|254560585|ref|YP_003067680.1| ATP synthase F1 sector subunit epsilon [Methylobacterium extorquens
           DM4]
 gi|163662499|gb|ABY29866.1| ATP synthase F1, epsilon subunit [Methylobacterium extorquens PA1]
 gi|218522020|gb|ACK82605.1| ATP synthase F1, epsilon subunit [Methylobacterium chloromethanicum
           CM4]
 gi|240007993|gb|ACS39219.1| ATP synthase F1 sector epsilon subunit [Methylobacterium extorquens
           AM1]
 gi|254267863|emb|CAX23729.1| ATP synthase F1 sector epsilon subunit [Methylobacterium extorquens
           DM4]
          Length = 133

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 71/121 (58%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+ V PE+ ++SGEV++V LP   G++TVL GHAPVLTT+K G++T++ +     R  
Sbjct: 4   FHFDFVGPERTLYSGEVEAVQLPGSEGEMTVLPGHAPVLTTLKVGVITVTETTGNGMRIY 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  DI P   TVL+E   P++      +++ I+ V    +   D+ +R  +   +V 
Sbjct: 64  VQGGFADIGPKSVTVLAERAAPIEEVTPGMIDREIEAVELVRDATQDLAKREALNAQIVQ 123

Query: 127 L 127
           +
Sbjct: 124 M 124


>gi|163761384|ref|ZP_02168458.1| ATP synthase subunit epsilon [Hoeflea phototrophica DFL-43]
 gi|162281379|gb|EDQ31676.1| ATP synthase subunit epsilon [Hoeflea phototrophica DFL-43]
          Length = 135

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + ++ +FELVSPE+ + S     VVLP   G++TV+  HAP +TTIK G+V++  +    
Sbjct: 1   MADNFNFELVSPERLLLSASATEVVLPGTDGEMTVMAHHAPTMTTIKPGVVSVVTAEGAT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            RYVV GG  DI+P  CT+L+E+ + + +     L +R+ +   D+ +      + + + 
Sbjct: 61  ERYVVFGGFADILPDGCTLLAESAVAVGDIDRDDLAQRLQDAREDVADASSDAAKQKAQD 120

Query: 123 LLVDLSCLRRRI 134
            L  L+ L   I
Sbjct: 121 YLDHLTTLNEAI 132


>gi|182677216|ref|YP_001831362.1| F0F1 ATP synthase subunit epsilon [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633099|gb|ACB93873.1| ATP synthase F1, epsilon subunit [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 134

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTIS-LSCEEIHRY 65
            HFELVSPE+ VFSGE  SVV+P   G+ TVL GHAP +TT++ G++T++  + +E   +
Sbjct: 4   FHFELVSPERLVFSGEADSVVVPGVEGEFTVLAGHAPFMTTLRPGLITVNDATSKEKLEF 63

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
             +GG  D+     T+L++  LP+  A        + +  +D+++  D D R
Sbjct: 64  YTLGGFVDVGEGGLTILADVALPIAEADQARFTADLAQAETDIHDAPDADFR 115


>gi|154251919|ref|YP_001412743.1| ATP synthase F1 subunit epsilon [Parvibaculum lavamentivorans DS-1]
 gi|171769591|sp|A7HT53|ATPE_PARL1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|154155869|gb|ABS63086.1| ATP synthase F1, epsilon subunit [Parvibaculum lavamentivorans
           DS-1]
          Length = 132

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L+F+LVSPE+ +FSG+V  VV+P   GD+ ++ GHAPV++T++ GI+ +       
Sbjct: 1   MAEKLNFDLVSPERLLFSGQVDMVVIPGSEGDMGIMAGHAPVMSTLRPGIIEVENEGAPR 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            R  V GG  ++ P+  TVL+E  +P+ +    AL++ I     D+ +  + D+R    +
Sbjct: 61  QRIFVRGGFAEVTPAGLTVLAEFTVPLADLDATALDREIALADKDVADAKNDDKRQSALE 120

Query: 123 LLVDLSCLR 131
            L  L  LR
Sbjct: 121 KLDHLKELR 129


>gi|83944755|ref|ZP_00957121.1| ATP synthase F1, epsilon subunit [Oceanicaulis alexandrii HTCC2633]
 gi|83851537|gb|EAP89392.1| ATP synthase F1, epsilon subunit [Oceanicaulis alexandrii HTCC2633]
          Length = 133

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 72/128 (56%), Gaps = 1/128 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + LHF+LVSPE+ VF+GEV  VV+P   GD  VL  HAP ++TI++G +++  S  ++
Sbjct: 1   MADKLHFDLVSPERRVFAGEVDMVVVPGSEGDFGVLANHAPFMSTIRTGAISVH-SGNDV 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            R  + GG  ++  +  T+L+E  + + +   + + K + E   DL    D ++R + E 
Sbjct: 60  SRTFIRGGFAEVTAAGLTILAEEAIDLADVNAEDVSKSLAEAREDLGQARDDEERHEAEA 119

Query: 123 LLVDLSCL 130
            +     L
Sbjct: 120 RIEKFQAL 127


>gi|154246025|ref|YP_001416983.1| ATP synthase F1, epsilon subunit [Xanthobacter autotrophicus Py2]
 gi|154160110|gb|ABS67326.1| ATP synthase F1, epsilon subunit [Xanthobacter autotrophicus Py2]
          Length = 139

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 1/121 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L FELVSPE+ VFSG V  V++P   G+  V+ GHAP +  +K GI+TI         Y 
Sbjct: 4   LPFELVSPERLVFSGAVTEVIVPGAEGEFGVMAGHAPFIGMLKPGILTIKGDGAS-RSYF 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  ++ P+  T+L+E   P+D   L AL+++I +   D+ +    + R +  + L D
Sbjct: 63  VRGGFAEVNPAGLTILAEEAKPLDELDLGALQQQIQDAKEDVADATTDESRQRAARQLAD 122

Query: 127 L 127
           L
Sbjct: 123 L 123


>gi|23006798|ref|ZP_00048955.1| COG0355: F0F1-type ATP synthase, epsilon subunit (mitochondrial
          delta subunit) [Magnetospirillum magnetotacticum MS-1]
          Length = 133

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (66%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           HF+ V PE+ ++SGEV++V LP   G++TVL GHAPVLTT+K G++T++       R  
Sbjct: 4  FHFDFVGPERTLYSGEVEAVQLPGAEGEMTVLPGHAPVLTTLKVGVITVTERAGNGKRIY 63

Query: 67 VIGGICDIVPSHCTVLSETILPMD 90
          V GG  DI P+  TVL+E   P++
Sbjct: 64 VQGGFADIGPNTVTVLAERATPIE 87


>gi|319406290|emb|CBI79927.1| ATP synthase epsilon chain [Bartonella sp. AR 15-3]
          Length = 148

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 80/123 (65%), Gaps = 3/123 (2%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV-TISLSCEEIHRYVV 67
           FELVSPEK VFS +V SVVLPS  G +TV+  H+P++ ++  G++  IS S E++  + +
Sbjct: 21  FELVSPEKLVFSEKVMSVVLPSVSGYLTVMADHSPLVVSLTPGVIRVISSSGEKV--FAL 78

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
           +GG+ DI  S C++L+ET++ +++  L  LE+R+ EV + L      +   ++E+L   L
Sbjct: 79  LGGVADITSSGCSLLAETVVAVNHLSLHDLEQRMAEVRAMLEENSSGNTHHKVEELFQKL 138

Query: 128 SCL 130
           + +
Sbjct: 139 TSV 141


>gi|319404805|emb|CBI78406.1| ATP synthase epsilon chain [Bartonella rochalimae ATCC BAA-1498]
          Length = 148

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 67/96 (69%), Gaps = 1/96 (1%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           FELVSPEK +FS +V SVVLPS  G +T++  HAP++ ++  G++ +  S EE   + ++
Sbjct: 21  FELVSPEKLIFSEKVMSVVLPSVSGYLTIMANHAPLVVSLVPGVIRVMSSSEE-KIFALL 79

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV 104
           GG+ DI  S C++L+ET + +++  LQ LE+R+ EV
Sbjct: 80  GGVADITSSGCSLLAETAVAVNHLSLQDLEQRMAEV 115


>gi|326409801|gb|ADZ66866.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Brucella
           melitensis M28]
 gi|326539518|gb|ADZ87733.1| ATP synthase F1, epsilon subunit [Brucella melitensis M5-90]
          Length = 126

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 68/123 (55%)

Query: 12  VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGI 71
           +SPE+ + S +V  VV+P   G +T L GH+P++TTI  G+V++ L+  +   YVV GG 
Sbjct: 1   MSPERLLLSAQVTEVVIPGSEGYLTALAGHSPLMTTIMPGVVSVKLADGKTDSYVVFGGF 60

Query: 72  CDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLR 131
            DI P  CTVL+E+   +D+     ++ RID     L +    + R + E  L  L  L+
Sbjct: 61  ADITPQGCTVLAESATHVDDIDPADIQHRIDHARKVLEDASSNEHRTKAEIFLHQLMTLQ 120

Query: 132 RRI 134
             I
Sbjct: 121 GAI 123


>gi|218678715|ref|ZP_03526612.1| F0F1 ATP synthase subunit epsilon [Rhizobium etli CIAT 894]
          Length = 87

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 60/86 (69%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + ++ +FELVSPE+ + S  V  VV+P+  G++TV+  HAP +TTIK G+V++  +  + 
Sbjct: 1  MADNFNFELVSPERLLLSEMVTEVVIPATEGEMTVMAHHAPTMTTIKPGVVSVRSASGKK 60

Query: 63 HRYVVIGGICDIVPSHCTVLSETILP 88
            YVV GG  DI+P+ CT+L+E+ +P
Sbjct: 61 QDYVVFGGFADILPTGCTLLAESAVP 86


>gi|319899410|ref|YP_004159507.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit)
           [Bartonella clarridgeiae 73]
 gi|319403378|emb|CBI76942.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit)
           [Bartonella clarridgeiae 73]
          Length = 138

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 3/97 (3%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV-TISLSCEEIHRYVV 67
           FELVSPEK VFS +V SVVLPS  G +TV+  HAPV+ ++  G++  IS S E++  + +
Sbjct: 11  FELVSPEKLVFSEKVVSVVLPSASGYLTVMANHAPVVVSLIPGVIRVISSSGEKV--FAL 68

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV 104
           +GGI DI  + C++L+ET++ +D+     LE+R+ EV
Sbjct: 69  LGGIADITSAGCSLLAETVVVVDHLSFHDLEQRMAEV 105


>gi|319409366|emb|CBI83010.1| ATP synthase epsilon chain [Bartonella schoenbuchensis R1]
          Length = 138

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 75/123 (60%), Gaps = 3/123 (2%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSG-IVTISLSCEEIHRYVV 67
           FEL+SPEK +FS EV SVVLPS  G +TV+  HAP++  +  G I  +S S E++  + +
Sbjct: 11  FELISPEKLIFSDEVTSVVLPSASGYLTVMANHAPLMVRLMPGSIRVLSSSGEKL--FAL 68

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
            GG+ DI PS C++L+E ++ +D+     LE+RI +V + L    +      +E+ L  L
Sbjct: 69  CGGVADITPSRCSLLAEAVVAVDHLSFDELEQRILKVRAALEEGSNGGANDPVEEFLHQL 128

Query: 128 SCL 130
           + +
Sbjct: 129 TTV 131


>gi|121601681|ref|YP_988453.1| ATP synthase F1, epsilon subunit [Bartonella bacilliformis KC583]
 gi|120613858|gb|ABM44459.1| ATP synthase F1, epsilon subunit [Bartonella bacilliformis KC583]
          Length = 138

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           FELVSPEK VFS E+ SVVLPS  G +TV+  HAP++ ++  G V +  S  E   + V 
Sbjct: 11  FELVSPEKIVFSEEIVSVVLPSASGYLTVMANHAPLVVSLIPGSVRVVSSSREW-LFAVG 69

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
           GG+ +I PS C++L+E +L +D+   + LE+ I  V + L N
Sbjct: 70  GGVVEITPSRCSLLAEAVLSVDHLSFEELEQHIMNVRATLEN 111


>gi|209883748|ref|YP_002287605.1| ATP synthase F1, epsilon subunit [Oligotropha carboxidovorans OM5]
 gi|226740271|sp|B6JD10|ATPE_OLICO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|209871944|gb|ACI91740.1| ATP synthase F1, epsilon subunit [Oligotropha carboxidovorans OM5]
          Length = 136

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 67/104 (64%), Gaps = 1/104 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPEK  FSGEV+ V +P   GD  VL GH+P++ +++ GI+T+++  +   + +
Sbjct: 4   FHFDLVSPEKIAFSGEVEQVDVPGVEGDFGVLAGHSPLVASVRPGILTVTIGGKH-EKII 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
           V+GG+ ++     TVL++T   + +    A  ++I+E+ S+L N
Sbjct: 63  VLGGLAEVSEKGLTVLADTATSLADLDRAAFARQIEEMESNLKN 106


>gi|220924730|ref|YP_002500032.1| F0F1 ATP synthase subunit epsilon [Methylobacterium nodulans ORS
           2060]
 gi|219949337|gb|ACL59729.1| ATP synthase F1, epsilon subunit [Methylobacterium nodulans ORS
           2060]
          Length = 133

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 71/115 (61%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ELVSPE+ VF+GEV+SV+LP   GD+TVL GHAP++T + +G+V  + +     R V
Sbjct: 4   LFAELVSPERIVFAGEVRSVLLPGVEGDMTVLPGHAPLVTMLHAGLVFATDAAGTGRRAV 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           V GG+ ++  +  T+L+E +LP++      +++ I     + +   + ++R Q E
Sbjct: 64  VRGGLVEVTGTRVTILAERVLPVEELTRDQIDEEILYFQMERDGTANPERRAQCE 118


>gi|296446168|ref|ZP_06888116.1| ATP synthase F1, epsilon subunit [Methylosinus trichosporium OB3b]
 gi|296256362|gb|EFH03441.1| ATP synthase F1, epsilon subunit [Methylosinus trichosporium OB3b]
          Length = 132

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 68/120 (56%), Gaps = 6/120 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HFELVSPEK +F+GEV++VV P   G  TVL  HAP++T +K G+V I  + ++  R  
Sbjct: 4   FHFELVSPEKLLFAGEVEAVVAPGADGQFTVLKDHAPLMTVLKPGVVEIDDAGKK-DRLF 62

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  D+  S  T+L+E  +P   +D A + A  K   E  +D     D  +R   E+L
Sbjct: 63  VRGGFADVGLSGFTILAEYAIPVAELDAAKIDADIKNAGEDVADAK--TDEARRLAAEKL 120


>gi|114798087|ref|YP_760592.1| ATP synthase F1 subunit epsilon [Hyphomonas neptunium ATCC 15444]
 gi|119367737|sp|Q0C101|ATPE_HYPNA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|114738261|gb|ABI76386.1| ATP synthase F1, epsilon subunit [Hyphomonas neptunium ATCC 15444]
          Length = 135

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 71/130 (54%), Gaps = 1/130 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + LHF LVSP + +FSG+V  V+ P   G+  VLV HAP +TT+K+G+V +       
Sbjct: 1   MADKLHFSLVSPARELFSGQVDHVIAPGTEGEFGVLVNHAPFMTTLKNGVVRVLEGDVVR 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD-QRFQME 121
           HR+ V GG  D+ P+  T+L+E    + +A  Q ++  ++     L  +   D +R  +E
Sbjct: 61  HRFYVRGGFADVTPAGLTILAEEARNLSDASAQEIDVEVEAAKLKLLELDAGDTKRAVLE 120

Query: 122 QLLVDLSCLR 131
             +  L  LR
Sbjct: 121 HQISYLEGLR 130


>gi|299135453|ref|ZP_07028643.1| ATP synthase F1, epsilon subunit [Afipia sp. 1NLS2]
 gi|298589861|gb|EFI50066.1| ATP synthase F1, epsilon subunit [Afipia sp. 1NLS2]
          Length = 137

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 1/108 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + N  HF+LVSPEK  FSGEV+ V +P   GD  VL GH+P++ +I+ GI+T+++  +  
Sbjct: 1   MANTFHFDLVSPEKIAFSGEVEQVDVPGVEGDFGVLAGHSPLVASIRPGILTVTVGGKN- 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
            + +V+GG+ ++     TVL++T   +      A  K+I+E+  +L +
Sbjct: 60  EKIIVLGGLAEVSDKGLTVLADTATSLAELDRVAFAKQIEEMEENLKD 107


>gi|220927117|ref|YP_002502419.1| F0F1 ATP synthase subunit epsilon [Methylobacterium nodulans ORS
           2060]
 gi|219951724|gb|ACL62116.1| ATP synthase F1, epsilon subunit [Methylobacterium nodulans ORS
           2060]
          Length = 133

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 71/121 (58%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             F+LV PE+ ++SG V +V LP   G++TVL GHAPVLTT+K+G++ I+   +   R +
Sbjct: 4   FQFDLVGPERVLYSGPVDAVQLPGSEGEMTVLPGHAPVLTTLKTGVLVITEGPQHGKRVL 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  +I  +  TV++E   P++    ++++  I    +  +   D+D+R  ++  +  
Sbjct: 64  VRGGFAEINATGLTVIAERATPVEELTSESIDAEIIAAETHRDATDDLDKRRDIDMAIAQ 123

Query: 127 L 127
           L
Sbjct: 124 L 124


>gi|319407765|emb|CBI81412.1| ATP synthase epsilon chain [Bartonella sp. 1-1C]
          Length = 138

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           FELVSPEK +FS +V +VVLPS  G +T++  HAP++ ++  G++ +  S EE   + ++
Sbjct: 11  FELVSPEKLIFSEKVMAVVLPSVSGYLTIMANHAPLVVSLVPGVIRVMSSSEE-KIFALL 69

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV 104
           GG+ DI    C++L+ET + +++  LQ LE+R+ EV
Sbjct: 70  GGVADITSLGCSLLAETAVAINHLSLQDLEQRMAEV 105


>gi|158425748|ref|YP_001527040.1| F0F1 ATP synthase subunit epsilon [Azorhizobium caulinodans ORS
           571]
 gi|158332637|dbj|BAF90122.1| H+-transporting two-sector ATPase delta/epsilon subunit
           [Azorhizobium caulinodans ORS 571]
          Length = 138

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 64/123 (52%), Gaps = 14/123 (11%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             FELVSPE+ VFSG+V  VV+P   G   V+ GHAP ++T+ +GI+TI     +  R  
Sbjct: 4   FSFELVSPERLVFSGQVTEVVVPGSEGQFGVMAGHAPFISTLSAGILTIKGEGAD-KRLF 62

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSD----------LNNICD 113
           V GG  +  P+  TVL+E   P    D A LQ L K   E  +D           +N+ D
Sbjct: 63  VRGGFAEANPAGLTVLAEQATPVESFDRAELQQLIKNAQEDVADAKSDEARQKAASNLAD 122

Query: 114 VDQ 116
           + Q
Sbjct: 123 LQQ 125


>gi|170744667|ref|YP_001773322.1| F0F1 ATP synthase subunit epsilon [Methylobacterium sp. 4-46]
 gi|168198941|gb|ACA20888.1| ATP synthase F1, epsilon subunit [Methylobacterium sp. 4-46]
          Length = 133

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 70/117 (59%), Gaps = 2/117 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             F+LV PE+ ++SG V +V LP   G++TVL GHAPVLTT+K+G++ I+   +   R +
Sbjct: 4   FQFDLVGPERVIYSGAVDAVQLPGSEGEMTVLPGHAPVLTTLKTGVLVITEGPQHGKRVL 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR--FQME 121
           V GG  +I  +   V++E   P++    ++++  I  V +  +   D+D+R  F M+
Sbjct: 64  VRGGFAEINATGLIVIAERATPVEELTPESIDAEIANVETLRDATDDLDKRRDFDMQ 120


>gi|288959332|ref|YP_003449673.1| F-type H+-transporting ATPase epsilon chain [Azospirillum sp. B510]
 gi|288911640|dbj|BAI73129.1| F-type H+-transporting ATPase epsilon chain [Azospirillum sp. B510]
          Length = 138

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 69/123 (56%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + FELVSPEK + S  V  VV+P   GD  VL GH+P+++T++ G++ +      +
Sbjct: 1   MADKVEFELVSPEKLLKSQPVDMVVVPGSEGDFGVLAGHSPMISTVRPGVIDVYEGDRVV 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            R  V GG  ++  + CTVL+E  + + +    A+EK++ ++  DL++     +R   E 
Sbjct: 61  DRVFVAGGFAEVTEARCTVLAEEAVALTDLDRAAVEKQVKDLSEDLDDSKSDAERAAAES 120

Query: 123 LLV 125
            L 
Sbjct: 121 KLA 123


>gi|163737804|ref|ZP_02145221.1| hypothetical protein RGBS107_19773 [Phaeobacter gallaeciensis
           BS107]
 gi|163742890|ref|ZP_02150274.1| ATP synthase F1, epsilon subunit [Phaeobacter gallaeciensis 2.10]
 gi|161383854|gb|EDQ08239.1| ATP synthase F1, epsilon subunit [Phaeobacter gallaeciensis 2.10]
 gi|161389330|gb|EDQ13682.1| ATP synthase epsilon chain [Phaeobacter gallaeciensis BS107]
          Length = 137

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 72/132 (54%), Gaps = 5/132 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S  V +V++P   GD+T +  HAP +TT++ G++ +  S +  
Sbjct: 1   MADTMQFDLVSPERRLASLPVTAVMIPGAEGDMTAMANHAPTITTLRPGVLRVE-SPQGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM-- 120
             Y+V GG  +I     +VL+E  +PMD      L++ I+E  +    + D DQ   +  
Sbjct: 60  SEYLVTGGFAEIGADGLSVLAEKAIPMDQLTRAQLDELIEEARTTYKTVQDTDQPHGLVE 119

Query: 121 --EQLLVDLSCL 130
              +LL D+  L
Sbjct: 120 DAAKLLADMEAL 131


>gi|237749341|ref|ZP_04579821.1| H+-transporting two-sector ATPase [Oxalobacter formigenes OXCC13]
 gi|229380703|gb|EEO30794.1| H+-transporting two-sector ATPase [Oxalobacter formigenes OXCC13]
          Length = 140

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + N +H ++VS E+ +FSGE + VVLP ELG++ +L  HAP++T IK G V I +S +E 
Sbjct: 1  MANTIHVDVVSAEELIFSGEAEFVVLPGELGELGILPKHAPLITRIKPGAVRIKVSGKEE 60

Query: 63 HRYV-VIGGICDIVPSHCTVLSETIL 87
            YV V GG+ ++ P   TVL++T +
Sbjct: 61 EEYVFVAGGVLEVQPHAVTVLADTAI 86


>gi|254476265|ref|ZP_05089651.1| ATP synthase F1, epsilon subunit [Ruegeria sp. R11]
 gi|214030508|gb|EEB71343.1| ATP synthase F1, epsilon subunit [Ruegeria sp. R11]
          Length = 137

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 72/132 (54%), Gaps = 5/132 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S  V +V++P   GD+T +  HAP +TT++ G++ +  S E  
Sbjct: 1   MADTMQFDLVSPERRLASLPVTAVMIPGAEGDMTAMANHAPTITTLRPGVLRVE-SPEGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM-- 120
             Y+V GG  +I     +VL+E  +PMD      L++ I+E  +    + + DQ   +  
Sbjct: 60  SEYLVTGGFAEIGADGLSVLAEKAIPMDQMTRAHLDELIEEARTTYKTVQETDQPHGLVE 119

Query: 121 --EQLLVDLSCL 130
              +LL D+  L
Sbjct: 120 DAAKLLADMEAL 131


>gi|254470761|ref|ZP_05084164.1| ATP synthase F1, epsilon subunit [Pseudovibrio sp. JE062]
 gi|211959903|gb|EEA95100.1| ATP synthase F1, epsilon subunit [Pseudovibrio sp. JE062]
          Length = 135

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S +V  V +P   G+  V  GH+P L+T++ G+V         
Sbjct: 1   MAEAFQFELVSPERLLLSAKVTDVTVPGSEGEFGVGAGHSPFLSTMRPGVVKALSEDGSK 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
           H Y V GG  D+  S  TVL+E  +PM +     + ++I +   D+ +  D D R
Sbjct: 61  HDYFVRGGFADVSASGMTVLAEQAIPMADLDAGYIAQQIQDASEDVADAKDEDAR 115


>gi|304320619|ref|YP_003854262.1| ATP synthase F1 subunit epsilon [Parvularcula bermudensis
          HTCC2503]
 gi|303299521|gb|ADM09120.1| ATP synthase F1, epsilon subunit [Parvularcula bermudensis
          HTCC2503]
          Length = 126

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 6  DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
          DL F LVSPE+ +FSGE  +V +P   GD  V+ GHAP+++T+  G++ IS +  E  R+
Sbjct: 3  DLAFSLVSPERELFSGEAAAVTVPGTEGDFQVMAGHAPLMSTLSPGLLQISTNG-EAKRF 61

Query: 66 VVIGGICDIVPSHCTVLSETILP 88
           V GG  D+     T+L+E  +P
Sbjct: 62 YVRGGFADVTAQGLTILAEIAIP 84


>gi|237747182|ref|ZP_04577662.1| F0F1-type ATP synthase [Oxalobacter formigenes HOxBLS]
 gi|229378533|gb|EEO28624.1| F0F1-type ATP synthase [Oxalobacter formigenes HOxBLS]
          Length = 140

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + N +H ++VS E+ +FSGE + VVLP ELG++ +L  HAP++T IK G V I +S +E 
Sbjct: 1  MANTIHVDVVSAEELIFSGEAEFVVLPGELGELGILPRHAPLITRIKPGAVRIKVSDKED 60

Query: 63 HRYV-VIGGICDIVPSHCTVLSETIL 87
            YV V GG+ ++ P   TVL++T +
Sbjct: 61 EEYVFVAGGVLEVQPHAVTVLADTAI 86


>gi|114571339|ref|YP_758019.1| ATP synthase F1 subunit epsilon [Maricaulis maris MCS10]
 gi|119367744|sp|Q0AKW2|ATPE_MARMM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|114341801|gb|ABI67081.1| ATP synthase F1 subcomplex epsilon subunit [Maricaulis maris MCS10]
          Length = 133

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 70/129 (54%), Gaps = 1/129 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + LHF+LVSPE+ +F+G V  VV+P E GD  VL  HAP ++ I+ G +T+    +E 
Sbjct: 1   MADKLHFDLVSPERRLFAGNVDQVVVPGEEGDFGVLPNHAPFMSVIRPGAITVIDDGKET 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            R  + GG  ++  +  T+L+E  + + +   + L + + +   D+    D ++R Q   
Sbjct: 61  -RTFIHGGFAEVTAAGLTILAEEAIAVADIDTEKLARDLSDAREDVTAAKDEEERDQAAA 119

Query: 123 LLVDLSCLR 131
           L+     ++
Sbjct: 120 LVAKYEAMQ 128


>gi|220926659|ref|YP_002501961.1| F0F1 ATP synthase subunit epsilon [Methylobacterium nodulans ORS
           2060]
 gi|219951266|gb|ACL61658.1| ATP synthase F1, epsilon subunit [Methylobacterium nodulans ORS
           2060]
          Length = 133

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 69/116 (59%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           +L  +L+SPE+ VFSGEV+SV+LP   GD+TVL GHAP++T + +G+V  + +     R 
Sbjct: 3   NLFAQLISPERVVFSGEVRSVLLPGVEGDMTVLPGHAPLVTLLHAGLVFATDAEGTGRRA 62

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            V GG  ++  +  T+L++ +L ++      L++ I  +  + +   D D R Q E
Sbjct: 63  FVRGGFAEVTGTQVTILADHVLSVEELTRDRLDEEILHLQMERDGTADPDLRAQHE 118


>gi|298293436|ref|YP_003695375.1| ATP synthase F1 subunit epsilon [Starkeya novella DSM 506]
 gi|296929947|gb|ADH90756.1| ATP synthase F1, epsilon subunit [Starkeya novella DSM 506]
          Length = 138

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           FELVSPE+ V+SG V  VV+P   G+  +L GHAP ++T+K GI+TI        +  V 
Sbjct: 6   FELVSPERLVYSGTVSEVVVPGTEGEFGILAGHAPFVSTLKPGILTIKGDG-ATRKLFVR 64

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
           GG  +  P   TVL+ET +P+     + L + I +   D+ +  D   R
Sbjct: 65  GGFAEANPQGLTVLAETAIPLAELHAENLTQMIKDAEEDVEDAKDETTR 113


>gi|296117270|ref|ZP_06835861.1| ATP synthase epsilon chain [Gluconacetobacter hansenii ATCC 23769]
 gi|295976163|gb|EFG82950.1| ATP synthase epsilon chain [Gluconacetobacter hansenii ATCC 23769]
          Length = 141

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (54%), Gaps = 9/113 (7%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           E+VSPEK +FS     VV+P   GDI  +  HAP++  ++ G+V I       HR+ V G
Sbjct: 6   EIVSPEKTLFSHTADMVVMPGSEGDIAAMPEHAPLMLMLRGGVVEIYEGDAIAHRFFVSG 65

Query: 70  GICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDEVCSDLNNICDVD 115
           G  D+ P HCT+L++   P+ +       + L ALEK  DE  +D  N+  +D
Sbjct: 66  GFADMTPDHCTILADHATPVADLSATDAQSRLTALEKSYDE--ADKMNVPALD 116


>gi|304392605|ref|ZP_07374545.1| ATP synthase F1, epsilon subunit [Ahrensia sp. R2A130]
 gi|303295235|gb|EFL89595.1| ATP synthase F1, epsilon subunit [Ahrensia sp. R2A130]
          Length = 133

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 54/86 (62%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + +   FELVSPEK + SG  + V +P+  GD+ VL  HAPV+T+++ G+V++ ++  + 
Sbjct: 1  MADTFTFELVSPEKLMLSGAAEIVTVPAVEGDMGVLSNHAPVMTSLRPGLVSVKMADGDE 60

Query: 63 HRYVVIGGICDIVPSHCTVLSETILP 88
            Y V GG  DI P   TVL+E  +P
Sbjct: 61 TEYFVKGGFADITPDAVTVLAEFAIP 86


>gi|85713720|ref|ZP_01044710.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Nitrobacter sp. Nb-311A]
 gi|85699624|gb|EAQ37491.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Nitrobacter sp. Nb-311A]
          Length = 136

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 51/78 (65%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           HF+LVSPEK  FSGEV  V +P   GD  VL GHAPV+ TI+ GI+T++ +     + +
Sbjct: 4  FHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVATIRPGILTVTAAGGTRQKII 63

Query: 67 VIGGICDIVPSHCTVLSE 84
          V+GG+ ++     TVL++
Sbjct: 64 VLGGLAEVSEKGLTVLAD 81


>gi|163792321|ref|ZP_02186298.1| H+-transporting two-sector ATPase, delta/epsilon subunit [alpha
           proteobacterium BAL199]
 gi|159182026|gb|EDP66535.1| H+-transporting two-sector ATPase, delta/epsilon subunit [alpha
           proteobacterium BAL199]
          Length = 137

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 71/130 (54%), Gaps = 3/130 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
            FELVSPE+ V S +V+ VV+P   G   VL  HAP+++T+ +G++ I      + R  V
Sbjct: 6   KFELVSPERLVLSRDVEMVVVPGTEGYFGVLPRHAPMISTLSAGVIDIYEGGAVVDRIFV 65

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
            GG  ++  + CTVL+E  +P+ +  + A EK I +    L +  D   R ++E  + + 
Sbjct: 66  AGGFAEVTETRCTVLAEEAMPLGDVDVAATEKSIADDRDVLKDTTDAVARGKLEDRIRNR 125

Query: 128 SCL---RRRI 134
             +   +RR+
Sbjct: 126 EAMLAAKRRL 135


>gi|114604|sp|P05441|ATPE_RHOBL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|45981|emb|CAA77304.1| ATPase epsilon subunit [Rhodobacter blasticus]
          Length = 130

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 73/130 (56%), Gaps = 6/130 (4%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L F+LVSPE+ + S +   V +P   GD+T + GHAP +TT++ GI+  ++S E  
Sbjct: 1   MAATLQFDLVSPERRLASVQATEVQIPGAAGDMTAMQGHAPTITTLRPGILR-AVSAEGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD-QRFQME 121
             YVV GG  +I  +  +VL+E  +P+D   + A  K +D++ +D +    V   +   E
Sbjct: 60  KAYVVTGGFAEISATGVSVLAERAVPLDE--MDA--KLMDQLVADASAASSVGVDKDTAE 115

Query: 122 QLLVDLSCLR 131
           + + DL  ++
Sbjct: 116 KAMSDLQAMK 125


>gi|39933252|ref|NP_945528.1| F0F1 ATP synthase subunit epsilon [Rhodopseudomonas palustris
           CGA009]
 gi|192288603|ref|YP_001989208.1| F0F1 ATP synthase subunit epsilon [Rhodopseudomonas palustris
           TIE-1]
 gi|60389659|sp|Q6NDD3|ATPE_RHOPA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740280|sp|B3Q744|ATPE_RHOPT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|39652877|emb|CAE25619.1| putative H+-transporting ATP synthase epsilon chain
           [Rhodopseudomonas palustris CGA009]
 gi|192282352|gb|ACE98732.1| ATP synthase F1, epsilon subunit [Rhodopseudomonas palustris TIE-1]
          Length = 135

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (55%), Gaps = 8/108 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPE   FSG+V  V +P   GD  VL GHAPV+  I+ GI+T++    +  + V
Sbjct: 4   FHFDLVSPEMVAFSGDVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGANK-QKIV 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDEVCSD 107
           V+GGI ++     TVL++   P  +       A +Q +E++I     D
Sbjct: 63  VLGGIAEVSDKGLTVLADVATPAPDVDLQDFAATIQTMEQQIPGKVGD 110


>gi|126725130|ref|ZP_01740973.1| ATP synthase F1, epsilon subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126706294|gb|EBA05384.1| ATP synthase F1, epsilon subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 131

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 67/124 (54%), Gaps = 2/124 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           + ++LVSPE+ + SG+   V +P   GD+T +  HAPV+TT++ G++TI +S      Y 
Sbjct: 4   MQYDLVSPERSLASGQASEVRIPGSEGDMTAMADHAPVITTLRPGVLTI-VSDAGTAEYA 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           VIGG  ++  +  +VL+E  +P+       L   + +  + L N   VD +    + L D
Sbjct: 63  VIGGFAEVTATSTSVLAEKAMPVAEVTADVLAGLVSDAETALAN-ASVDGKDSAVKYLDD 121

Query: 127 LSCL 130
           L  L
Sbjct: 122 LRSL 125


>gi|118590579|ref|ZP_01547981.1| F0F1 ATP synthase subunit epsilon [Stappia aggregata IAM 12614]
 gi|118437042|gb|EAV43681.1| F0F1 ATP synthase subunit epsilon [Stappia aggregata IAM 12614]
          Length = 135

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 60/122 (49%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             FELVSPE+ + S +V  VV+P   G+  VL  HAP ++TI  GI+ +         Y 
Sbjct: 5   FQFELVSPERQLLSEQVAEVVVPGAEGEFGVLKNHAPFISTILPGILKVRGEAGGWDEYF 64

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  D+     TVL+E  +P+     + L+K I +   D+ +  D   R + E  L  
Sbjct: 65  VRGGFADVAAGGLTVLAEQAVPVGEISREQLDKAIQDAQEDVADAKDDASRQKAEMTLAQ 124

Query: 127 LS 128
           L 
Sbjct: 125 LK 126


>gi|316931856|ref|YP_004106838.1| ATP synthase F1 subunit epsilon [Rhodopseudomonas palustris DX-1]
 gi|315599570|gb|ADU42105.1| ATP synthase F1, epsilon subunit [Rhodopseudomonas palustris DX-1]
          Length = 139

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPE   FSGEV  V +P   GD  VL GHAPV+  I+ GI+T++       + V
Sbjct: 8   FHFDLVSPEMVAFSGEVDQVDIPGAEGDFGVLAGHAPVVALIRPGILTVTAGA-ATQKIV 66

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRI 101
           V+GGI ++     TVL++   P  +  LQ     I
Sbjct: 67  VLGGIAEVSEKGLTVLADVATPAPDVDLQDFAATI 101


>gi|330991788|ref|ZP_08315738.1| ATP synthase epsilon chain [Gluconacetobacter sp. SXCC-1]
 gi|329761256|gb|EGG77750.1| ATP synthase epsilon chain [Gluconacetobacter sp. SXCC-1]
          Length = 141

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 66/116 (56%), Gaps = 9/116 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VSPEK +FS +   VV+P   GDI  +  HAP++ T++ G+V +       +R+ 
Sbjct: 3   IKVKIVSPEKVMFSHDADMVVMPGTEGDIAAMPDHAPLMLTLRGGVVDVYEGAAVTNRFF 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDEVCSDLNNICDVD 115
           V GG  D+ P+HCT+L++  L +++       A L+ LEK  +   +D  N+  +D
Sbjct: 63  VAGGFADMAPTHCTILADRALRVEDLSVDDAEARLEGLEKSYE--AADKMNVPALD 116


>gi|148252016|ref|YP_001236601.1| F0F1 ATP synthase subunit epsilon [Bradyrhizobium sp. BTAi1]
 gi|166222434|sp|A5E951|ATPE_BRASB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|146404189|gb|ABQ32695.1| ATP synthase F1 subcomplex epsilon subunit [Bradyrhizobium sp.
           BTAi1]
          Length = 135

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPEK  FSGEV  V +P + GD  VL GHAP + T++ GI+T++    +  + +
Sbjct: 4   FHFDLVSPEKIAFSGEVDQVDVPGQEGDFGVLAGHAPFVATLRPGILTVTAGGTQ-QKII 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLN 109
           V+GG+ +I     T+L++    +      A    I  + + LN
Sbjct: 63  VLGGLAEISEKGLTILADVATSLKELDQTAFAAEISGMEAKLN 105


>gi|240851265|ref|YP_002972668.1| ATP synthase epsilon chain [Bartonella grahamii as4aup]
 gi|240268388|gb|ACS51976.1| ATP synthase epsilon chain [Bartonella grahamii as4aup]
          Length = 138

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 1/121 (0%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           FELVSPEK VFS +V SVVLPS  G +TV+  HAP++ +I  G V +  S  E   + V 
Sbjct: 11  FELVSPEKIVFSEQVVSVVLPSASGSLTVMAHHAPLVASIVLGSVRVRTSLGE-KLFAVC 69

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLS 128
           GG+ +I  S C++L E ++ +++     LE+RI +V + L      +   ++E     LS
Sbjct: 70  GGVANITFSGCSLLVEHVVAVEHLSFDVLEQRILQVQATLEGGTRDEDNHKIEAFFQQLS 129

Query: 129 C 129
            
Sbjct: 130 A 130


>gi|146337565|ref|YP_001202613.1| F0F1 ATP synthase subunit epsilon [Bradyrhizobium sp. ORS278]
 gi|166222435|sp|A4YKE1|ATPE_BRASO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|146190371|emb|CAL74367.1| ATP synthase subunit epsilon, membrane-bound, F1 sector
           [Bradyrhizobium sp. ORS278]
          Length = 135

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPEK  FSGEV  V +P + GD  VL GHAP + T++ GI+T++    +  + +
Sbjct: 4   FHFDLVSPEKIAFSGEVDQVDVPGQEGDFGVLAGHAPFVATLRPGILTVTTGGTQ-QKII 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLN 109
           V+GG+ +I     T+L++    +      A    I  + + LN
Sbjct: 63  VLGGLAEISEKGLTILADVATSLKELDQTAFATEISGMEAKLN 105


>gi|84683668|ref|ZP_01011571.1| ATP synthase F1, epsilon subunit [Maritimibacter alkaliphilus
          HTCC2654]
 gi|84668411|gb|EAQ14878.1| ATP synthase F1, epsilon subunit [Rhodobacterales bacterium
          HTCC2654]
          Length = 136

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          + F+LVSPE+ + S E  +V +P   GD T +  HAP + T++ GIVT+  +  E  RYV
Sbjct: 5  MQFDLVSPERRLTSTEASAVQIPGADGDFTAMAQHAPTIATLRPGIVTVQGAGGE-ERYV 63

Query: 67 VIGGICDIVPSHCTVLSETILP 88
          V GG  ++ P   TVL+E  +P
Sbjct: 64 VTGGFAEVTPDGTTVLAERAMP 85


>gi|90418834|ref|ZP_01226745.1| ATP synthase, epsilon subunit [Aurantimonas manganoxydans SI85-9A1]
 gi|90336914|gb|EAS50619.1| ATP synthase, epsilon subunit [Aurantimonas manganoxydans SI85-9A1]
          Length = 134

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 66/129 (51%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +   FELVSPE+ + S  V +V +P   G  TV+  HAPV+TT+K G+V  +L     
Sbjct: 1   MADSFQFELVSPEQLLLSEAVTAVNVPGAEGYFTVMAHHAPVMTTLKPGVVVATLEGGAQ 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            R  V+GG  D+  +  T+L+E   P+D      L+ +I +   D+ +    + + + + 
Sbjct: 61  QRIFVLGGFADVNENGFTLLAERATPVDQLDSAELDSQIRDAEEDVTDAATPEAKAKAQH 120

Query: 123 LLVDLSCLR 131
            L  L   R
Sbjct: 121 SLAQLREAR 129


>gi|254292531|ref|YP_003058554.1| ATP synthase F1 subunit epsilon [Hirschia baltica ATCC 49814]
 gi|254041062|gb|ACT57857.1| ATP synthase F1, epsilon subunit [Hirschia baltica ATCC 49814]
          Length = 131

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 64/128 (50%), Gaps = 1/128 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + LHF LVSPE+ +FSGEV  V  P   G   VL GHAP +TT+K+G+V +    +  
Sbjct: 1   MSDKLHFSLVSPERELFSGEVDQVDAPGSEGQFGVLPGHAPFMTTLKAGVVEV-FEGDAR 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            R  V  G  D+ P   TVL+E  + +D     A +  + E    L    D  ++  + +
Sbjct: 60  TRLFVRSGFADVTPQGLTVLAEEAINLDGFDASASKTALAEAQDALIAAEDDHEKEHLTE 119

Query: 123 LLVDLSCL 130
            +  L  L
Sbjct: 120 TITYLEAL 127


>gi|260576483|ref|ZP_05844473.1| ATP synthase F1, epsilon subunit [Rhodobacter sp. SW2]
 gi|259021366|gb|EEW24672.1| ATP synthase F1, epsilon subunit [Rhodobacter sp. SW2]
          Length = 132

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 2/129 (1%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + N L F+LVSPE+ + S +   V +P   GD+T + GHAP +TT++ GI+  ++S E  
Sbjct: 1   MANTLQFDLVSPERRLASVQATEVQIPGADGDLTAMEGHAPTITTLRPGILK-AISAEGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             Y V GG  +I  S  +VL+E  +P+D      L++ I E  +  ++    + R   E+
Sbjct: 60  KTYAVTGGFAEISASGVSVLAERAVPVDEVTTAMLDELIAEARAAASSAVAAN-RDSAEK 118

Query: 123 LLVDLSCLR 131
           L+ D   LR
Sbjct: 119 LVNDFMVLR 127


>gi|317404546|gb|EFV84953.1| ATP synthase subunit epsilon [Achromobacter xylosoxidans C54]
          Length = 141

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 3/111 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH ++VS E+ +FSGE + VVLP E G++ +L GH P+++ ++ G V I  + +      
Sbjct: 4   LHVDVVSAEEAIFSGEAKFVVLPGEAGELGILPGHTPLISRVRPGTVKIVRADQGEENIF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDV 114
           V GGI ++ P   TVL++T +    +D A      KR +E  ++  +  D+
Sbjct: 64  VAGGILEVQPGSVTVLADTAIRAADLDEARALEARKRAEEALANAKDKADI 114


>gi|75674632|ref|YP_317053.1| F0F1 ATP synthase subunit epsilon [Nitrobacter winogradskyi Nb-255]
 gi|119367752|sp|Q3SVJ0|ATPE_NITWN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|74419502|gb|ABA03701.1| ATP synthase F1 subcomplex epsilon subunit [Nitrobacter
           winogradskyi Nb-255]
          Length = 135

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 69/121 (57%), Gaps = 9/121 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPEK  FSGEV  V +P   GD  VL GHAPV+  I+ G++T++    +  + +
Sbjct: 4   FHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVAAIRPGMLTVTAGGTQ-QKII 62

Query: 67  VIGGICDIVPSHCTVLSE---TILPMDNA----CLQALEKRI-DEVCSDLNNICDVDQRF 118
           V+GG+ ++     TVL++   +I  +D A     +  +E R+ D+  S+L+   +    F
Sbjct: 63  VLGGLAEVSEKGLTVLADVATSIEELDRAQFADTIAGMEARLTDKEGSELDKAIERLDHF 122

Query: 119 Q 119
           +
Sbjct: 123 K 123


>gi|91975040|ref|YP_567699.1| F0F1 ATP synthase subunit epsilon [Rhodopseudomonas palustris
          BisB5]
 gi|91681496|gb|ABE37798.1| ATP synthase F1, epsilon subunit [Rhodopseudomonas palustris
          BisB5]
          Length = 151

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           HF+LVSPE+  FSGEV  V +P   GD  VL GHAPV+  I+ GI+T++    +  + V
Sbjct: 20 FHFDLVSPEQVAFSGEVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGGAQ-QKIV 78

Query: 67 VIGGICDIVPSHCTVLSE 84
          V+GGI ++     TVL++
Sbjct: 79 VLGGIAEVSEKGLTVLAD 96


>gi|119367772|sp|Q13DP1|ATPE_RHOPS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
          Length = 135

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           HF+LVSPE+  FSGEV  V +P   GD  VL GHAPV+  I+ GI+T++    +  + V
Sbjct: 4  FHFDLVSPEQVAFSGEVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGGAQ-QKIV 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          V+GGI ++     TVL++
Sbjct: 63 VLGGIAEVSEKGLTVLAD 80


>gi|27375550|ref|NP_767079.1| F0F1 ATP synthase subunit epsilon [Bradyrhizobium japonicum USDA
          110]
 gi|60389778|sp|Q89X75|ATPE_BRAJA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|27348687|dbj|BAC45704.1| ATP synthase epsilon chain [Bradyrhizobium japonicum USDA 110]
          Length = 135

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           HF+LVSPEK  FSGEV  V +P   GD  VL GHAPV+  I+ GI+T++ +     + +
Sbjct: 4  FHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVAAIRPGILTVTTAGRH-EKII 62

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          V+GG+ ++     TVL++    +D 
Sbjct: 63 VLGGLAEVSEKGLTVLADVATSLDE 87


>gi|293603081|ref|ZP_06685515.1| ATP synthase subunit epsilon [Achromobacter piechaudii ATCC 43553]
 gi|292818475|gb|EFF77522.1| ATP synthase subunit epsilon [Achromobacter piechaudii ATCC 43553]
          Length = 141

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 3/111 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH ++VS E+ +FSGE + VVLP E G++ +L GH P+++ I+ G V I  + +      
Sbjct: 4   LHVDVVSAEEAIFSGEAKFVVLPGEAGELGILPGHTPLISRIRPGTVKIVRADQGEENIF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDV 114
           V GGI ++ P   TVL++T +    +D A      K+ +E  ++  +  D+
Sbjct: 64  VAGGILEVQPGSVTVLADTAIRASDLDEARAVEARKKAEEALANAKDKADI 114


>gi|114769415|ref|ZP_01447041.1| ATP synthase F1, epsilon subunit [alpha proteobacterium HTCC2255]
 gi|114550332|gb|EAU53213.1| ATP synthase F1, epsilon subunit [alpha proteobacterium HTCC2255]
          Length = 129

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 68/124 (54%), Gaps = 2/124 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           + F+LVSPE+ + S E   + +P   GD T +  HAPVLTT+K G++++ +   ++  Y+
Sbjct: 4   IQFDLVSPERKLASLEASEIQIPGSDGDFTAMAEHAPVLTTLKPGLLSVKVG-NDLMEYI 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  +I  S+ +VL+E  LP +      +E  I++    L ++   + +   E+ L D
Sbjct: 63  VTGGFVEISGSNASVLAEEALPRNEVDTSVIEGLIEKATIALEDVT-AENKDDAEKRLAD 121

Query: 127 LSCL 130
              L
Sbjct: 122 TKAL 125


>gi|254503990|ref|ZP_05116141.1| ATP synthase F1, epsilon subunit [Labrenzia alexandrii DFL-11]
 gi|222440061|gb|EEE46740.1| ATP synthase F1, epsilon subunit [Labrenzia alexandrii DFL-11]
          Length = 127

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (49%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VSPE+ + S +V  VV+P   G+  VL  H+P ++TIK GI+ +         Y V GG
Sbjct: 1   MVSPERQLLSEQVAEVVVPGTEGEFGVLKNHSPFMSTIKPGILKVRTDAGSWDEYFVRGG 60

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
             DI P   TVL+E  +P+       L + I     D+ +  D D + + E  L  L
Sbjct: 61  FADIAPGGLTVLAEQAIPVSEISEDQLAQAIKNAEEDVADAKDDDTKQKAEMTLSQL 117


>gi|33594187|ref|NP_881831.1| F0F1 ATP synthase subunit epsilon [Bordetella pertussis Tohama I]
 gi|33598625|ref|NP_886268.1| F0F1 ATP synthase subunit epsilon [Bordetella parapertussis 12822]
 gi|33603576|ref|NP_891136.1| F0F1 ATP synthase subunit epsilon [Bordetella bronchiseptica RB50]
 gi|60389742|sp|Q7VU43|ATPE_BORPE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|60389744|sp|Q7W3B1|ATPE_BORPA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|60389746|sp|Q7WEN0|ATPE_BORBR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|33564262|emb|CAE43554.1| ATP synthase epsilon chain [Bordetella pertussis Tohama I]
 gi|33574754|emb|CAE39413.1| ATP synthase epsilon chain [Bordetella parapertussis]
 gi|33577701|emb|CAE34966.1| ATP synthase epsilon chain [Bordetella bronchiseptica RB50]
 gi|332383601|gb|AEE68448.1| F0F1 ATP synthase subunit epsilon [Bordetella pertussis CS]
          Length = 140

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 3/111 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH ++VS E+ +F+GE + VVLP E G++ +L GH P+++ I+ G V I  + E      
Sbjct: 4   LHVDVVSAEEAIFTGEAKFVVLPGEAGELGILPGHTPLISRIRPGTVKIVRADEGEENIF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDV 114
           V GGI ++ P   TVL++T +    +D A   A  ++ +E   +  +  D+
Sbjct: 64  VAGGILEVQPGSVTVLADTAIRAADLDEARAVAAREKAEEALRNAKDKADI 114


>gi|86136464|ref|ZP_01055043.1| ATP synthase F1, epsilon subunit [Roseobacter sp. MED193]
 gi|85827338|gb|EAQ47534.1| ATP synthase F1, epsilon subunit [Roseobacter sp. MED193]
          Length = 137

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 71/132 (53%), Gaps = 5/132 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S +V +V +P   GD+T +  HAP +TT++ G++ +  S +  
Sbjct: 1   MADTMQFDLVSPERSLASLQVNAVQIPGAEGDMTAMPMHAPTITTLRPGVLRVE-SSQGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRF---- 118
             +VV GG  +I     +VL+E  +PMD      L++ I+E  +      D +Q      
Sbjct: 60  SEFVVTGGFAEISAEALSVLAERAIPMDEMTRAHLDELIEEARTMYKTAQDDEQPHDIVE 119

Query: 119 QMEQLLVDLSCL 130
           +  +LL D+  L
Sbjct: 120 EAAKLLSDMEAL 131


>gi|86747390|ref|YP_483886.1| F0F1 ATP synthase subunit epsilon [Rhodopseudomonas palustris HaA2]
 gi|86570418|gb|ABD04975.1| ATP synthase F1, epsilon subunit [Rhodopseudomonas palustris HaA2]
          Length = 139

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPE   FSGEV  V +P   GD  VL GHAPV+  I+ GI+T++    +  + V
Sbjct: 8   FHFDLVSPEMVAFSGEVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGGAQ-QKIV 66

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRI 101
           V+GGI ++     TVL++      +  +Q   + I
Sbjct: 67  VLGGIAEVSEKGLTVLADVATATADVDMQDFAETI 101


>gi|119367770|sp|Q2J3I5|ATPE_RHOP2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
          Length = 135

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPE   FSGEV  V +P   GD  VL GHAPV+  I+ GI+T++    +  + V
Sbjct: 4   FHFDLVSPEMVAFSGEVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGGAQ-QKIV 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRI 101
           V+GGI ++     TVL++      +  +Q   + I
Sbjct: 63  VLGGIAEVSEKGLTVLADVATATADVDMQDFAETI 97


>gi|17548033|ref|NP_521435.1| F0F1 ATP synthase subunit epsilon [Ralstonia solanacearum GMI1000]
 gi|20137359|sp|Q8XU77|ATPE1_RALSO RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
           synthase F1 sector epsilon subunit 1; AltName:
           Full=F-ATPase epsilon subunit 1
 gi|17430339|emb|CAD17104.1| probable atp synthase epsilon chain 1 (atp synthase f1
           sectorepsilon subunit 1) protein [Ralstonia solanacearum
           GMI1000]
          Length = 137

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 72/136 (52%), Gaps = 12/136 (8%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG+ + V LP E G++ +L GH P++T IK G V I     E   +V
Sbjct: 4   IHVDVVSAEQEIFSGDAKFVALPGEAGELGILPGHTPLITRIKPGAVRIETEAGEEFVFV 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD-QRFQME- 121
             GGI ++ P H TVL++T +    +D A     ++  +E     N   D+D  R Q E 
Sbjct: 64  A-GGILEVQPKHVTVLADTAIRGHDLDEAKANEAKRAAEEALQ--NQSSDLDLARAQGEL 120

Query: 122 ----QLLVDLSCLRRR 133
                 L  ++ LRR+
Sbjct: 121 AVATAQLAAIARLRRK 136


>gi|187479683|ref|YP_787708.1| F0F1 ATP synthase subunit epsilon [Bordetella avium 197N]
 gi|119361414|sp|Q2KU37|ATPE_BORA1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|115424270|emb|CAJ50823.1| ATP synthase epsilon chain [Bordetella avium 197N]
          Length = 141

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (56%), Gaps = 3/111 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH ++VS E+ +FSGE + VVLP E G++ +L GH P+++ I+ G V I  + E      
Sbjct: 4   LHVDVVSAEEAIFSGEAKFVVLPGESGELGILPGHTPLISRIRPGTVKIVRADEGEENIF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDV 114
           V GGI ++ P   TVLS+T +    +D A   A  ++ +E   +  +  D+
Sbjct: 64  VAGGILEVQPGSVTVLSDTAIRAADLDEARALAAREKAEEALRNAKDREDI 114


>gi|328545828|ref|YP_004305937.1| ATP synthase epsilon chain [polymorphum gilvum SL003B-26A1]
 gi|326415568|gb|ADZ72631.1| ATP synthase epsilon chain [Polymorphum gilvum SL003B-26A1]
          Length = 135

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 65/125 (52%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     FELVSPE+ + S +V  VV+P   G+  VL  H+P ++T++ G++ +    +++
Sbjct: 1   MAEPFQFELVSPERLLLSDKVLEVVVPGTEGEFGVLKDHSPFMSTMRPGLLKVRKDGDKV 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             Y V GG  D+  +  TVL+E  +P++      +  +I     DL +  D + R   E 
Sbjct: 61  TEYFVRGGFADVSSAGLTVLAELAIPVEEIKPDDIAAQIRNAEEDLADARDDEARRAAET 120

Query: 123 LLVDL 127
           +L  L
Sbjct: 121 VLAQL 125


>gi|259415771|ref|ZP_05739691.1| ATP synthase F1, epsilon subunit [Silicibacter sp. TrichCH4B]
 gi|259347210|gb|EEW58987.1| ATP synthase F1, epsilon subunit [Silicibacter sp. TrichCH4B]
          Length = 137

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 5/132 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S + ++V +P   GD+T +  HAP LTT++ GI+ +  + E  
Sbjct: 1   MADTMQFDLVSPERSLASLQARAVQIPGSEGDMTAMPLHAPTLTTLRPGILKVE-APEGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM-- 120
             Y+V GG   I     +VL+E  +PMD      L++ I+E  +      D +    +  
Sbjct: 60  TEYLVTGGFAQITAEGLSVLAERAIPMDEMTRAHLDELIEEARAMYKTAKDDESAHGLVE 119

Query: 121 --EQLLVDLSCL 130
              +LL D+  L
Sbjct: 120 DAAKLLADMEAL 131


>gi|307942825|ref|ZP_07658170.1| ATP synthase F1, epsilon subunit [Roseibium sp. TrichSKD4]
 gi|307773621|gb|EFO32837.1| ATP synthase F1, epsilon subunit [Roseibium sp. TrichSKD4]
          Length = 135

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 57/115 (49%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +   FELVSPE  + S EV  VV+P   G+  VL  H+P ++TIK GI+ +       
Sbjct: 1   MADTFQFELVSPEHLLLSEEVLEVVVPGTDGEFGVLKHHSPFMSTIKPGILKVRKDGNAW 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
             Y V GG  D  P+  TVL+E   P+       L ++I     D+ +  D + R
Sbjct: 61  VEYFVRGGFADAGPNGLTVLAERATPVSEISADDLNQQIKNAEEDVADAKDDETR 115


>gi|218506447|ref|ZP_03504325.1| F0F1 ATP synthase subunit epsilon [Rhizobium etli Brasil 5]
          Length = 99

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 57/95 (60%)

Query: 41  HAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKR 100
           HAP +TTIK GIV++     +   YVV GG  DI+P+ CT+L+E+ +P++      L +R
Sbjct: 3   HAPTMTTIKPGIVSVRSGSGKKQDYVVFGGFADILPTGCTLLAESAVPVEELNKDELTRR 62

Query: 101 IDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ 135
           I+    +L +    + + ++E  +++L+ LR  +Q
Sbjct: 63  IEAAKKELEDAVHHEHKSKLEHFILELTHLRGVVQ 97


>gi|159045473|ref|YP_001534267.1| ATP synhtase epsilon chain [Dinoroseobacter shibae DFL 12]
 gi|157913233|gb|ABV94666.1| ATP synhtase epsilon chain [Dinoroseobacter shibae DFL 12]
          Length = 131

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 9/132 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEE 61
           + N L F+LVSPE+ + S EV  V +P+  GD+T +  HAP +TT++ GI+T +  S  E
Sbjct: 1   MANTLQFDLVSPERSLASLEVTEVQIPAADGDMTAMADHAPTITTLRPGILTAVGPSGRE 60

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNI----CDVDQR 117
              + V GG  +I     TVL+E   P       ALE+ ++   +  +       DV ++
Sbjct: 61  --SFAVTGGFAEISAEGTTVLAERAYPAGADARAALEEHLEAARAKASEAQGEHKDVAEK 118

Query: 118 F--QMEQLLVDL 127
               M +LL D+
Sbjct: 119 LVDDMVKLLADM 130


>gi|92116486|ref|YP_576215.1| F0F1 ATP synthase subunit epsilon [Nitrobacter hamburgensis X14]
 gi|119361403|sp|Q1QPU2|ATPE2_NITHX RecName: Full=ATP synthase epsilon chain 2; AltName: Full=ATP
           synthase F1 sector epsilon subunit 2; AltName:
           Full=F-ATPase epsilon subunit 2
 gi|91799380|gb|ABE61755.1| ATP synthase F1 subcomplex epsilon subunit [Nitrobacter
           hamburgensis X14]
          Length = 136

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 61/100 (61%), Gaps = 1/100 (1%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           LVSPE  +FSG+V  V LP   GD+ VL GHAP++  ++ GIVT +++ +   R+V++GG
Sbjct: 8   LVSPESLLFSGQVDQVDLPGIEGDLGVLAGHAPIVVMLRPGIVT-TVAGDIRDRFVILGG 66

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
           + +      T+L+++   +D   L  L+ +IDE+   L  
Sbjct: 67  LAEFSQGELTILADSASSVDGFDLTRLKAQIDEMQESLAK 106


>gi|254466359|ref|ZP_05079770.1| ATP synthase F1, epsilon subunit [Rhodobacterales bacterium Y4I]
 gi|206687267|gb|EDZ47749.1| ATP synthase F1, epsilon subunit [Rhodobacterales bacterium Y4I]
          Length = 137

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   + F+LVSPE+ + S +V +V +P   GD+T +  HAP +TT++ G++ +  S E  
Sbjct: 1   MAQTMQFDLVSPERALASLQVSAVQIPGAEGDMTAMPSHAPTITTLRPGVLKVE-SPEGN 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM-- 120
             Y+V GG  +I     +VL+E  +PM       + + I+E         + DQ   +  
Sbjct: 60  AEYLVTGGFAEIAGDSLSVLAERAIPMTEMTRDQMNELIEEAREMYKTAKEEDQPHGLVE 119

Query: 121 --EQLLVDLSCL 130
              +LL D+  L
Sbjct: 120 DAAKLLADMEAL 131


>gi|315497309|ref|YP_004086113.1| atpase, f1 complex, delta/epsilon subunit-like protein
          [Asticcacaulis excentricus CB 48]
 gi|315415321|gb|ADU11962.1| ATPase, F1 complex, delta/epsilon subunit-like protein
          [Asticcacaulis excentricus CB 48]
          Length = 91

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + LH  LV+PEK +F+G+V  V+ P   G+  VL GHAP++TT+  G VTI L+ ++ 
Sbjct: 1  MADKLHVSLVTPEKELFAGDVDQVIAPGSEGEFGVLAGHAPLMTTLTEGTVTI-LNGDQK 59

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
            + VIGG  D+     T+L+E
Sbjct: 60 RMFQVIGGFADVNAEGITILAE 81


>gi|311103599|ref|YP_003976452.1| ATP synthase F1 subunit epsilon [Achromobacter xylosoxidans A8]
 gi|310758288|gb|ADP13737.1| ATP synthase F1, epsilon subunit [Achromobacter xylosoxidans A8]
          Length = 141

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 64/111 (57%), Gaps = 3/111 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH ++VS E+ +FSGE + VVLP E G++ +L GH P+++ I+ G V I  + +      
Sbjct: 4   LHVDVVSAEEAIFSGEAKFVVLPGEAGELGILPGHTPLISRIRPGTVKIVRADQGEENIF 63

Query: 67  VIGGICDIVPSHCTVLSET-ILPMDNACLQALEKR--IDEVCSDLNNICDV 114
           V GGI ++ P   TVL++T I   D    +ALE R   ++  ++  +  D+
Sbjct: 64  VAGGILEVQPGSVTVLADTAIRAADLDEARALEARQKAEQALANAKDKADI 114


>gi|209965525|ref|YP_002298440.1| ATP synthase F1, epsilon subunit [Rhodospirillum centenum SW]
 gi|226740279|sp|B6IPC5|ATPE_RHOCS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|209958991|gb|ACI99627.1| ATP synthase F1, epsilon subunit [Rhodospirillum centenum SW]
          Length = 146

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 5/128 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + L FELVSPEK + S  V  VV+P   G   VL GHAP++ T++ GI+ +    +  
Sbjct: 1   MADKLEFELVSPEKLLVSQPVAMVVVPGADGLFGVLPGHAPMIVTVRPGIIDVYGDNQTT 60

Query: 63  --HRYVVIGGICDIVPSHCTVLSETILPMD---NACLQALEKRIDEVCSDLNNICDVDQR 117
              R  V GG  ++  + CTVL+E    +D    +   ALEK+I ++  D+ +     +R
Sbjct: 61  VSRRIFVAGGFAEVTDTRCTVLAEEASDLDALLKSDTAALEKQISDLREDIEDATSDVER 120

Query: 118 FQMEQLLV 125
             +E  LV
Sbjct: 121 RALETRLV 128


>gi|126728279|ref|ZP_01744095.1| ATP synthase F1, epsilon subunit [Sagittula stellata E-37]
 gi|126711244|gb|EBA10294.1| ATP synthase F1, epsilon subunit [Sagittula stellata E-37]
          Length = 144

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 70/131 (53%), Gaps = 10/131 (7%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S EV SV +P   GD+T +  HAP +TT++ G++T+  +    
Sbjct: 1   MADTMQFDLVSPERKLLSAEVTSVQIPGADGDMTAMPNHAPTITTLRPGLLTVETTG-GT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDL-----NNICDV 114
             +VV GG  +I   + +VL+E  LP   MD A  +AL K   E          N    V
Sbjct: 60  EVFVVTGGFAEIG-ENVSVLAEKALPKGDMDQATYEALVKEAHEAYQQTKEAYQNEPGPV 118

Query: 115 DQRFQMEQLLV 125
           D+  ++ Q +V
Sbjct: 119 DEAAKLLQDMV 129


>gi|99081925|ref|YP_614079.1| F0F1 ATP synthase subunit epsilon [Ruegeria sp. TM1040]
 gi|119367787|sp|Q1GEU9|ATPE_SILST RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|99038205|gb|ABF64817.1| ATP synthase F1 epsilon subunit [Ruegeria sp. TM1040]
          Length = 137

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (57%), Gaps = 1/102 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S + ++V +P   GD+T +  HAP LTT++ GI+ +  + E  
Sbjct: 1   MADTMQFDLVSPERSLASLQARAVQIPGAEGDMTAMPLHAPTLTTLRPGILKVD-APEGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV 104
             Y+V GG   I     +VL+E  +PMD      L++ I+E 
Sbjct: 60  TEYLVTGGFAQITAEGLSVLAERAIPMDEMTRAHLDELIEEA 101


>gi|118594196|ref|ZP_01551543.1| ATP synthase subunit epsilon [Methylophilales bacterium HTCC2181]
 gi|118439974|gb|EAV46601.1| ATP synthase subunit epsilon [Methylophilales bacterium HTCC2181]
          Length = 141

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 57/86 (66%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEE 61
          + N +  ++VS E+ +FSGE + VV P+++G++ +   HAP++TT+KSG + I L+  +E
Sbjct: 1  MANTVQIDVVSAEESIFSGEAEFVVAPAKMGEVGIYPNHAPMITTLKSGSLKIKLADKKE 60

Query: 62 IHRYVVIGGICDIVPSHCTVLSETIL 87
           H   V GGI ++ P   TVLS+T +
Sbjct: 61 EHLIYVSGGILEVQPGIITVLSDTAI 86


>gi|92116149|ref|YP_575878.1| F0F1 ATP synthase subunit epsilon [Nitrobacter hamburgensis X14]
 gi|119361397|sp|Q1QQS9|ATPE1_NITHX RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
           synthase F1 sector epsilon subunit 1; AltName:
           Full=F-ATPase epsilon subunit 1
 gi|91799043|gb|ABE61418.1| ATP synthase F1 subcomplex epsilon subunit [Nitrobacter
           hamburgensis X14]
          Length = 135

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 73/133 (54%), Gaps = 9/133 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            HF+LVSPEK  FSG+V  V +P   GD  VL GHAPV+  I+ GI+TI+       + +
Sbjct: 4   FHFDLVSPEKLTFSGDVDQVDVPGVEGDFGVLAGHAPVVAAIRPGILTITTGGTP-QKII 62

Query: 67  VIGGICDIVPSHCTVLSE---TILPMDNA----CLQALEKRIDEV-CSDLNNICDVDQRF 118
           V+GG+ ++     TVL++   +I  +D A     + ++E ++ E   S+L+   +    F
Sbjct: 63  VLGGLAEVSEKGLTVLADVATSIQELDRAQFADTIASMEAKLAEKEGSELDKAIERLDHF 122

Query: 119 QMEQLLVDLSCLR 131
           +  Q  ++ + L 
Sbjct: 123 KSIQSQLNTTALH 135


>gi|163869184|ref|YP_001610436.1| ATP synthase epsilon chain [Bartonella tribocorum CIP 105476]
 gi|161018883|emb|CAK02441.1| ATP synthase epsilon chain [Bartonella tribocorum CIP 105476]
          Length = 138

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           FELVSPEK VFS  V SVVLPS  G +TV+  HAP++  I  G V I  +  E   + V 
Sbjct: 11  FELVSPEKIVFSERVVSVVLPSASGFLTVMAHHAPLVAGIVLGSVRIRTAAGE-KLFAVC 69

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDL-NNICDVDQRFQMEQLLVDL 127
           GG+ +I  S C++L E  + +++     LE++I +V + L     D D R ++E     L
Sbjct: 70  GGVANITFSGCSLLVEHAVAVEHLSFDVLEQQILQVQATLEGGTSDEDNR-KIEAFFQQL 128

Query: 128 SC 129
           S 
Sbjct: 129 SS 130


>gi|67906679|gb|AAY82767.1| predicted F0F1-type ATP synthase epsilon subunit [uncultured
           bacterium eBACred22E04]
          Length = 141

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 74/133 (55%), Gaps = 7/133 (5%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + +  E+VS E+ +FS +V+ V  P+E+G++ V   H P++T +K G V   +S +E+
Sbjct: 1   MADKIRLEIVSAEEELFSEDVEMVYAPAEMGEVGVSPNHTPLITKLKPGDVRAQISKDEM 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDN----ACLQALEKRIDEVCSDLNNICDVDQRF 118
             + V GGI +I P+  T+LS+T +  D+      L+A E++  E     N+  ++D   
Sbjct: 61  KTFYVSGGILEIQPNEVTILSDTAIREDDLDEERALEA-ERQAKEAMK--NSSSEIDSSK 117

Query: 119 QMEQLLVDLSCLR 131
              +LL   + LR
Sbjct: 118 AKTELLQAAAQLR 130


>gi|114322015|ref|YP_743698.1| F0F1 ATP synthase subunit epsilon [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|119361409|sp|Q0A4M9|ATPE_ALHEH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|114228409|gb|ABI58208.1| ATP synthase F1 subcomplex epsilon subunit [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 140

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (51%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH ++VS E+ + SGE + +V P+  GDI +   HAP+LT ++ G V +     E   + 
Sbjct: 4   LHVDIVSAEQAIHSGEAKMLVAPAREGDIGITPRHAPLLTKLRPGEVRVQDENGEERFFY 63

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T      +D A  Q  ++R +E  ++     D    + ++ +
Sbjct: 64  VSGGIIEVQPHKVTVLADTAARARDLDEAAAQEAKRRAEEALANRKAGEDYSHVQAELAE 123

Query: 123 LLVDLSCLRR 132
            +  L  L R
Sbjct: 124 AMAQLQTLER 133


>gi|325525632|gb|EGD03406.1| F0F1 ATP synthase subunit epsilon [Burkholderia sp. TJI49]
          Length = 141

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 70/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I +         
Sbjct: 4   IKVDVVSAEELIFSGEAKFVALPGETGELGILPGHTPLITRIRPGAVRIEVEGGNDEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D+A  +   KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDSAKAEEARKRAEETLQNAKSDIDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|254250971|ref|ZP_04944289.1| ATP synthase subunit epsilon [Burkholderia dolosa AUO158]
 gi|124893580|gb|EAY67460.1| ATP synthase subunit epsilon [Burkholderia dolosa AUO158]
          Length = 141

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 70/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I +         
Sbjct: 4   IKVDVVSAEEQIFSGEAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEVEGGNDEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D+A  +   KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDSAKAEEARKRAEETLQNAKSDIDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|167564617|ref|ZP_02357533.1| F0F1 ATP synthase subunit epsilon [Burkholderia oklahomensis EO147]
 gi|167571759|ref|ZP_02364633.1| F0F1 ATP synthase subunit epsilon [Burkholderia oklahomensis C6786]
          Length = 141

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 71/130 (54%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     +     
Sbjct: 4   IKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEAESGDEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D+A  +  +KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDSAKAEEAKKRAEETLQNAKSDLDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|206558441|ref|YP_002229201.1| F0F1 ATP synthase subunit epsilon [Burkholderia cenocepacia J2315]
 gi|226740229|sp|B4EEZ0|ATPE_BURCJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|198034478|emb|CAR50343.1| ATP synthase epsilon chain [Burkholderia cenocepacia J2315]
          Length = 141

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 70/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I +         
Sbjct: 4   IKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITRIRPGAVRIEVEGGNDEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   ++ +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNVKSDLDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|329114831|ref|ZP_08243588.1| ATP synthase epsilon chain [Acetobacter pomorum DM001]
 gi|326695962|gb|EGE47646.1| ATP synthase epsilon chain [Acetobacter pomorum DM001]
          Length = 136

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 7/105 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  E++SPEK + S EV   VLP   GDI  +   AP++  ++ GIV +        RY 
Sbjct: 3   IQIEIISPEKVLVSREVDMAVLPGMEGDIAAMPERAPMMLLLRGGIVALYDGDTVKDRYF 62

Query: 67  VIGGICDIVPSHCTVLSETILP-----MDNAC--LQALEKRIDEV 104
           V GG  DI P+ CTVL++  +P     +DNA   L+AL +  D+ 
Sbjct: 63  VGGGFADITPTRCTVLADKAVPVSEISIDNATAQLEALSEAWDQA 107


>gi|78064766|ref|YP_367535.1| F0F1 ATP synthase subunit epsilon [Burkholderia sp. 383]
 gi|107024490|ref|YP_622817.1| F0F1 ATP synthase subunit epsilon [Burkholderia cenocepacia AU
           1054]
 gi|115350154|ref|YP_771993.1| F0F1 ATP synthase subunit epsilon [Burkholderia ambifaria AMMD]
 gi|116688131|ref|YP_833754.1| F0F1 ATP synthase subunit epsilon [Burkholderia cenocepacia HI2424]
 gi|170699475|ref|ZP_02890518.1| ATP synthase F1, epsilon subunit [Burkholderia ambifaria IOP40-10]
 gi|170731478|ref|YP_001763425.1| F0F1 ATP synthase subunit epsilon [Burkholderia cenocepacia MC0-3]
 gi|171315825|ref|ZP_02905056.1| ATP synthase F1, epsilon subunit [Burkholderia ambifaria MEX-5]
 gi|172059173|ref|YP_001806825.1| F0F1 ATP synthase subunit epsilon [Burkholderia ambifaria MC40-6]
 gi|254246699|ref|ZP_04940020.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Burkholderia cenocepacia PC184]
 gi|119361395|sp|Q1BRB1|ATPE1_BURCA RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
           synthase F1 sector epsilon subunit 1; AltName:
           Full=F-ATPase epsilon subunit 1
 gi|119361417|sp|Q39KX5|ATPE_BURS3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|122324406|sp|Q0BJL4|ATPE_BURCM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740228|sp|B1YQL5|ATPE_BURA4 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|77965511|gb|ABB06891.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia sp. 383]
 gi|105894679|gb|ABF77844.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia
           cenocepacia AU 1054]
 gi|115280142|gb|ABI85659.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia ambifaria
           AMMD]
 gi|116646220|gb|ABK06861.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia
           cenocepacia HI2424]
 gi|124871475|gb|EAY63191.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Burkholderia cenocepacia PC184]
 gi|169814720|gb|ACA89303.1| ATP synthase F1, epsilon subunit [Burkholderia cenocepacia MC0-3]
 gi|170135624|gb|EDT03909.1| ATP synthase F1, epsilon subunit [Burkholderia ambifaria IOP40-10]
 gi|171099014|gb|EDT43799.1| ATP synthase F1, epsilon subunit [Burkholderia ambifaria MEX-5]
 gi|171991690|gb|ACB62609.1| ATP synthase F1, epsilon subunit [Burkholderia ambifaria MC40-6]
          Length = 141

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 69/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I +         
Sbjct: 4   IKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITRIRPGAVRIEVEGGNDEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNAKSDLDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|161523287|ref|YP_001578299.1| F0F1 ATP synthase subunit epsilon [Burkholderia multivorans ATCC
           17616]
 gi|189351940|ref|YP_001947568.1| F0F1 ATP synthase subunit epsilon [Burkholderia multivorans ATCC
           17616]
 gi|221214287|ref|ZP_03587259.1| ATP synthase F1, epsilon subunit [Burkholderia multivorans CGD1]
 gi|226740230|sp|A9AJG5|ATPE_BURM1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|160340716|gb|ABX13802.1| ATP synthase F1, epsilon subunit [Burkholderia multivorans ATCC
           17616]
 gi|189335962|dbj|BAG45032.1| F-type H+-transporting ATPase epsilon chain [Burkholderia
           multivorans ATCC 17616]
 gi|221165942|gb|EED98416.1| ATP synthase F1, epsilon subunit [Burkholderia multivorans CGD1]
          Length = 141

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 69/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I +         
Sbjct: 4   IKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITRIRPGAVRIEVEGGSDEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNAKSDLDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|126739853|ref|ZP_01755544.1| ATP synthase F1, epsilon subunit [Roseobacter sp. SK209-2-6]
 gi|126719085|gb|EBA15796.1| ATP synthase F1, epsilon subunit [Roseobacter sp. SK209-2-6]
          Length = 137

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 68/132 (51%), Gaps = 5/132 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   + F+LVSPE+ + S +  +V +P   GD+T +  HAP +TT++ G++ +  S E  
Sbjct: 1   MAQTMQFDLVSPERSLASLQASAVQIPGAEGDMTAMPSHAPTITTLRPGVLKVE-SPEGN 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRF---- 118
             Y+V GG  +I     +VL+E  +PM       L++ I+E  +      + +Q      
Sbjct: 60  ADYLVTGGFAEISGEALSVLAERAIPMTEMTRAHLDELIEEARNTYKTAKEEEQPHDIVE 119

Query: 119 QMEQLLVDLSCL 130
           +  +LL D+  L
Sbjct: 120 EAAKLLADMEAL 131


>gi|134294239|ref|YP_001117974.1| F0F1 ATP synthase subunit epsilon [Burkholderia vietnamiensis G4]
 gi|134137396|gb|ABO53139.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia
           vietnamiensis G4]
          Length = 141

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 69/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I +         
Sbjct: 4   IKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITRIRPGAVRIEVEGSNDEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDAAKAEDARKRAEETLQNAKSDLDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|115522307|ref|YP_779218.1| F0F1 ATP synthase subunit epsilon [Rhodopseudomonas palustris
          BisA53]
 gi|122298000|sp|Q07UZ6|ATPE_RHOP5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|115516254|gb|ABJ04238.1| ATP synthase F1, epsilon subunit [Rhodopseudomonas palustris
          BisA53]
          Length = 135

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           HF+LVSPEK  FSGEV  V +P   GD  VL  HAPV+  I+ GI+T+ ++     + V
Sbjct: 4  FHFDLVSPEKLAFSGEVDQVDVPGIEGDFGVLANHAPVVAVIRPGILTV-ITGGNQQKIV 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          V+GGI ++     TVL++
Sbjct: 63 VLGGIAEVSEKGLTVLAD 80


>gi|307731458|ref|YP_003908682.1| ATP synthase F1 subunit epsilon [Burkholderia sp. CCGE1003]
 gi|323527840|ref|YP_004229993.1| ATP synthase F1 subunit epsilon [Burkholderia sp. CCGE1001]
 gi|307585993|gb|ADN59391.1| ATP synthase F1, epsilon subunit [Burkholderia sp. CCGE1003]
 gi|323384842|gb|ADX56933.1| ATP synthase F1, epsilon subunit [Burkholderia sp. CCGE1001]
          Length = 141

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 68/130 (52%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     E     
Sbjct: 4   IKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEAENGEEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDL-NNICDVDQRFQMEQ 122
           V GGI +I P   TVL++T +    +D A  +   KR +E   +  +N+     + ++  
Sbjct: 64  VAGGILEIQPGAVTVLADTAIRGKDLDEAKAEDARKRAEEALQNTGSNLEYATAQAELAY 123

Query: 123 LLVDLSCLRR 132
               L+ ++R
Sbjct: 124 ATAQLAAIQR 133


>gi|187925862|ref|YP_001897504.1| F0F1 ATP synthase subunit epsilon [Burkholderia phytofirmans PsJN]
 gi|226740232|sp|B2T7J9|ATPE_BURPP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|187717056|gb|ACD18280.1| ATP synthase F1, epsilon subunit [Burkholderia phytofirmans PsJN]
          Length = 141

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (51%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     E     
Sbjct: 4   IKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEAENGEEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLN-NICDVDQRFQMEQ 122
           V GGI +I P   TVL++T +    +D A  +   KR +E   +   N+     + ++  
Sbjct: 64  VAGGILEIQPGAVTVLADTAIRGKDLDEAKAEDARKRAEEALQNTGSNLEYATAQAELAY 123

Query: 123 LLVDLSCLRR 132
               L+ ++R
Sbjct: 124 ATAQLAAIQR 133


>gi|329911643|ref|ZP_08275583.1| ATP synthase epsilon chain [Oxalobacteraceae bacterium IMCC9480]
 gi|327545823|gb|EGF30943.1| ATP synthase epsilon chain [Oxalobacteraceae bacterium IMCC9480]
          Length = 140

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 75/133 (56%), Gaps = 8/133 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE-E 61
           + + +H ++VS E  +FSGE + V LP E G++ +  GH P++T IK G V I ++ + E
Sbjct: 1   MAHTIHVDVVSAETQIFSGEAEFVALPGESGELGIYPGHTPLITRIKPGTVRIKVAGQAE 60

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILP---MDNACLQALE-KRIDEVCSDLNNICDVDQR 117
           +    V GGI ++ P+  TVL++T +    +D A  +ALE KR+ E    +N    +D  
Sbjct: 61  MELVFVAGGILEVQPNAVTVLADTAIRGSDLDEA--KALEAKRLAEEAM-INQESKIDYA 117

Query: 118 FQMEQLLVDLSCL 130
               +L V ++ L
Sbjct: 118 AAQAELSVAIAQL 130


>gi|329890938|ref|ZP_08269281.1| ATP synthase epsilon chain [Brevundimonas diminuta ATCC 11568]
 gi|328846239|gb|EGF95803.1| ATP synthase epsilon chain [Brevundimonas diminuta ATCC 11568]
          Length = 89

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   L+F LV+PE+ VF+G V  V  P   GD  VL GHAP +TT++ G+VT+    +  
Sbjct: 1  MAGKLNFSLVAPEREVFAGSVDQVDAPGVEGDFGVLPGHAPFMTTLREGVVTVYDGAQR- 59

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
           R+ V GG  D+     T+L+E
Sbjct: 60 RRFEVKGGFADVNGEGLTILAE 81


>gi|170694321|ref|ZP_02885475.1| ATP synthase F1, epsilon subunit [Burkholderia graminis C4D1M]
 gi|170140744|gb|EDT08918.1| ATP synthase F1, epsilon subunit [Burkholderia graminis C4D1M]
          Length = 141

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (51%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     E     
Sbjct: 4   IKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEAENGEEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLN-NICDVDQRFQMEQ 122
           V GGI +I P   TVL++T +    +D A  +   KR +E   +   N+     + ++  
Sbjct: 64  VAGGILEIQPGAVTVLADTAIRGKDLDEAKAEDARKRAEEALQNTGSNLEYATAQAELAY 123

Query: 123 LLVDLSCLRR 132
               L+ ++R
Sbjct: 124 ATAQLAAIQR 133


>gi|90421697|ref|YP_530067.1| F0F1 ATP synthase subunit epsilon [Rhodopseudomonas palustris
          BisB18]
 gi|119367771|sp|Q21CY8|ATPE_RHOPB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|90103711|gb|ABD85748.1| ATP synthase F1, epsilon subunit [Rhodopseudomonas palustris
          BisB18]
          Length = 135

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            F+LVSPEK  FSG+V  V +P   GD  VL GHAPV+  I+ G++TI+    +  + V
Sbjct: 4  FQFDLVSPEKLAFSGQVDQVDIPGVEGDFGVLAGHAPVVAVIRPGLLTITAGGNQ-QKIV 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          V+GG+ ++     TVL++
Sbjct: 63 VLGGLAEVSDKGLTVLAD 80


>gi|296157534|ref|ZP_06840369.1| ATP synthase F1, epsilon subunit [Burkholderia sp. Ch1-1]
 gi|295892306|gb|EFG72089.1| ATP synthase F1, epsilon subunit [Burkholderia sp. Ch1-1]
          Length = 141

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     E     V G
Sbjct: 7   DVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEAENGEEEFVFVAG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLN-NICDVDQRFQMEQLLV 125
           GI +I P   TVL++T +    +D A  +   KR +E   +   N+     + ++     
Sbjct: 67  GILEIQPGAVTVLADTAIRGKDLDEAKAEDARKRAEEALQNTGSNLEYATAQAELAYATA 126

Query: 126 DLSCLRR 132
            L+ ++R
Sbjct: 127 QLAAIQR 133


>gi|134096551|ref|YP_001101626.1| F0F1 ATP synthase subunit epsilon [Herminiimonas arsenicoxydans]
 gi|166222465|sp|A4GAG8|ATPE_HERAR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|133740454|emb|CAL63505.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit)
           [Herminiimonas arsenicoxydans]
          Length = 140

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 74/135 (54%), Gaps = 5/135 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + +  E+VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I ++ +  
Sbjct: 1   MAHTMRVEVVSAEEEIFSGEAEFVALPGESGELGILPGHTPLITRIRPGAVRIKIAGQAE 60

Query: 63  HRYV-VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ-R 117
             +V V GGI ++ P   TVL++T +    +D A     ++  +E   +  +  D  Q +
Sbjct: 61  DEFVFVAGGILEVQPHGVTVLADTAIRGADLDEAKAAEAKRLAEEALVNKESKIDYAQAQ 120

Query: 118 FQMEQLLVDLSCLRR 132
            ++   +  L+ ++R
Sbjct: 121 AELATAIAQLAAIQR 135


>gi|258541223|ref|YP_003186656.1| ATP synthase F1 subunit epsilon [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632301|dbj|BAH98276.1| ATP synthase F1 epsilon subunit [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635358|dbj|BAI01327.1| ATP synthase F1 epsilon subunit [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638413|dbj|BAI04375.1| ATP synthase F1 epsilon subunit [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641467|dbj|BAI07422.1| ATP synthase F1 epsilon subunit [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644522|dbj|BAI10470.1| ATP synthase F1 epsilon subunit [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647577|dbj|BAI13518.1| ATP synthase F1 epsilon subunit [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650630|dbj|BAI16564.1| ATP synthase F1 epsilon subunit [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653621|dbj|BAI19548.1| ATP synthase F1 epsilon subunit [Acetobacter pasteurianus IFO
           3283-12]
          Length = 136

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 7/105 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  E++SPEK + S EV   VLP   GDI  +   AP++  ++ G+V +        RY 
Sbjct: 3   IQIEIISPEKVLVSREVDMAVLPGMEGDIAAMPERAPMMLLLRGGVVALYDGDTVKDRYF 62

Query: 67  VIGGICDIVPSHCTVLSETILP-----MDNAC--LQALEKRIDEV 104
           V GG  DI P+ CTVL++  +P     +DNA   L+AL +  D+ 
Sbjct: 63  VGGGFADITPTRCTVLADKAVPVSEISIDNATAQLEALSEAWDQA 107


>gi|197103704|ref|YP_002129081.1| ATP synthase F1, epsilon subunit [Phenylobacterium zucineum HLK1]
 gi|196477124|gb|ACG76652.1| ATP synthase F1, epsilon subunit [Phenylobacterium zucineum HLK1]
          Length = 87

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + LHF LVSPE+ +FSG V  V  P   GD  VL  HAP +TT+K G V + +   ++
Sbjct: 1  MADKLHFSLVSPERELFSGLVDQVDAPGSEGDFGVLAHHAPFMTTLKEGQVRVYVDG-KV 59

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
            Y V GG  D+ P   T+L+E
Sbjct: 60 TVYEVRGGFADVTPEGLTILAE 81


>gi|221202176|ref|ZP_03575211.1| ATP synthase F1, epsilon subunit [Burkholderia multivorans CGD2M]
 gi|221208763|ref|ZP_03581762.1| ATP synthase F1, epsilon subunit [Burkholderia multivorans CGD2]
 gi|221171395|gb|EEE03843.1| ATP synthase F1, epsilon subunit [Burkholderia multivorans CGD2]
 gi|221177970|gb|EEE10382.1| ATP synthase F1, epsilon subunit [Burkholderia multivorans CGD2M]
          Length = 180

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 69/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I +         
Sbjct: 43  IKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITRIRPGAVRIEVEGGSDEFVF 102

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   +  +  D+ + + ++  
Sbjct: 103 VAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNAKSDLDLAKAQSELAT 162

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 163 AMAQLEAIQR 172


>gi|167587927|ref|ZP_02380315.1| F0F1 ATP synthase subunit epsilon [Burkholderia ubonensis Bu]
          Length = 141

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (53%), Gaps = 5/112 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I           
Sbjct: 4   IKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIETESGNDEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
           V GGI ++ P   TVL++T +    +D+A  +   KR +E     N   D+D
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDSAKAEEARKRAEETLQ--NAKSDID 113


>gi|167838423|ref|ZP_02465282.1| F0F1 ATP synthase subunit epsilon [Burkholderia thailandensis
           MSMB43]
          Length = 141

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 69/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     +     
Sbjct: 4   IKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEAESGDEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNAKSDIDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|109900592|ref|YP_663847.1| ATP synthase F1, epsilon subunit [Pseudoalteromonas atlantica T6c]
 gi|119367759|sp|Q15MU5|ATPE_PSEA6 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|109702873|gb|ABG42793.1| ATP synthase F1 subcomplex epsilon subunit [Pseudoalteromonas
           atlantica T6c]
          Length = 137

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 61/101 (60%), Gaps = 5/101 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E  +FSG VQS+ +    G++ V  GHAP+LTTIK+G+V +     E     
Sbjct: 5   IQLDVVSAEDSIFSGLVQSIQVTGSEGELGVQYGHAPLLTTIKAGMVNVVKQHGEEELIY 64

Query: 67  VIGGICDIVPSHCTVLSETILPM----DNACLQALEKRIDE 103
           V GG+ ++ P H +VL++T L      + A L+A +KR++E
Sbjct: 65  VAGGVLEVQPGHISVLADTALRAGDLDEQAVLEA-KKRLEE 104


>gi|167648690|ref|YP_001686353.1| F0F1 ATP synthase subunit epsilon [Caulobacter sp. K31]
 gi|167351120|gb|ABZ73855.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Caulobacter sp. K31]
          Length = 86

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LHF LV+PE+ +FS EV  V  P   GD  VL GHAP +TT++ G VT+     ++  + 
Sbjct: 4  LHFSLVAPERELFSAEVDQVDAPGAEGDFGVLPGHAPFMTTLREGKVTVR-DGSKLRVFD 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          + GG  D+ P   T+L+E
Sbjct: 63 IQGGFADVGPDGFTILAE 80


>gi|85704183|ref|ZP_01035286.1| ATP synthase F1, epsilon subunit [Roseovarius sp. 217]
 gi|85671503|gb|EAQ26361.1| ATP synthase F1, epsilon subunit [Roseovarius sp. 217]
          Length = 146

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S     V +P   GD+T +  HAP++TT++ GIV +S    E 
Sbjct: 6   MADTVQFDLVSPERLLASVAAHEVSIPGAEGDLTAMADHAPLITTLRPGIVRVSGPSGE- 64

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
             YVV GG  +I  +  +VL+E  +  ++   +A +  ++     L N  D
Sbjct: 65  KEYVVTGGFAEINGTSVSVLAEQAVAREDMTKEAYQTMVNAATDKLANAQD 115


>gi|209515775|ref|ZP_03264638.1| ATP synthase F1, epsilon subunit [Burkholderia sp. H160]
 gi|295678132|ref|YP_003606656.1| ATP synthase F1, epsilon subunit [Burkholderia sp. CCGE1002]
 gi|209503802|gb|EEA03795.1| ATP synthase F1, epsilon subunit [Burkholderia sp. H160]
 gi|295437975|gb|ADG17145.1| ATP synthase F1, epsilon subunit [Burkholderia sp. CCGE1002]
          Length = 141

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 69/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I +   E     
Sbjct: 4   IKVDVVSAEEEIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEVENGEEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDL-NNICDVDQRFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   +  +N+     + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDEAKAEDARKRAEEALQNTGSNLEYATAQAELAY 123

Query: 123 LLVDLSCLRR 132
               L+ ++R
Sbjct: 124 ATAQLAAIQR 133


>gi|186477772|ref|YP_001859242.1| F0F1 ATP synthase subunit epsilon [Burkholderia phymatum STM815]
 gi|226740231|sp|B2JJ94|ATPE_BURP8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|184194231|gb|ACC72196.1| ATP synthase F1, epsilon subunit [Burkholderia phymatum STM815]
          Length = 141

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     E     V G
Sbjct: 7   DVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIESENGEEEFVFVAG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDL-NNICDVDQRFQMEQLLV 125
           GI ++ P   TVL++T +    +D A  +   KR +E   +  +N+     + ++     
Sbjct: 67  GILEVQPGAVTVLADTAIRGKDLDEAKAEQARKRAEEALQNTGSNLEYATAQAELAYATA 126

Query: 126 DLSCLRR 132
            L+ ++R
Sbjct: 127 QLAAIQR 133


>gi|110680692|ref|YP_683699.1| F0F1 ATP synthase subunit epsilon [Roseobacter denitrificans OCh
          114]
 gi|119367776|sp|Q162T0|ATPE_ROSDO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|109456808|gb|ABG33013.1| ATP synthase F1, epsilon subunit [Roseobacter denitrificans OCh
          114]
          Length = 138

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 54/86 (62%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + + F+LVSPE+ + SG+V +V +P   GD+T +  HAP +TT++ G++ ++   +  
Sbjct: 1  MADTVQFDLVSPERLLASGQVTAVQIPGADGDMTAMAEHAPTITTLRPGLL-VTEGPDGT 59

Query: 63 HRYVVIGGICDIVPSHCTVLSETILP 88
            YVV GG  +I  S  +VL+E  +P
Sbjct: 60 SEYVVTGGFAEITASSISVLAERAIP 85


>gi|91785732|ref|YP_560938.1| F0F1 ATP synthase subunit epsilon [Burkholderia xenovorans LB400]
 gi|119361396|sp|Q13SQ3|ATPE1_BURXL RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
           synthase F1 sector epsilon subunit 1; AltName:
           Full=F-ATPase epsilon subunit 1
 gi|91689686|gb|ABE32886.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia xenovorans
           LB400]
          Length = 141

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     E     V G
Sbjct: 7   DVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEAENGEEEFVFVAG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLN-NICDVDQRFQMEQLLV 125
           GI ++ P   TVL++T +    +D A  +   KR +E   +   N+     + ++     
Sbjct: 67  GILEVQPGAVTVLADTAIRGKDLDEAKAEDARKRAEEALQNTGSNLEYATAQAELAYATA 126

Query: 126 DLSCLRR 132
            L+ ++R
Sbjct: 127 QLAAIQR 133


>gi|254467879|ref|ZP_05081285.1| ATP synthase F1, epsilon subunit [beta proteobacterium KB13]
 gi|207086689|gb|EDZ63972.1| ATP synthase F1, epsilon subunit [beta proteobacterium KB13]
          Length = 139

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 71/128 (55%), Gaps = 5/128 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI- 68
           ++VS E+ +FSGE + VV PS +G++ +   HAP++TT+K G V I LS +     V + 
Sbjct: 7   DVVSAEESLFSGEAEFVVAPSAMGEVGIYPNHAPMITTLKPGSVRIKLSGKNDEELVYVS 66

Query: 69  GGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
           GGI ++ P   TVLS+T +    +D A   QA ++  D +     +I     + ++ + +
Sbjct: 67  GGILEVQPGSVTVLSDTAVRGSDLDEAKANQAKKQAEDALTKQKGDIDYAKAQAELAEAV 126

Query: 125 VDLSCLRR 132
             +  ++R
Sbjct: 127 AQIQAIQR 134


>gi|126736548|ref|ZP_01752288.1| ATP synthase F1, epsilon subunit [Roseobacter sp. CCS2]
 gi|126713861|gb|EBA10732.1| ATP synthase F1, epsilon subunit [Roseobacter sp. CCS2]
          Length = 141

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 64/121 (52%), Gaps = 4/121 (3%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           +L F+LVSPE+ + S E   V +P   GD+T +  HAP +TT++ GI+T+ +       Y
Sbjct: 3   NLQFDLVSPERRLASVEASEVQIPGADGDMTAMADHAPTITTLRPGILTV-VHGGGSDAY 61

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLV 125
           VV GG  +I  +  +VL+E  LP D    +  ++ +++  +         + F+ E   V
Sbjct: 62  VVSGGFAEITAASVSVLAEQALPRDEVTQEVYDQMVEDAKAAYGR---AQETFKNEPGPV 118

Query: 126 D 126
           D
Sbjct: 119 D 119


>gi|114328719|ref|YP_745876.1| ATP synthase epsilon chain [Granulibacter bethesdensis CGDNIH1]
 gi|119367733|sp|Q0BQE9|ATPE_GRABC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|114316893|gb|ABI62953.1| ATP synthase epsilon chain [Granulibacter bethesdensis CGDNIH1]
          Length = 135

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 57/107 (53%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
            E+VSPEK + S  V  VV+P+  G++ VL GHAP++  ++ G + +  + +   R  V 
Sbjct: 6   LEIVSPEKRLLSRSVDMVVIPAAEGELGVLPGHAPMIVLLQGGTIRLYQNGQVTDRLYVA 65

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD 115
           GG  +I P  CTVL++   P+        EKR+ +  +    +  +D
Sbjct: 66  GGFAEITPERCTVLADQARPVAEISATEAEKRLADAEAAYATVDKLD 112


>gi|332308598|ref|YP_004436449.1| ATP synthase F1, epsilon subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175927|gb|AEE25181.1| ATP synthase F1, epsilon subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 137

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 60/104 (57%), Gaps = 4/104 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E  +FSG VQS+ +    G++ V  GHAP+LTTIK+G+V +     E     
Sbjct: 5   IQLDVVSAEDSIFSGLVQSIQVTGSEGELGVQYGHAPLLTTIKAGMVNVVKQFGEEELIY 64

Query: 67  VIGGICDIVPSHCTVLSETILPM----DNACLQALEKRIDEVCS 106
           V GG+ ++ P H +VL++T L      + A L+A ++  D + +
Sbjct: 65  VAGGVLEVQPGHISVLADTALRASDLDEQAVLEAKKRLEDNIAN 108


>gi|260432840|ref|ZP_05786811.1| ATP synthase F1, epsilon subunit [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416668|gb|EEX09927.1| ATP synthase F1, epsilon subunit [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 136

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 4/131 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + N + F+LVSPE+ + S +  +V +P   GD+T +  HAP +TT++ GI+ +  + E  
Sbjct: 1   MANTMQFDLVSPERSLASLQASAVQIPGADGDMTAMPDHAPTITTLRPGILKVE-APEGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRF---Q 119
             Y+V GG   I     +VL+E  +P+D      L++ I E  +      +  ++    +
Sbjct: 60  SEYLVTGGFAQINGDALSVLAEKAIPVDEVTRSHLDELIAEARASHEAAKENGEQTIVDE 119

Query: 120 MEQLLVDLSCL 130
             +LL D+  L
Sbjct: 120 AAKLLADMEAL 130


>gi|53721002|ref|YP_109988.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei
           K96243]
 gi|53724017|ref|YP_104463.1| F0F1 ATP synthase subunit epsilon [Burkholderia mallei ATCC 23344]
 gi|67643092|ref|ZP_00441841.1| ATP synthase F1, epsilon subunit [Burkholderia mallei GB8 horse 4]
 gi|76810572|ref|YP_331593.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei 1710b]
 gi|121598820|ref|YP_994633.1| F0F1 ATP synthase subunit epsilon [Burkholderia mallei SAVP1]
 gi|124386193|ref|YP_001027566.1| F0F1 ATP synthase subunit epsilon [Burkholderia mallei NCTC 10229]
 gi|126438987|ref|YP_001060960.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei 668]
 gi|126449201|ref|YP_001082536.1| F0F1 ATP synthase subunit epsilon [Burkholderia mallei NCTC 10247]
 gi|126453887|ref|YP_001068260.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei 1106a]
 gi|134281647|ref|ZP_01768355.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 305]
 gi|167000140|ref|ZP_02265963.1| ATP synthase F1, epsilon subunit [Burkholderia mallei PRL-20]
 gi|167721820|ref|ZP_02405056.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei DM98]
 gi|167740792|ref|ZP_02413566.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei 14]
 gi|167818007|ref|ZP_02449687.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei 91]
 gi|167826370|ref|ZP_02457841.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei 9]
 gi|167847889|ref|ZP_02473397.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei B7210]
 gi|167896447|ref|ZP_02483849.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei 7894]
 gi|167904848|ref|ZP_02492053.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei NCTC
           13177]
 gi|167913126|ref|ZP_02500217.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei 112]
 gi|167921064|ref|ZP_02508155.1| F0F1 ATP synthase subunit epsilon [Burkholderia pseudomallei
           BCC215]
 gi|217424043|ref|ZP_03455543.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 576]
 gi|226193128|ref|ZP_03788738.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237814344|ref|YP_002898795.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei
           MSHR346]
 gi|242314852|ref|ZP_04813868.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 1106b]
 gi|254175070|ref|ZP_04881731.1| ATP synthase F1, epsilon subunit [Burkholderia mallei ATCC 10399]
 gi|254184021|ref|ZP_04890612.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 1655]
 gi|254186487|ref|ZP_04893004.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei Pasteur
           52237]
 gi|254194733|ref|ZP_04901164.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei S13]
 gi|254201538|ref|ZP_04907902.1| ATP synthase F1, epsilon subunit [Burkholderia mallei FMH]
 gi|254206874|ref|ZP_04913225.1| ATP synthase F1, epsilon subunit [Burkholderia mallei JHU]
 gi|254258142|ref|ZP_04949196.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 1710a]
 gi|254298705|ref|ZP_04966156.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 406e]
 gi|254357428|ref|ZP_04973702.1| ATP synthase F1, epsilon subunit [Burkholderia mallei 2002721280]
 gi|60389510|sp|Q62FR4|ATPE_BURMA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|60389520|sp|Q63PI1|ATPE_BURPS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119361416|sp|Q3JXW0|ATPE_BURP1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222436|sp|A3MQK0|ATPE_BURM7 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222437|sp|A2S6J7|ATPE_BURM9 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222438|sp|A1V8T0|ATPE_BURMS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222439|sp|A3P0Y9|ATPE_BURP0 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222440|sp|A3NF39|ATPE_BURP6 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|52211416|emb|CAH37407.1| ATP synthase epsilon chain [Burkholderia pseudomallei K96243]
 gi|52427440|gb|AAU48033.1| ATP synthase F1, epsilon subunit [Burkholderia mallei ATCC 23344]
 gi|76580025|gb|ABA49500.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 1710b]
 gi|121227630|gb|ABM50148.1| ATP synthase F1, epsilon subunit [Burkholderia mallei SAVP1]
 gi|124294213|gb|ABN03482.1| ATP synthase F1, epsilon subunit [Burkholderia mallei NCTC 10229]
 gi|126218480|gb|ABN81986.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 668]
 gi|126227529|gb|ABN91069.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 1106a]
 gi|126242071|gb|ABO05164.1| ATP synthase F1, epsilon subunit [Burkholderia mallei NCTC 10247]
 gi|134247314|gb|EBA47400.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 305]
 gi|147747432|gb|EDK54508.1| ATP synthase F1, epsilon subunit [Burkholderia mallei FMH]
 gi|147752416|gb|EDK59482.1| ATP synthase F1, epsilon subunit [Burkholderia mallei JHU]
 gi|148026492|gb|EDK84577.1| ATP synthase F1, epsilon subunit [Burkholderia mallei 2002721280]
 gi|157808570|gb|EDO85740.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 406e]
 gi|157934172|gb|EDO89842.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei Pasteur
           52237]
 gi|160696115|gb|EDP86085.1| ATP synthase F1, epsilon subunit [Burkholderia mallei ATCC 10399]
 gi|169651483|gb|EDS84176.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei S13]
 gi|184214553|gb|EDU11596.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 1655]
 gi|217393106|gb|EEC33128.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 576]
 gi|225934728|gb|EEH30705.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237504520|gb|ACQ96838.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238524341|gb|EEP87774.1| ATP synthase F1, epsilon subunit [Burkholderia mallei GB8 horse 4]
 gi|242138091|gb|EES24493.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 1106b]
 gi|243063943|gb|EES46129.1| ATP synthase F1, epsilon subunit [Burkholderia mallei PRL-20]
 gi|254216831|gb|EET06215.1| ATP synthase F1, epsilon subunit [Burkholderia pseudomallei 1710a]
          Length = 141

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 69/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     +     
Sbjct: 4   IKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIESESGDEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNAKSDIDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|254459593|ref|ZP_05073009.1| ATP synthase F1, epsilon subunit [Rhodobacterales bacterium
          HTCC2083]
 gi|206676182|gb|EDZ40669.1| ATP synthase F1, epsilon subunit [Rhodobacteraceae bacterium
          HTCC2083]
          Length = 138

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 57/98 (58%), Gaps = 4/98 (4%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + L F+LVSPE+ + S +V  V +P   GD+T +  HAP +TT++ G++ +S    + 
Sbjct: 1  MADTLQFDLVSPERSLASMQVSEVQIPGSDGDMTAMADHAPTITTLRPGVLKVSGPAGDA 60

Query: 63 HRYVVIGGICDIVPSHCTVLSETILP---MDNACLQAL 97
            YVV GG  +I     +VL+E  +    MD A L+++
Sbjct: 61 E-YVVTGGFAEIGDGGISVLAERAIAKADMDQATLKSM 97


>gi|49474709|ref|YP_032751.1| ATP synthase epsilon chain [Bartonella quintana str. Toulouse]
 gi|60389586|sp|Q6FYM4|ATPE_BARQU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|49240213|emb|CAF26681.1| ATP synthase epsilon chain [Bartonella quintana str. Toulouse]
          Length = 138

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           FELVSPEK VFS +V SVV+PS  G +TV+  H P++ +I  G V +  S  E   + V 
Sbjct: 11  FELVSPEKLVFSEQVISVVIPSASGALTVMAHHEPLVASIVLGSVRVLTSSGE-KLFAVC 69

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
            G+ +I  S C++L E ++ +++     LE++I +V + L    D D R
Sbjct: 70  RGVANITSSGCSLLVEKVVAVEHLSFDVLEQQISQVRATLEG--DSDDR 116


>gi|312115965|ref|YP_004013561.1| ATP synthase F1 subunit epsilon [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221094|gb|ADP72462.1| ATP synthase F1, epsilon subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 133

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 68/133 (51%), Gaps = 8/133 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + ++FEL++P+K + S +V   VLP + GD++   G   ++  ++ GI+T      E 
Sbjct: 1   MADTIYFELIAPDKRLLSADVSEAVLPGQEGDLSAQAGRGFLILKLRPGILTTRAKDGE- 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNAC-------LQALEKRIDEVCSDLNNICDVD 115
            ++ + GG  D+ P   TVL+E  +P+++         +   E+ +DE   D   I   D
Sbjct: 60  KQFFLRGGFADVGPDKATVLAEFAIPLEDLTGAILADEIAQAEQSLDEAKDDARKISSWD 119

Query: 116 QRFQMEQLLVDLS 128
           +  +++ L   L+
Sbjct: 120 RLERLQTLKARLA 132


>gi|149202396|ref|ZP_01879369.1| ATP synthase F1, epsilon subunit [Roseovarius sp. TM1035]
 gi|149144494|gb|EDM32525.1| ATP synthase F1, epsilon subunit [Roseovarius sp. TM1035]
          Length = 146

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 67/133 (50%), Gaps = 12/133 (9%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   + F+LVSPE+ + S     V +P   GD+T +  HAP++TT++ GI+ +S    E 
Sbjct: 6   MAETVQFDLVSPERLLASVAAHEVSIPGAEGDLTAMADHAPLITTLRPGILRVSGPSGE- 64

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRF---- 118
             YVV GG  +I     +VL+E  +  ++   +A +  +D      + +    ++F    
Sbjct: 65  KEYVVTGGFAEISGKSVSVLAEQAVAREDMTREAFKAMVDAAT---DKLAHAQEKFVNEP 121

Query: 119 ----QMEQLLVDL 127
               +M +LL D+
Sbjct: 122 GPVDEMAKLLADM 134


>gi|194291165|ref|YP_002007072.1| F0F1 ATP synthase subunit epsilon [Cupriavidus taiwanensis LMG
           19424]
 gi|193225000|emb|CAQ71011.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Cupriavidus taiwanensis LMG 19424]
          Length = 147

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 6/116 (5%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E  +FSG+ + V LP E G++ +L GH P++T I+ G V I           V G
Sbjct: 16  DVVSAEASIFSGQAKFVALPGESGELGILPGHTPLITRIQPGAVRIEKEDGSEEFVFVAG 75

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD-QRFQME 121
           GI ++ P H TVL++T +    +D A  Q  ++  +E+    N   D+D  R Q E
Sbjct: 76  GILEVQPKHVTVLADTAIRGGDLDEAKAQEAKRAAEELMQ--NQSSDLDLARAQSE 129


>gi|89053541|ref|YP_508992.1| ATP synthase F1, epsilon subunit [Jannaschia sp. CCS1]
 gi|119367738|sp|Q28TJ5|ATPE_JANSC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|88863090|gb|ABD53967.1| ATP synthase F1 subcomplex epsilon subunit [Jannaschia sp. CCS1]
          Length = 132

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           + F+LVSPE+ + S EV  V +P   GD+T +  H+P++TT++ G++ +S   E    Y 
Sbjct: 4   MQFDLVSPERRLASMEVTEVQIPGADGDLTAMPDHSPMITTLRPGVLKVS-GAEGEKSYF 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRI 101
           V GG  DI     T+L+E  +P++    + +E+ I
Sbjct: 63  VTGGFADIAGPSATILAERAMPVEEVTGEIVEELI 97


>gi|113869572|ref|YP_728061.1| F0F1 ATP synthase subunit epsilon [Ralstonia eutropha H16]
 gi|123032573|sp|Q0K5M8|ATPE_RALEH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|113528348|emb|CAJ94693.1| Membrane-bound ATP synthase, F1 sector,epsilon-subunit [Ralstonia
           eutropha H16]
          Length = 138

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 6/116 (5%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E  +FSG+ + V LP E G++ +L GH P++T I+ G V I           V G
Sbjct: 7   DVVSAEASIFSGQAKFVALPGESGELGILPGHTPLITRIQPGAVRIEKEDGSEEFVFVAG 66

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD-QRFQME 121
           GI ++ P H TVL++T +    +D A  Q  ++  +E+    N   D+D  R Q E
Sbjct: 67  GILEVQPKHVTVLADTAIRGGDLDEAKAQEAKRAAEELMQ--NQSSDLDLARAQSE 120


>gi|295687684|ref|YP_003591377.1| ATPase F1 complex delta/epsilon subunit-like protein [Caulobacter
          segnis ATCC 21756]
 gi|295429587|gb|ADG08759.1| ATPase, F1 complex, delta/epsilon subunit-like protein
          [Caulobacter segnis ATCC 21756]
          Length = 86

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LHF LV+PE+ +FSGEV  V  P   GD  VL  HAP +TT++ G VT+         + 
Sbjct: 4  LHFSLVAPERELFSGEVDMVQAPGAEGDFGVLANHAPFMTTLREGKVTVK-DGATTKVFD 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          + GG  D+ P   T+L+E
Sbjct: 63 IQGGFADVGPDGLTILAE 80


>gi|312963997|ref|ZP_07778468.1| ATP synthase epsilon chain [Pseudomonas fluorescens WH6]
 gi|311282032|gb|EFQ60642.1| ATP synthase epsilon chain [Pseudomonas fluorescens WH6]
          Length = 138

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 65/110 (59%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ V+   ELGD+ + +GHAP++T++K G +T++    E   + 
Sbjct: 5   VHCDIVSAEGEIFSGLVEMVIAHGELGDLGIAMGHAPLITSLKPGPITLTKQGGEKEVFY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQ----ALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A  Q    A EK ++E  +D +
Sbjct: 65  ISGGFLEVQPNMVKVLADTVQRAGDLDEASAQEAVKAAEKALNEKGADFD 114


>gi|312794896|ref|YP_004027818.1| ATP synthase epsilon chain [Burkholderia rhizoxinica HKI 454]
 gi|312166671|emb|CBW73674.1| ATP synthase epsilon chain (EC 3.6.3.14) [Burkholderia rhizoxinica
           HKI 454]
          Length = 164

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 8/134 (5%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +FSG  + V LP E G++ +L GH P++T I+ G V I     +     V G
Sbjct: 30  DVVSAEESIFSGHARFVALPGEAGELGILPGHTPLITRIRPGSVRIEDENGDEQFVFVAG 89

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN-----ICDVDQRFQME 121
           GI ++ P   TVL++T +    +D A  +   KR +E   + ++         +  +   
Sbjct: 90  GILEVQPGAVTVLADTAIRGAELDEAKAEQARKRAEEALQNTDSNLEYATAQAELAYATA 149

Query: 122 QLLVDLSCLRRRIQ 135
           QL       RRR Q
Sbjct: 150 QLAAIAQLRRRRGQ 163


>gi|310815416|ref|YP_003963380.1| ATP synthase F1, epsilon subunit [Ketogulonicigenium vulgare Y25]
 gi|308754151|gb|ADO42080.1| ATP synthase F1, epsilon subunit [Ketogulonicigenium vulgare Y25]
          Length = 125

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           D+ F+LVSPE+ + S   + V +P   GD+T +  HA  +TT++ GI+ + +       Y
Sbjct: 3   DIQFDLVSPERRLASVSAREVQIPGADGDLTAMADHATTITTLRPGILRV-VHAGGTDDY 61

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD 115
           +V GG  DI  +  TVL+E  LP      +    +++E+ + L    DVD
Sbjct: 62  LVTGGFADISATTVTVLAEVALP----AAEVTAAKVEELAAQLRANADVD 107


>gi|224823533|ref|ZP_03696642.1| ATP synthase F1, epsilon subunit [Lutiella nitroferrum 2002]
 gi|224603988|gb|EEG10162.1| ATP synthase F1, epsilon subunit [Lutiella nitroferrum 2002]
          Length = 140

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 73/138 (52%), Gaps = 10/138 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGI--VTISLSCEEIHR 64
           +H E+VS E+ ++SGE + +V P++ G+I V   H P+LT IK G+  +T+  S +E+  
Sbjct: 4   MHVEVVSTEQLIYSGEAEFLVAPAQEGEIGVYPRHVPLLTRIKPGVLRLTVPGSKDEV-L 62

Query: 65  YVVIGGICDIVPSHCTVLSETILPMD-------NACLQALEKRIDEVCSDLNNICDVDQR 117
             V GG+ ++ P+H TVL++T +  +       N   +A E+ + +   DL+        
Sbjct: 63  VAVSGGMMEVQPTHITVLADTAIRGEDIDEARANEAKRAAEETLKKSVDDLDTAKAHAAL 122

Query: 118 FQMEQLLVDLSCLRRRIQ 135
                 L  L  LR+R+ 
Sbjct: 123 AVAIAELKALDYLRKRVH 140


>gi|16127675|ref|NP_422239.1| F0F1 ATP synthase subunit epsilon [Caulobacter crescentus CB15]
 gi|221236494|ref|YP_002518931.1| F0F1 ATP synthase subunit epsilon [Caulobacter crescentus NA1000]
 gi|20137446|sp|Q9A2W1|ATPE_CAUCR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|13425163|gb|AAK25407.1| ATP synthase F1, epsilon subunit [Caulobacter crescentus CB15]
 gi|220965667|gb|ACL97023.1| ATP synthase epsilon chain [Caulobacter crescentus NA1000]
          Length = 86

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LHF LV+PE+ +FSGEV  V  P   GD  VL  HAP +TT++ G VT+         + 
Sbjct: 4  LHFSLVAPERELFSGEVDMVQAPGAEGDFGVLANHAPFMTTLREGKVTVKDGA-TTKVFD 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          + GG  D+ P   T+L+E
Sbjct: 63 IQGGFADVGPEGLTILAE 80


>gi|319944943|ref|ZP_08019205.1| ATP synthase F1 sector epsilon subunit [Lautropia mirabilis ATCC
           51599]
 gi|319741513|gb|EFV93938.1| ATP synthase F1 sector epsilon subunit [Lautropia mirabilis ATCC
           51599]
          Length = 154

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 55/86 (63%), Gaps = 1/86 (1%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           ++N +  E+VS E+ +FSGE + VVLP E+G++ V   H P++T IK+G V I +  E  
Sbjct: 16  VMNTIQVEVVSAEESIFSGEAEFVVLPGEVGELGVYPNHTPLITRIKAGAVRIRVPGENR 75

Query: 63  HRYV-VIGGICDIVPSHCTVLSETIL 87
              + V GGI +I P+  TVL++T +
Sbjct: 76  DELIFVAGGILEIQPNLVTVLADTAI 101


>gi|296137182|ref|YP_003644424.1| ATP synthase F1, epsilon subunit [Thiomonas intermedia K12]
 gi|295797304|gb|ADG32094.1| ATP synthase F1, epsilon subunit [Thiomonas intermedia K12]
          Length = 144

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 54/91 (59%), Gaps = 9/91 (9%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS----- 58
          +N +H ++VS E+ +FSGE + V LP E G++ +L GH P++T IK G V I L+     
Sbjct: 1  MNTIHVDVVSAEESIFSGEARFVALPGESGELGILPGHTPLITRIKPGSVRIELAEANAS 60

Query: 59 --CEEIHRYVVIGGICDIVPSHCTVLSETIL 87
             EE     V GGI ++ P   TVL++T +
Sbjct: 61 GGKEEF--IFVAGGILEVQPKRVTVLADTAI 89


>gi|294341480|emb|CAZ89897.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon
          subunit) [Thiomonas sp. 3As]
          Length = 144

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 54/91 (59%), Gaps = 9/91 (9%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS----- 58
          +N +H ++VS E+ +FSGE + V LP E G++ +L GH P++T IK G V I L+     
Sbjct: 1  MNTIHVDVVSAEESIFSGEARFVALPGESGELGILPGHTPLITRIKPGSVRIELAEANAT 60

Query: 59 --CEEIHRYVVIGGICDIVPSHCTVLSETIL 87
             EE     V GGI ++ P   TVL++T +
Sbjct: 61 GGKEEF--IFVAGGILEVQPKRVTVLADTAI 89


>gi|254485856|ref|ZP_05099061.1| ATP synthase F1, epsilon subunit [Roseobacter sp. GAI101]
 gi|214042725|gb|EEB83363.1| ATP synthase F1, epsilon subunit [Roseobacter sp. GAI101]
          Length = 145

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%), Gaps = 1/102 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S +V +V +P   GD+T +  HAP LTT++ G++ +    E  
Sbjct: 1   MADTMQFDLVSPERRLASMQVTAVQIPGADGDMTAMPDHAPTLTTLRPGVLRVE-GPEGA 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV 104
             YVV GG  +I  +  +VL+E  +P      + L++ ++E 
Sbjct: 60  TEYVVTGGFAEISAAGVSVLAERAVPKGEMTQEHLDEMMEEA 101


>gi|91777091|ref|YP_546847.1| ATP synthase F1, epsilon subunit [Methylobacillus flagellatus KT]
 gi|119367746|sp|Q1GXN1|ATPE_METFK RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|91711078|gb|ABE51006.1| ATP synthase F1 subcomplex epsilon subunit [Methylobacillus
           flagellatus KT]
          Length = 141

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 71/123 (57%), Gaps = 5/123 (4%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGI--VTISLSCE 60
           + + +H ++VS E+ +FSGE + V  P++LG++ +   HAP++TTIK G+  V ++   E
Sbjct: 1   MASTIHLDVVSAEESIFSGEAEFVAAPAKLGEVGIYPNHAPLITTIKPGVLRVKVANGGE 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVD-QRF 118
           E   Y+  GG+ ++ P   TVL++T I   D   ++A+E +     +  NN   VD  R 
Sbjct: 61  EQAIYIS-GGLLEVQPGVITVLADTAIRGHDLDEVKAIEAKRAAEEALRNNASGVDYARA 119

Query: 119 QME 121
           Q E
Sbjct: 120 QAE 122


>gi|84500098|ref|ZP_00998364.1| ATP synthase F1, epsilon subunit [Oceanicola batsensis HTCC2597]
 gi|84392032|gb|EAQ04300.1| ATP synthase F1, epsilon subunit [Oceanicola batsensis HTCC2597]
          Length = 139

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + L F LVSPE+ + SG   +V +P   GD+T + GHAP++TT++ G++ +    +  
Sbjct: 1  MADSLDFSLVSPERSLASGTASAVQIPGADGDLTAMAGHAPLITTLRPGVLHVD-GPDGA 59

Query: 63 HRYVVIGGICDIVPSHCTVLSETIL 87
            YVV GG  +I     TVL+E  L
Sbjct: 60 DDYVVSGGFAEISAEGVTVLAERAL 84


>gi|27364455|ref|NP_759983.1| F0F1 ATP synthase subunit epsilon [Vibrio vulnificus CMCP6]
 gi|37681434|ref|NP_936043.1| F0F1 ATP synthase subunit epsilon [Vibrio vulnificus YJ016]
 gi|320154859|ref|YP_004187238.1| ATP synthase subunit epsilon [Vibrio vulnificus MO6-24/O]
 gi|31339983|sp|Q8DDG7|ATPE_VIBVU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|60389703|sp|Q7MGI1|ATPE_VIBVY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|27360574|gb|AAO09510.1| ATP synthase F1, epsilon subunit [Vibrio vulnificus CMCP6]
 gi|37200186|dbj|BAC96014.1| F0F1-type ATP synthase epsilon subunit [Vibrio vulnificus YJ016]
 gi|319930171|gb|ADV85035.1| ATP synthase epsilon chain [Vibrio vulnificus MO6-24/O]
          Length = 140

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 68/129 (52%), Gaps = 7/129 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-SLSCEEIHRY 65
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I  L  EE   Y
Sbjct: 6   FHLDVVSAEKKIFSGRVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKLHGEEEFIY 65

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           V  GGI ++ P   TVL++T +    +D A  +  ++R  E    LN   D+D      +
Sbjct: 66  VS-GGIVEVQPGTATVLADTAIRGEELDAAKAEEAKRRAKENI--LNQHGDMDFAQAASE 122

Query: 123 LLVDLSCLR 131
           L   ++ LR
Sbjct: 123 LAKAIAQLR 131


>gi|49476186|ref|YP_034227.1| ATP synthase epsilon chain [Bartonella henselae str. Houston-1]
 gi|60389588|sp|Q6G1X0|ATPE_BARHE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|49238994|emb|CAF28294.1| ATP synthase epsilon chain [Bartonella henselae str. Houston-1]
          Length = 138

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           VN   FELVSPEK VFS +V SVVLPS  G +TV+  HAP++ +I  G + +  S  E  
Sbjct: 6   VNHFLFELVSPEKPVFSEQVVSVVLPSASGALTVMANHAPLVASIVLGSMYVLTSSGE-K 64

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDL 108
            + V GG+ +I  S C+VL E ++ + +     LE+RI  V + L
Sbjct: 65  LFAVCGGVANITSSGCSVLVERVVVVQHLSFHDLEQRILRVRATL 109


>gi|83592563|ref|YP_426315.1| H+-transporting two-sector ATPase subunit delta/epsilon
           [Rhodospirillum rubrum ATCC 11170]
 gi|114605|sp|P05442|ATPE_RHORU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119367773|sp|Q2RV17|ATPE_RHORT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|9367331|emb|CAB97256.1| unnamed protein product [Rhodospirillum rubrum]
 gi|83575477|gb|ABC22028.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Rhodospirillum rubrum ATCC 11170]
          Length = 134

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 53/94 (56%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
            FELVSPE+ +FS  V+ VV+P   GD   +  HAP+L+T++ G+++     +   R  V
Sbjct: 6   EFELVSPERLLFSEPVEMVVVPGTDGDFGAMPRHAPLLSTVRPGVISTYNGGKVQRRIFV 65

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKRI 101
            GG  ++    CTVL++    + +   +A+  R+
Sbjct: 66  AGGFAEVTEDRCTVLADEAFDLASLSEEAVRARL 99


>gi|145588216|ref|YP_001154813.1| ATP synthase F1, epsilon subunit [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|189081372|sp|A4SUT5|ATPE_POLSQ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|145046622|gb|ABP33249.1| ATP synthase F1 subcomplex epsilon subunit [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 138

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 5/109 (4%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I  +  +     V G
Sbjct: 7   DVVSAEQSIFSGEAKFVALPGESGELGILRGHTPLITRIRPGSVRIEKADGDEEFVFVAG 66

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
           G  ++ P   TVL++T +    +D A     +KR +E     N   D D
Sbjct: 67  GYLEVQPDRVTVLADTAIRGHDLDEAKAIEAKKRAEEAMQ--NRGTDFD 113


>gi|330815047|ref|YP_004358752.1| ATP synthase subunit epsilon [Burkholderia gladioli BSR3]
 gi|327367440|gb|AEA58796.1| ATP synthase subunit epsilon [Burkholderia gladioli BSR3]
          Length = 141

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 61/112 (54%), Gaps = 5/112 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I     +     
Sbjct: 4   IKVDVVSAEEEIFSGQAKFVALPGESGELGILPGHTPLITRIRPGAVRIESEGGQDEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
           V GGI ++ P   TVL++T +    +D A  +  ++R +E     N   D+D
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGRDLDAAKAEEAKRRAEETLQ--NAKSDID 113


>gi|163854648|ref|YP_001628946.1| F0F1 ATP synthase subunit epsilon [Bordetella petrii DSM 12804]
 gi|226740226|sp|A9HY45|ATPE_BORPD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|163258376|emb|CAP40675.1| ATP synthase epsilon chain [Bordetella petrii]
          Length = 141

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 60/111 (54%), Gaps = 3/111 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++VS E+ +F+GE + V LP E G++ +L GH P+++ I+ G V I  +        
Sbjct: 4   LQVDVVSAEEAIFAGEAKFVTLPGEAGELGILPGHTPLISRIRPGTVKIVRADGGEENIF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDV 114
           V GGI ++ P   TVL++T +    +D A   A  ++ +E   +  +  D+
Sbjct: 64  VAGGILEVQPGMVTVLADTAIRAADLDEARAVAAREKAEEALRNAKDKADI 114


>gi|83746947|ref|ZP_00943993.1| ATP synthase epsilon chain [Ralstonia solanacearum UW551]
 gi|207722133|ref|YP_002252571.1| atp synthase epsilon chain 1 (atp synthase f1 sectorepsilon subunit
           1) protein [Ralstonia solanacearum MolK2]
 gi|207744811|ref|YP_002261203.1| atp synthase epsilon chain 1 (atp synthase f1 sectorepsilon subunit
           1) protein [Ralstonia solanacearum IPO1609]
 gi|300689833|ref|YP_003750828.1| ATP synthase, F1 sector, epsilon subunit [Ralstonia solanacearum
           PSI07]
 gi|300702514|ref|YP_003744114.1| ATP synthase, f1 sector subunit epsilon [Ralstonia solanacearum
           CFBP2957]
 gi|83726367|gb|EAP73499.1| ATP synthase epsilon chain [Ralstonia solanacearum UW551]
 gi|206587308|emb|CAQ17892.1| atp synthase epsilon chain 1 (atp synthase f1 sectorepsilon subunit
           1) protein [Ralstonia solanacearum MolK2]
 gi|206596221|emb|CAQ63148.1| atp synthase epsilon chain 1 (atp synthase f1 sectorepsilon subunit
           1) protein [Ralstonia solanacearum IPO1609]
 gi|299070175|emb|CBJ41466.1| ATP synthase, F1 sector, epsilon subunit [Ralstonia solanacearum
           CFBP2957]
 gi|299076893|emb|CBJ49506.1| ATP synthase, F1 sector, epsilon subunit [Ralstonia solanacearum
           PSI07]
          Length = 138

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 57/110 (51%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG  + V LP E G++ +L GH P++T IK G V I           
Sbjct: 4   IHVDVVSAEQEIFSGNAKFVALPGEAGELGILPGHTPLITRIKPGAVRIEKEDGGEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL-------PMDNACLQALEKRIDEVCSDLN 109
           V GGI ++ P   TVL++T +          N   +A E+ +    SDL+
Sbjct: 64  VAGGILEVQPKKVTVLADTAIRGHDLDEAKANEAKRAAEEALQNQSSDLD 113


>gi|241765095|ref|ZP_04763086.1| ATP synthase F1, epsilon subunit [Acidovorax delafieldii 2AN]
 gi|241365287|gb|EER60115.1| ATP synthase F1, epsilon subunit [Acidovorax delafieldii 2AN]
          Length = 138

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 72/136 (52%), Gaps = 4/136 (2%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +N +H ++VS E+ +FSGE + + LP E G++ V   H P++T IK G V I ++     
Sbjct: 1   MNTIHVDVVSAEESIFSGEARFIALPGEAGELGVYPRHTPLITRIKPGSVRIEMADGSEE 60

Query: 64  RYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQ 119
              V GGI ++ P   TVLS+T +    +D+    A +   +E   +  +  D+ + + +
Sbjct: 61  FVFVAGGILEVQPDCVTVLSDTAIRGKDLDDEKANAAKASAEEALKNAKSEIDLAKAQSE 120

Query: 120 MEQLLVDLSCLRRRIQ 135
           +  +   ++ LR+  Q
Sbjct: 121 LAIMAAQIAALRKYRQ 136


>gi|160895870|ref|YP_001561452.1| F0F1 ATP synthase subunit epsilon [Delftia acidovorans SPH-1]
 gi|226740244|sp|A9BPU8|ATPE_DELAS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|160361454|gb|ABX33067.1| ATP synthase F1, epsilon subunit [Delftia acidovorans SPH-1]
          Length = 138

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +N +H ++VS E+ +FSGE + V LP E G++ +   H P++T IK G V I ++     
Sbjct: 1   MNTIHVDVVSAEESIFSGEARFVALPGESGELGIFPRHTPLITRIKPGSVRIEMADGSEE 60

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNI-CDVD-QRFQME 121
              V GGI ++ P+  TVLS+T +   +   +  EK   E    L N   +VD  R Q E
Sbjct: 61  FVFVAGGILEVQPNCVTVLSDTAIRGADLDAEKAEKAKLEAEEALKNAKSEVDLARAQSE 120

Query: 122 Q--LLVDLSCLRR 132
              +   ++ LR+
Sbjct: 121 LAVMAAQIAALRK 133


>gi|83718437|ref|YP_443799.1| F0F1 ATP synthase subunit epsilon [Burkholderia thailandensis E264]
 gi|167582833|ref|ZP_02375707.1| F0F1 ATP synthase subunit epsilon [Burkholderia thailandensis
           TXDOH]
 gi|167620973|ref|ZP_02389604.1| F0F1 ATP synthase subunit epsilon [Burkholderia thailandensis Bt4]
 gi|119361418|sp|Q2STF0|ATPE_BURTA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|83652262|gb|ABC36325.1| ATP synthase F1, epsilon subunit [Burkholderia thailandensis E264]
          Length = 141

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 68/130 (52%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG  + V LP E G++ +L GH P++T I+ G V I     +     
Sbjct: 4   IKVDVVSAEEQIFSGLAKFVALPGEAGELGILPGHTPLITRIRPGAVRIEAESGDEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +   KR +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNAKSDIDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|254512354|ref|ZP_05124421.1| ATP synthase F1, epsilon subunit [Rhodobacteraceae bacterium KLH11]
 gi|221536065|gb|EEE39053.1| ATP synthase F1, epsilon subunit [Rhodobacteraceae bacterium KLH11]
          Length = 136

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 65/136 (47%), Gaps = 14/136 (10%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + N + F+LVSPE+ + S E  +V LP   GD+T +  HAP +TT++ G++ +  + E  
Sbjct: 1   MANTMQFDLVSPERSLASLEATAVQLPGADGDMTAMPDHAPTITTLRPGLLKVQ-APEGS 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV--------CSDLNNICDV 114
             Y+V GG   I     +VL+E  +P+       L+  I E          SD   I D 
Sbjct: 60  SEYLVTGGFAQINGDGLSVLAEKAIPVAEVTRSHLDDLIAEARASHDAAKASDDQTIVD- 118

Query: 115 DQRFQMEQLLVDLSCL 130
                  +LL D+  L
Sbjct: 119 ----DAAKLLADMEAL 130


>gi|144898924|emb|CAM75788.1| ATP synthase F1, epsilon subunit [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 133

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 60/123 (48%), Gaps = 8/123 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   + FELVSP K + S  V  VV+P   GD   L  HAP++TT++ G++ +    +  
Sbjct: 1   MAEKIKFELVSPAKLLISESVDMVVVPGSEGDFGALALHAPMITTVRPGVINVHNDGKIG 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILP-------MDNACLQALEKRIDEVCSDLNNICDVD 115
           +R  V GG  ++     TVL+E  +P       M +A LQ   + I +  +D       D
Sbjct: 61  NRIFVAGGFAEVNEERVTVLAEEAIPVADITADMASARLQDAREAIADAKTDAEKAA-AD 119

Query: 116 QRF 118
           QR 
Sbjct: 120 QRM 122


>gi|325981217|ref|YP_004293619.1| ATP synthase F1, epsilon subunit [Nitrosomonas sp. AL212]
 gi|325530736|gb|ADZ25457.1| ATP synthase F1, epsilon subunit [Nitrosomonas sp. AL212]
          Length = 140

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 73/134 (54%), Gaps = 7/134 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ ++SG V+ +V P+++G++ +   H P+LT IKSG+V I    +E     
Sbjct: 5   FHLDIVSAEESIYSGPVEFMVAPAQMGEVGIYPRHTPMLTKIKSGMVRIKAQLQEEELIY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNA----CLQALEKRIDEVCSDLNNICDVDQRFQ 119
           V GG+ ++ P   T+L++T +    +D A      +A E+ +    S+L+ +    +  +
Sbjct: 65  VSGGMLEVQPDIVTILADTAVRSHDLDEAKALEAKRAAEEAMKNKESELDYVKAQAELIE 124

Query: 120 MEQLLVDLSCLRRR 133
               L  ++ LR+R
Sbjct: 125 AMAQLAAINKLRKR 138


>gi|238025754|ref|YP_002909985.1| F0F1 ATP synthase subunit epsilon [Burkholderia glumae BGR1]
 gi|237874948|gb|ACR27281.1| ATP synthase subunit epsilon [Burkholderia glumae BGR1]
          Length = 141

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 69/130 (53%), Gaps = 4/130 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E+ +FSG+ + V LP E G++ +L GH P++T I+ G V I           
Sbjct: 4   IKVDVVSAEEEIFSGQAKFVALPGESGELGILPGHTPLITRIRPGAVRIESEAGADEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQ 122
           V GGI ++ P   TVL++T +    +D A  +  ++R +E   +  +  D+ + + ++  
Sbjct: 64  VAGGILEVQPGAVTVLADTAIRGRDLDAAKAEEAKRRAEETLQNAKSDIDLAKAQSELAT 123

Query: 123 LLVDLSCLRR 132
            +  L  ++R
Sbjct: 124 AMAQLEAIQR 133


>gi|260429143|ref|ZP_05783120.1| ATP synthase F1, epsilon subunit [Citreicella sp. SE45]
 gi|260419766|gb|EEX13019.1| ATP synthase F1, epsilon subunit [Citreicella sp. SE45]
          Length = 144

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 74/142 (52%), Gaps = 17/142 (11%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S +  +V +P   GD+TV  GH P +TT++ GI+ +  + +  
Sbjct: 1   MADTMQFDLVSPERNLLSAQASTVAIPGSEGDLTVGPGHEPTITTLRPGILKVE-TDKGA 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILP---MDNACLQAL-------EKRIDEVCSDLNNIC 112
             +VV GG  +I     TVL+E  +P   MD A  +AL        ++I E  +  N   
Sbjct: 60  EEFVVTGGFVEIG-DGVTVLAEKAVPHADMDQATYEALVSEAEATYRQIKEATN--NEPG 116

Query: 113 DVDQRFQMEQLLVDLSCLRRRI 134
            VD   +  +LL+D+  +   I
Sbjct: 117 PVD---EAAKLLMDMVAIGGHI 135


>gi|229593480|ref|YP_002875599.1| F0F1 ATP synthase subunit epsilon [Pseudomonas fluorescens SBW25]
 gi|259585487|sp|C3K1E5|ATPE_PSEFS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|229365346|emb|CAY53724.1| ATP synthase epsilon chain [Pseudomonas fluorescens SBW25]
          Length = 138

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 65/110 (59%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ V+   +LGD+ + +GHAP++T++K G +T++    E   + 
Sbjct: 5   VHCDIVSAEGEIFSGLVEMVIAHGDLGDLGIAMGHAPLITSLKPGPITLTKQGGEKEVFY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQ----ALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A  Q    A EK ++E  +D +
Sbjct: 65  ISGGFLEVQPNMVKVLADTVQRAGDLDEASAQEAVKAAEKALNEKGADFD 114


>gi|149913697|ref|ZP_01902230.1| ATP synthase F1, epsilon subunit [Roseobacter sp. AzwK-3b]
 gi|149812817|gb|EDM72646.1| ATP synthase F1, epsilon subunit [Roseobacter sp. AzwK-3b]
          Length = 141

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + +HF+LVSPE+ + S +   V +P   GD+T +  H+P++TT++ GIVT++      
Sbjct: 1   MADTVHFDLVSPERRLVSVDATEVRIPGAEGDLTAMAQHSPLITTLRPGIVTVT-GPNGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDL 108
             YVV  G  +I     +VL+E  +P D       +  +DE    L
Sbjct: 60  ADYVVTSGFAEIDGGSVSVLAERAIPRDEITQAQYKALVDEATDKL 105


>gi|73543027|ref|YP_297547.1| F0F1 ATP synthase subunit epsilon [Ralstonia eutropha JMP134]
 gi|119367765|sp|Q46VY1|ATPE_RALEJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|72120440|gb|AAZ62703.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Ralstonia
           eutropha JMP134]
          Length = 138

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E  +FSG  + V LP E G++ +L GH P++T I+ G V I           V G
Sbjct: 7   DVVSAEASIFSGPAKFVALPGESGELGILPGHTPLITRIQPGAVRIEKEDGSEEFVFVAG 66

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           GI ++ P H TVL++T +    +D A  Q  ++  +E+  + ++  D+  R Q E
Sbjct: 67  GILEVQPQHVTVLADTAIRGTDLDEAKAQEAKRAAEELMQNQSSDLDI-ARAQSE 120


>gi|299065198|emb|CBJ36364.1| ATP synthase, F1 sector, epsilon subunit [Ralstonia solanacearum
           CMR15]
          Length = 138

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 67/136 (49%), Gaps = 11/136 (8%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG  + V LP E G++ +L GH P++T IK G V I           
Sbjct: 4   IHVDVVSAEHEIFSGNAKFVALPGEAGELGILPGHTPLITRIKPGAVRIEKEDGGEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD-QRFQME- 121
           V GGI ++ P   TVL++T +    +D A     ++  +E     N   D+D  R Q E 
Sbjct: 64  VAGGILEVQPKKVTVLADTAIRGHDLDEAKASEAKRAAEEALQ--NQSSDLDLARAQGEL 121

Query: 122 ----QLLVDLSCLRRR 133
                 L  ++ LRR+
Sbjct: 122 AVATAQLAAIARLRRK 137


>gi|332285685|ref|YP_004417596.1| hypothetical protein PT7_2432 [Pusillimonas sp. T7-7]
 gi|330429638|gb|AEC20972.1| hypothetical protein PT7_2432 [Pusillimonas sp. T7-7]
          Length = 141

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 62/113 (54%), Gaps = 5/113 (4%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-SLSCEEIHR 64
           +L  ++VS E+ +F+G+ + V LP E G++ +L GH P+++ I+ G V I      E+  
Sbjct: 3   NLQVDVVSAEESIFAGQAKFVALPGESGELGILPGHTPLISRIRPGTVKIVQEDGSEVSI 62

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDV 114
           +V  GGI +I P   TVLS+T +    +D A      KR +E   +  +  D+
Sbjct: 63  FVA-GGILEIQPGTVTVLSDTAIRAEDLDEAKALEARKRAEETLRNTKDKADI 114


>gi|89070091|ref|ZP_01157421.1| ATP synthase F1, epsilon subunit [Oceanicola granulosus HTCC2516]
 gi|89044312|gb|EAR50455.1| ATP synthase F1, epsilon subunit [Oceanicola granulosus HTCC2516]
          Length = 145

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +     F+LVSPE+ +   EV  V +P   GD+T +  HAP +TT++ GI+  ++     
Sbjct: 1   MAETFTFDLVSPERRLAQLEVTEVQIPGADGDMTAMASHAPTITTLRPGILR-AVHAGGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVC 105
             YVV+GG  +I  S  TVL+E  LP      +  ++ ++E  
Sbjct: 60  DEYVVVGGFAEIGESGVTVLAEQALPRAEMSQEVYDRLVEEAA 102


>gi|332529018|ref|ZP_08404984.1| F0F1 ATP synthase subunit epsilon [Hylemonella gracilis ATCC 19624]
 gi|332041568|gb|EGI77928.1| F0F1 ATP synthase subunit epsilon [Hylemonella gracilis ATCC 19624]
          Length = 139

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 60/110 (54%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSGE + V LP E G++ +   H P++T +K G V I L+  +     
Sbjct: 5   IHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRVKPGSVRIELADGKEEFVF 64

Query: 67  VIGGICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDEVCSDLN 109
           V GGI ++ P   TVLS+T +   +       A  QA E+ I    S+L+
Sbjct: 65  VAGGILEVQPDCVTVLSDTAVRGKDLDEEKASAARQAAEEAIKNAKSELD 114


>gi|307823036|ref|ZP_07653266.1| ATP synthase F1, epsilon subunit [Methylobacter tundripaludum
          SV96]
 gi|307735811|gb|EFO06658.1| ATP synthase F1, epsilon subunit [Methylobacter tundripaludum
          SV96]
          Length = 140

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 55/81 (67%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS EK +FSG  + V  P+ELG++ +   HAP+++ +K+G V + ++ +E +++ 
Sbjct: 5  VHVDIVSAEKEIFSGLAEMVFAPAELGEVGISPRHAPLISRLKAGEVRVKVNDKETYQFY 64

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG+ +I P   T+L++T +
Sbjct: 65 VSGGMLEIQPHMITILADTAI 85


>gi|148553548|ref|YP_001261130.1| F0F1 ATP synthase subunit epsilon [Sphingomonas wittichii RW1]
 gi|148498738|gb|ABQ66992.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Sphingomonas wittichii RW1]
          Length = 87

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 6  DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI-HR 64
          DLHFELV+PE+ + S EV  VV+P   GD  VL GHAP ++T++SG + I  S   +  R
Sbjct: 3  DLHFELVTPERLLRSEEVHMVVVPGSEGDFGVLAGHAPFMSTVRSGELAIYSSPTTVAAR 62

Query: 65 YVVIGGICDIVPSHCTVLSE 84
            V GG  ++     TVL+E
Sbjct: 63 IHVEGGFAEVNEKGLTVLAE 82


>gi|296532597|ref|ZP_06895302.1| ATP synthase F1 sector epsilon subunit [Roseomonas cervicalis ATCC
           49957]
 gi|296267088|gb|EFH13008.1| ATP synthase F1 sector epsilon subunit [Roseomonas cervicalis ATCC
           49957]
          Length = 137

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 5/128 (3%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           MS   DL  ELVSPEK + S  V+  ++P+  G++ VL G AP++  +K G++ +     
Sbjct: 1   MSATFDL--ELVSPEKLLLSRPVEMAIIPAAEGEMGVLPGMAPMIVALKGGVIRVQEKGA 58

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDV---DQR 117
              R  V+GG  +I P+  TVL++   P+          R+ E  +  ++       ++ 
Sbjct: 59  VTERLFVMGGFAEITPTRVTVLADEATPVAELSRAEAAGRVREAEAAYDSAASATPEERE 118

Query: 118 FQMEQLLV 125
             M++LL 
Sbjct: 119 AAMDRLLA 126


>gi|254000515|ref|YP_003052578.1| F0F1 ATP synthase subunit epsilon [Methylovorus sp. SIP3-4]
 gi|313202474|ref|YP_004041132.1| ATP synthase f1 subunit epsilon [Methylovorus sp. MP688]
 gi|253987194|gb|ACT52051.1| ATP synthase F1, epsilon subunit [Methylovorus sp. SIP3-4]
 gi|312441790|gb|ADQ85896.1| ATP synthase F1, epsilon subunit [Methylovorus sp. MP688]
          Length = 141

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 56/86 (65%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + +H ++VS E  +FSGE + VV P++LG++ +   H P++TTIK G++ + ++ E  
Sbjct: 1  MASTIHLDVVSAEASIFSGEAEFVVAPAKLGEVGIYPNHTPLITTIKPGVLRVKVANEAE 60

Query: 63 HRYVVI-GGICDIVPSHCTVLSETIL 87
           + + I GG+ ++ P   TVL++T +
Sbjct: 61 EQAIYISGGMLEVQPGIITVLADTAI 86


>gi|241664765|ref|YP_002983125.1| F0F1 ATP synthase subunit epsilon [Ralstonia pickettii 12D]
 gi|309780426|ref|ZP_07675176.1| ATP synthase F1, epsilon subunit [Ralstonia sp. 5_7_47FAA]
 gi|240866792|gb|ACS64453.1| ATP synthase F1, epsilon subunit [Ralstonia pickettii 12D]
 gi|308920819|gb|EFP66466.1| ATP synthase F1, epsilon subunit [Ralstonia sp. 5_7_47FAA]
          Length = 138

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG  + V LP E G++ +L GH P++T IK G V I           
Sbjct: 4   IHVDVVSAEHEIFSGNAKFVALPGEAGELGILPGHTPLITRIKPGAVRIEKEDGGEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL-------PMDNACLQALEKRIDEVCSDLN 109
           V GGI ++ P   TVL++T +          N   +A E+ +    SDL+
Sbjct: 64  VAGGILEVQPKKVTVLADTAIRGHDLDEAKANEAKRAAEEALQNQSSDLD 113


>gi|187930576|ref|YP_001901063.1| F0F1 ATP synthase subunit epsilon [Ralstonia pickettii 12J]
 gi|187727466|gb|ACD28631.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12J]
          Length = 138

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG  + V LP E G++ +L GH P++T IK G V I           
Sbjct: 4   IHVDVVSAEHEIFSGNAKFVALPGEAGELGILPGHTPLITRIKPGAVRIEKEDGGEEFVF 63

Query: 67  VIGGICDIVPSHCTVLSETIL-------PMDNACLQALEKRIDEVCSDLN 109
           V GGI ++ P   TVL++T +          N   +A E+ +    SDL+
Sbjct: 64  VAGGILEVQPKRVTVLADTAIRGHDLDEAKANEAKRAAEEALQNQGSDLD 113


>gi|327399149|ref|YP_004340018.1| ATP synthase subunit epsilon [Hippea maritima DSM 10411]
 gi|327181778|gb|AEA33959.1| ATP synthase epsilon chain [Hippea maritima DSM 10411]
          Length = 132

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 71/125 (56%), Gaps = 9/125 (7%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +V+P K +F G+++ +  P ++G+  VL GH   +T +  GI+ + ++  +  RY+++GG
Sbjct: 7   IVTPSKSIFEGKIEYISAPGQVGEFGVLPGHESFVTVLDVGIIDVHIADNDKKRYLIVGG 66

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCL 130
             +I   +  V+++ +L  +   ++  ++++ E  ++L+++   D  +++         +
Sbjct: 67  YFEITEDNIVVIADDVLSKEEINIEEAKEKLQEYKNELSSLKQGDANYEL---------I 117

Query: 131 RRRIQ 135
           RR+++
Sbjct: 118 RRKVK 122


>gi|152980662|ref|YP_001355316.1| F0F1 ATP synthase subunit epsilon [Janthinobacterium sp. Marseille]
 gi|166222466|sp|A6T469|ATPE_JANMA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|151280739|gb|ABR89149.1| F-type H+-transporting ATPase epsilon chain [Janthinobacterium sp.
           Marseille]
          Length = 140

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 74/135 (54%), Gaps = 5/135 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + +  ++VS E+ +FSGE + V LP E G++ +L GH P++T I+ G V I ++ +  
Sbjct: 1   MAHTMRVDVVSAEEEIFSGEAEFVALPGESGELGILPGHTPLITRIRPGAVRIKVTGQAE 60

Query: 63  HRYV-VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-R 117
             +V V GGI ++ P   TVL++T +    +D A     ++  +E   +  +  D  Q +
Sbjct: 61  DEFVFVAGGILEVQPHVVTVLADTAIRGGDLDEAKAAEAKQLAEEALVNKESKIDYAQAQ 120

Query: 118 FQMEQLLVDLSCLRR 132
            ++   +  L+ ++R
Sbjct: 121 AELASAIAQLAAIQR 135


>gi|192362121|ref|YP_001984259.1| ATP synthase F1 subunit epsilon [Cellvibrio japonicus Ueda107]
 gi|226740233|sp|B3PIS6|ATPE_CELJU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|190688286|gb|ACE85964.1| ATP synthase F1, epsilon subunit [Cellvibrio japonicus Ueda107]
          Length = 141

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 61/108 (56%), Gaps = 8/108 (7%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHRYVV 67
           ++VS E+ +FSG V+ VV    LGD+ V  GHAP+LT+I  G V +      EEI  + V
Sbjct: 8   DIVSAEREIFSGLVEMVVATGALGDLGVAYGHAPLLTSINPGPVRVIKQGGTEEI--FYV 65

Query: 68  IGGICDIVPSHCTVLSETILPMDN----ACLQALEKRIDEVCSDLNNI 111
            GG  ++ P H TVL++T L  ++    A L+A E+   ++    + I
Sbjct: 66  SGGYLEVQPYHVTVLADTALRANDMDEAAALEAQERAQHQLAEQASEI 113


>gi|120609076|ref|YP_968754.1| F0F1 ATP synthase subunit epsilon [Acidovorax citrulli AAC00-1]
 gi|120587540|gb|ABM30980.1| ATP synthase F1 subcomplex epsilon subunit [Acidovorax citrulli
          AAC00-1]
          Length = 138

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +FSGE + V LP E G++ +   H P++T IK G V I  +     
Sbjct: 1  MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRIKPGSVRIETADGGEE 60

Query: 64 RYVVIGGICDIVPSHCTVLSETIL 87
             V GGI ++ P   TVLS+T +
Sbjct: 61 FVFVAGGILEVQPERVTVLSDTAI 84


>gi|326315261|ref|YP_004232933.1| ATP synthase F1 subunit epsilon [Acidovorax avenae subsp. avenae
          ATCC 19860]
 gi|323372097|gb|ADX44366.1| ATP synthase F1, epsilon subunit [Acidovorax avenae subsp. avenae
          ATCC 19860]
          Length = 138

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +FSGE + V LP E G++ +   H P++T IK G V I  +     
Sbjct: 1  MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRIKPGSVRIETADGGEE 60

Query: 64 RYVVIGGICDIVPSHCTVLSETIL 87
             V GGI ++ P   TVLS+T +
Sbjct: 61 FVFVAGGILEVQPERVTVLSDTAI 84


>gi|56697993|ref|YP_168364.1| F0F1 ATP synthase subunit epsilon [Ruegeria pomeroyi DSS-3]
 gi|81676123|sp|Q5LNP2|ATPE_SILPO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|56679730|gb|AAV96396.1| ATP synthase F1, epsilon subunit [Ruegeria pomeroyi DSS-3]
          Length = 136

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + N + F+LVSPE+ + S +V +V +P   GD+T +  HAP +TT++ G++ +    E  
Sbjct: 1   MANTMQFDLVSPERLLASLQVSAVQIPGADGDMTAMPDHAPTITTLRPGVLKVE-GPEGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCS 106
             Y+V GG   I     +VL+E  +P+       L++ I E  S
Sbjct: 60  SEYLVTGGFAQIGADSLSVLAEKAIPVTEVTRAHLDELIAEARS 103


>gi|319796133|ref|YP_004157773.1| ATP synthase f1, epsilon subunit [Variovorax paradoxus EPS]
 gi|315598596|gb|ADU39662.1| ATP synthase F1, epsilon subunit [Variovorax paradoxus EPS]
          Length = 139

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (58%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + N +H ++VS E+ +FSGE + V LP E G++ +   H P++T I+ G V I  +    
Sbjct: 1  MANTIHVDVVSAEESIFSGEAKFVALPGEAGELGIYPRHTPLITRIRPGAVRIETADGGE 60

Query: 63 HRYVVIGGICDIVPSHCTVLSETIL 87
              V GGI ++ P+  TVLS+T +
Sbjct: 61 EFVFVAGGILEVQPNAVTVLSDTAI 85


>gi|89092246|ref|ZP_01165200.1| ATP synthase epsilon chain [Oceanospirillum sp. MED92]
 gi|89083334|gb|EAR62552.1| ATP synthase epsilon chain [Oceanospirillum sp. MED92]
          Length = 141

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG ++ V +   LGD+ V  GHAP+LT +K G V +     E   + 
Sbjct: 5   VHCDIVSAEEEIFSGLIEFVSVTGSLGDLGVYPGHAPLLTELKPGPVELRKQGGEQDIFY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSD 107
           V GG  ++ P   TVL++T L    +D A  Q  +K  ++  +D
Sbjct: 65  VSGGFLEVQPHKVTVLADTALHAADLDEAAAQEAQKHAEQAMAD 108


>gi|325915882|ref|ZP_08178178.1| ATP synthase F1 subcomplex epsilon subunit [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325537849|gb|EGD09549.1| ATP synthase F1 subcomplex epsilon subunit [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 140

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 70/127 (55%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS EK +F GE   VV   ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTASGEQLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQLLV 125
           GI ++ P   TVL +T +    +D A ++ +++  + + ++  +  DV Q + Q+ +  V
Sbjct: 67  GILEVQPQVVTVLVDTAVRAQDIDEAAVRKVKEEAERLLANRGDTVDVAQAQRQLAEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|319761167|ref|YP_004125104.1| ATP synthase f1, epsilon subunit [Alicycliphilus denitrificans
          BC]
 gi|330823025|ref|YP_004386328.1| ATP synthase F1 subunit epsilon [Alicycliphilus denitrificans
          K601]
 gi|317115728|gb|ADU98216.1| ATP synthase F1, epsilon subunit [Alicycliphilus denitrificans
          BC]
 gi|329308397|gb|AEB82812.1| ATP synthase F1, epsilon subunit [Alicycliphilus denitrificans
          K601]
          Length = 138

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 51/84 (60%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +F+GE + V LP E G++ +L  H P++T IK G V I ++     
Sbjct: 1  MNTIHVDVVSAEESIFAGEARFVALPGEAGELGILPKHTPLITRIKPGSVRIEMADGSEE 60

Query: 64 RYVVIGGICDIVPSHCTVLSETIL 87
             V GGI ++ P   TVLS+T +
Sbjct: 61 FVFVAGGILEVQPDCVTVLSDTAI 84


>gi|30248231|ref|NP_840301.1| F0F1 ATP synthase subunit epsilon [Nitrosomonas europaea ATCC
           19718]
 gi|60389758|sp|Q820S4|ATPE_NITEU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|30180116|emb|CAD84118.1| ATP synthase, Delta/Epsilon chain [Nitrosomonas europaea ATCC
           19718]
          Length = 140

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 73/136 (53%), Gaps = 11/136 (8%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ ++SG  + +V P+ +G++ +   H P+LT IKSG+V +    ++     
Sbjct: 5   FHLDIVSAEESIYSGPAEFIVAPAVMGEVGIFPQHTPMLTRIKSGVVRVKAPLQDDEEVY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD-QRFQMEQ 122
           V GG+ ++ P   T+L++T +    +D A     +++ +E+    N I +++  R Q E 
Sbjct: 65  VSGGMLEVQPDVVTILADTAVRGKDLDEAKALEAKRKAEEIMK--NKISEIEYARAQAEL 122

Query: 123 L-----LVDLSCLRRR 133
           +     L  +  LR+R
Sbjct: 123 IEATAQLAAIQKLRKR 138


>gi|95929970|ref|ZP_01312710.1| ATP synthase F1, epsilon subunit [Desulfuromonas acetoxidans DSM
           684]
 gi|95133939|gb|EAT15598.1| ATP synthase F1, epsilon subunit [Desulfuromonas acetoxidans DSM
           684]
          Length = 137

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+V+P K V S EV  ++ P  LG++ +L GH P+LTT+K G +T        H   
Sbjct: 5   LKLEMVTPYKRVLSEEVDEIIAPGALGELGILPGHTPLLTTLKVGELTYRKGGAAFH-VA 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V  G  ++     T+L+ET  P D   L   +  +      L  +   D++F++ +  ++
Sbjct: 64  VNWGYVEVEEGKVTILAETAEPADEIDLARAKAALGRAEDALKKLDPEDKQFRIMEAALE 123

Query: 127 LSCLR 131
            + +R
Sbjct: 124 RAMIR 128


>gi|308274353|emb|CBX30952.1| ATP synthase epsilon chain [uncultured Desulfobacterium sp.]
          Length = 139

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 65/132 (49%), Gaps = 5/132 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  ++  E+V+PEK V S E Q V+ P  +G+  VLVGH P  TT+K G++    +  E 
Sbjct: 1   MAGNIKIEVVTPEKSVVSEEAQIVMAPGTMGEFGVLVGHTPFFTTLKMGVIKYKDAKGEE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETI---LPMDNACLQALEKRIDEVCSDLNNICDVDQRFQ 119
               V  G  + +P   T+L+E       +D    +A  KR +E  +  +   D+D  F 
Sbjct: 61  RCVFVTEGFAEALPDRVTILAEAAERRRDIDVERAKAALKRAEERLAKESGKQDMD--FM 118

Query: 120 MEQLLVDLSCLR 131
             ++ +D +  R
Sbjct: 119 RAKIALDRALHR 130


>gi|21230030|ref|NP_635947.1| F0F1 ATP synthase subunit epsilon [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769976|ref|YP_244738.1| F0F1 ATP synthase subunit epsilon [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188993188|ref|YP_001905198.1| F0F1 ATP synthase subunit epsilon [Xanthomonas campestris pv.
           campestris str. B100]
 gi|24211490|sp|Q8PCZ4|ATPE_XANCP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|81304071|sp|Q4UQF5|ATPE_XANC8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740303|sp|B0RWC1|ATPE_XANCB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|21111550|gb|AAM39871.1| ATP synthase epsilon chain [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66575308|gb|AAY50718.1| ATP synthase epsilon chain [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167734948|emb|CAP53160.1| ATP synthase epsilon chain [Xanthomonas campestris pv. campestris]
          Length = 140

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 70/127 (55%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +F GE   VV   ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAEQEIFRGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTASGEQLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQLLV 125
           GI ++ P   TVL +T +    +D A ++  ++  + + ++  +  DV+Q + Q+ +  V
Sbjct: 67  GILEVQPQVVTVLVDTAIRAQDIDEAAVRKAKEEAERLLANRGDTVDVEQAQRQLAEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|114330305|ref|YP_746527.1| F0F1 ATP synthase subunit epsilon [Nitrosomonas eutropha C91]
 gi|122314649|sp|Q0AJA9|ATPE_NITEC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|114307319|gb|ABI58562.1| ATP synthase F1 subcomplex epsilon subunit [Nitrosomonas eutropha
           C91]
          Length = 140

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 71/132 (53%), Gaps = 8/132 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ ++SG  + +V P+ +G++ +   H P+LT IKSG+V +    ++     
Sbjct: 5   FHLDIVSAEESIYSGPAEFIVAPAVMGEVGIYPQHTPMLTRIKSGVVRVKAPLQDDEEIY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD-QRFQME- 121
           V GG+ ++ P   T+L++T +    +D A     +++ +E+    N   D++  R Q E 
Sbjct: 65  VSGGMLEVQPDVVTILADTAVRGQDLDEAKALEAKRKAEEIMK--NKTSDIEYARAQAEL 122

Query: 122 -QLLVDLSCLRR 132
            +    L+ +R+
Sbjct: 123 IEATAQLAAIRK 134


>gi|251791749|ref|YP_003006470.1| ATP synthase F1 subunit epsilon [Dickeya zeae Ech1591]
 gi|247540370|gb|ACT08991.1| ATP synthase F1, epsilon subunit [Dickeya zeae Ech1591]
          Length = 140

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 7   HLDVVSAEQAMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQHGEEEYIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P+  TVLS+T +    +D A     ++R +E     N+  DVD       L 
Sbjct: 67  SGGILEVQPNMVTVLSDTAIRGQDLDEARAMEAKRRAEEHIR--NSHGDVDYAQASADLA 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|256823840|ref|YP_003147803.1| ATP synthase F1 subunit epsilon [Kangiella koreensis DSM 16069]
 gi|256797379|gb|ACV28035.1| ATP synthase F1, epsilon subunit [Kangiella koreensis DSM 16069]
          Length = 141

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG+V+ ++   +LG++ V  GHAP+LT++  G + ++L   E   + 
Sbjct: 5   VHLDIVSAEESIFSGKVERLIANGDLGELGVEPGHAPLLTSLNPGPIKVTLPGGEEEFFF 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSD 107
           V GG+ +++P   TVL++T +    +D A     EK   E   D
Sbjct: 65  VSGGMLEVLPHVVTVLADTAVRAEDVDEAKALEAEKMAREALQD 108


>gi|260913590|ref|ZP_05920067.1| ATP synthase F1 [Pasteurella dagmatis ATCC 43325]
 gi|260632366|gb|EEX50540.1| ATP synthase F1 [Pasteurella dagmatis ATCC 43325]
          Length = 142

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 72/134 (53%), Gaps = 8/134 (5%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           MS+ N     +VS E+ +FSG+V+S+      G++ +L GH P+LT+IK GIV I+L   
Sbjct: 1   MSVFN---LTVVSAEQQIFSGQVKSIQATGVEGELGILAGHTPLLTSIKPGIVKITLENG 57

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQR 117
           +     V GG  ++ P+  TVL++T +    +D   + A +KR +E     +   D +  
Sbjct: 58  KEEVVYVSGGFLEVQPNVVTVLADTAIRGEELDGDRILAAKKRAEENIRSRH--ADANYE 115

Query: 118 FQMEQLLVDLSCLR 131
               +L  +L+ LR
Sbjct: 116 MLASKLSKELAKLR 129


>gi|253997693|ref|YP_003049757.1| F0F1 ATP synthase subunit epsilon [Methylotenera mobilis JLW8]
 gi|253984372|gb|ACT49230.1| ATP synthase F1, epsilon subunit [Methylotenera mobilis JLW8]
          Length = 141

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + N +H ++VS E  +FSGE + VV P+  G++ +   HAP++TTIK G + I  + E  
Sbjct: 1  MANTVHIDVVSAEASIFSGEAEFVVAPASAGEVGIYPNHAPMITTIKPGALRIKQASEAE 60

Query: 63 HRYVVI-GGICDIVPSHCTVLSET 85
             + I GG+ ++ P   TVL++T
Sbjct: 61 ETLIFISGGMLEVQPGVVTVLADT 84


>gi|21244373|ref|NP_643955.1| F0F1 ATP synthase subunit epsilon [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|78049322|ref|YP_365497.1| F0F1 ATP synthase subunit epsilon [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294624653|ref|ZP_06703324.1| ATP synthase subunit epsilon [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667260|ref|ZP_06732480.1| ATP synthase subunit epsilon [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325924758|ref|ZP_08186195.1| ATP synthase F1 subcomplex epsilon subunit [Xanthomonas perforans
           91-118]
 gi|24211492|sp|Q8PGG8|ATPE_XANAC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119367809|sp|Q3BP16|ATPE_XANC5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|21110031|gb|AAM38491.1| ATP synthase epsilon chain [Xanthomonas axonopodis pv. citri str.
           306]
 gi|78037752|emb|CAJ25497.1| ATP synthase epsilon chain [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|292601047|gb|EFF45113.1| ATP synthase subunit epsilon [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602932|gb|EFF46363.1| ATP synthase subunit epsilon [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325544850|gb|EGD16196.1| ATP synthase F1 subcomplex epsilon subunit [Xanthomonas perforans
           91-118]
          Length = 140

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 70/127 (55%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS EK +F GE   VV   ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTANGEQLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           GI ++ P   T+L +T +    +D A ++ +++  + + ++  N  DV + + Q+ +  V
Sbjct: 67  GILEVQPQVVTILVDTAVRAQDIDEAAVRKVKEEAERLLANRGNTVDVAEAQRQLAEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|15642756|ref|NP_232389.1| F0F1 ATP synthase subunit epsilon [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121591161|ref|ZP_01678466.1| ATP synthase F1, epsilon subunit [Vibrio cholerae 2740-80]
 gi|121729385|ref|ZP_01682052.1| ATP synthase F1, epsilon subunit [Vibrio cholerae V52]
 gi|147675059|ref|YP_001218422.1| F0F1 ATP synthase subunit epsilon [Vibrio cholerae O395]
 gi|153212936|ref|ZP_01948530.1| ATP synthase F1, epsilon subunit [Vibrio cholerae 1587]
 gi|153803375|ref|ZP_01957961.1| ATP synthase F1, epsilon subunit [Vibrio cholerae MZO-3]
 gi|153820053|ref|ZP_01972720.1| ATP synthase F1, epsilon subunit [Vibrio cholerae NCTC 8457]
 gi|153823460|ref|ZP_01976127.1| ATP synthase F1, epsilon subunit [Vibrio cholerae B33]
 gi|153827200|ref|ZP_01979867.1| ATP synthase F1, epsilon subunit [Vibrio cholerae MZO-2]
 gi|227082875|ref|YP_002811426.1| ATP synthase F1, epsilon subunit [Vibrio cholerae M66-2]
 gi|229508276|ref|ZP_04397780.1| ATP synthase epsilon chain [Vibrio cholerae BX 330286]
 gi|229508628|ref|ZP_04398123.1| ATP synthase epsilon chain [Vibrio cholerae B33]
 gi|229515970|ref|ZP_04405427.1| ATP synthase epsilon chain [Vibrio cholerae TMA 21]
 gi|229517156|ref|ZP_04406602.1| ATP synthase epsilon chain [Vibrio cholerae RC9]
 gi|229520152|ref|ZP_04409579.1| ATP synthase epsilon chain [Vibrio cholerae TM 11079-80]
 gi|229524892|ref|ZP_04414297.1| ATP synthase epsilon chain [Vibrio cholerae bv. albensis VL426]
 gi|229530224|ref|ZP_04419613.1| ATP synthase epsilon chain [Vibrio cholerae 12129(1)]
 gi|229606550|ref|YP_002877198.1| F0F1 ATP synthase subunit epsilon [Vibrio cholerae MJ-1236]
 gi|254291149|ref|ZP_04961946.1| ATP synthase F1, epsilon subunit [Vibrio cholerae AM-19226]
 gi|254851554|ref|ZP_05240904.1| H+-transporting two-sector ATPase [Vibrio cholerae MO10]
 gi|255746827|ref|ZP_05420773.1| ATP synthase epsilon chain [Vibrio cholera CIRS 101]
 gi|258623012|ref|ZP_05718026.1| ATP synthase subunit epsilon [Vibrio mimicus VM573]
 gi|258625010|ref|ZP_05719933.1| ATP synthase subunit epsilon [Vibrio mimicus VM603]
 gi|261213284|ref|ZP_05927566.1| ATP synthase epsilon chain [Vibrio sp. RC341]
 gi|262155907|ref|ZP_06029029.1| ATP synthase epsilon chain [Vibrio cholerae INDRE 91/1]
 gi|262166761|ref|ZP_06034498.1| ATP synthase epsilon chain [Vibrio mimicus VM223]
 gi|262167079|ref|ZP_06034794.1| ATP synthase epsilon chain [Vibrio cholerae RC27]
 gi|262172740|ref|ZP_06040418.1| ATP synthase epsilon chain [Vibrio mimicus MB-451]
 gi|262190642|ref|ZP_06048877.1| ATP synthase epsilon chain [Vibrio cholerae CT 5369-93]
 gi|262402103|ref|ZP_06078667.1| ATP synthase epsilon chain [Vibrio sp. RC586]
 gi|297581992|ref|ZP_06943912.1| predicted protein [Vibrio cholerae RC385]
 gi|298501173|ref|ZP_07010972.1| ATP synthase F1, epsilon subunit [Vibrio cholerae MAK 757]
 gi|20137514|sp|Q9KNH6|ATPE_VIBCH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|9657364|gb|AAF95902.1| ATP synthase F1, epsilon subunit [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121546978|gb|EAX57123.1| ATP synthase F1, epsilon subunit [Vibrio cholerae 2740-80]
 gi|121628666|gb|EAX61138.1| ATP synthase F1, epsilon subunit [Vibrio cholerae V52]
 gi|124116162|gb|EAY34982.1| ATP synthase F1, epsilon subunit [Vibrio cholerae 1587]
 gi|124121099|gb|EAY39842.1| ATP synthase F1, epsilon subunit [Vibrio cholerae MZO-3]
 gi|126509410|gb|EAZ72004.1| ATP synthase F1, epsilon subunit [Vibrio cholerae NCTC 8457]
 gi|126519029|gb|EAZ76252.1| ATP synthase F1, epsilon subunit [Vibrio cholerae B33]
 gi|146316942|gb|ABQ21481.1| ATP synthase F1, epsilon subunit [Vibrio cholerae O395]
 gi|149738923|gb|EDM53247.1| ATP synthase F1, epsilon subunit [Vibrio cholerae MZO-2]
 gi|150422994|gb|EDN14944.1| ATP synthase F1, epsilon subunit [Vibrio cholerae AM-19226]
 gi|227010763|gb|ACP06975.1| ATP synthase F1, epsilon subunit [Vibrio cholerae M66-2]
 gi|227012009|gb|ACP08219.1| ATP synthase F1, epsilon subunit [Vibrio cholerae O395]
 gi|229332357|gb|EEN97844.1| ATP synthase epsilon chain [Vibrio cholerae 12129(1)]
 gi|229338473|gb|EEO03490.1| ATP synthase epsilon chain [Vibrio cholerae bv. albensis VL426]
 gi|229342746|gb|EEO07737.1| ATP synthase epsilon chain [Vibrio cholerae TM 11079-80]
 gi|229346219|gb|EEO11191.1| ATP synthase epsilon chain [Vibrio cholerae RC9]
 gi|229347070|gb|EEO12032.1| ATP synthase epsilon chain [Vibrio cholerae TMA 21]
 gi|229354342|gb|EEO19270.1| ATP synthase epsilon chain [Vibrio cholerae B33]
 gi|229354549|gb|EEO19471.1| ATP synthase epsilon chain [Vibrio cholerae BX 330286]
 gi|229369205|gb|ACQ59628.1| ATP synthase epsilon chain [Vibrio cholerae MJ-1236]
 gi|254847259|gb|EET25673.1| H+-transporting two-sector ATPase [Vibrio cholerae MO10]
 gi|255735584|gb|EET90983.1| ATP synthase epsilon chain [Vibrio cholera CIRS 101]
 gi|258582708|gb|EEW07534.1| ATP synthase subunit epsilon [Vibrio mimicus VM603]
 gi|258584715|gb|EEW09450.1| ATP synthase subunit epsilon [Vibrio mimicus VM573]
 gi|260837558|gb|EEX64261.1| ATP synthase epsilon chain [Vibrio sp. RC341]
 gi|261893816|gb|EEY39802.1| ATP synthase epsilon chain [Vibrio mimicus MB-451]
 gi|262024465|gb|EEY43151.1| ATP synthase epsilon chain [Vibrio cholerae RC27]
 gi|262026477|gb|EEY45145.1| ATP synthase epsilon chain [Vibrio mimicus VM223]
 gi|262030359|gb|EEY49001.1| ATP synthase epsilon chain [Vibrio cholerae INDRE 91/1]
 gi|262033480|gb|EEY51983.1| ATP synthase epsilon chain [Vibrio cholerae CT 5369-93]
 gi|262351749|gb|EEZ00881.1| ATP synthase epsilon chain [Vibrio sp. RC586]
 gi|297533859|gb|EFH72700.1| predicted protein [Vibrio cholerae RC385]
 gi|297540045|gb|EFH76107.1| ATP synthase F1, epsilon subunit [Vibrio cholerae MAK 757]
 gi|327485231|gb|AEA79638.1| ATP synthase epsilon chain [Vibrio cholerae LMA3894-4]
          Length = 140

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 7/129 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-SLSCEEIHRY 65
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I  L   E + Y
Sbjct: 6   FHLDVVSAEKKLFSGLVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKLHGHEEYIY 65

Query: 66  VVIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           V  GGI ++ P   TVL++T +    +D A  +  ++R +E    LN   D+D      +
Sbjct: 66  VS-GGIVEVQPGTATVLADTAIRGEDLDAAKAEEAKRRAEERI--LNQHGDMDFAQAASE 122

Query: 123 LLVDLSCLR 131
           L   ++ LR
Sbjct: 123 LAKAIAQLR 131


>gi|70733498|ref|YP_263273.1| F0F1 ATP synthase subunit epsilon [Pseudomonas fluorescens Pf-5]
 gi|119367760|sp|Q4K3B0|ATPE_PSEF5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|68347797|gb|AAY95403.1| ATP synthase F1, epsilon subunit [Pseudomonas fluorescens Pf-5]
          Length = 141

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 62/110 (56%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ VV   ELGD+ + +GHAP++T +K G + +     E   + 
Sbjct: 5   VHCDIVSAEGEIFSGLVEMVVAHGELGDLGIALGHAPLITNLKPGPIRLIKQGGEAEVFY 64

Query: 67  VIGGICDIVPSHCTVLSETI---LPMDNACLQ----ALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A  Q    A EK ++E  +D +
Sbjct: 65  ISGGFLEVQPNMVKVLADTVQRAADLDEASAQEAVKAAEKALNEKGADFD 114


>gi|300024909|ref|YP_003757520.1| ATP synthase F1 subunit epsilon [Hyphomicrobium denitrificans
          ATCC 51888]
 gi|299526730|gb|ADJ25199.1| ATP synthase F1, epsilon subunit [Hyphomicrobium denitrificans
          ATCC 51888]
          Length = 132

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +     FELVSPE+ + S +   VV+P   G+  VL GHAPV+ T++ G++ ++    + 
Sbjct: 1  MAGTFKFELVSPERVLLSIDADQVVVPGSDGEFAVLAGHAPVIATLRPGVLDVTAGGSK- 59

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
           R  V  G  ++ PS  TVL+E
Sbjct: 60 RRLFVKSGFAEVDPSRLTVLAE 81


>gi|94312424|ref|YP_585634.1| F0F1 ATP synthase subunit epsilon [Cupriavidus metallidurans CH34]
 gi|119367766|sp|Q1LHL1|ATPE_RALME RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|93356276|gb|ABF10365.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Cupriavidus metallidurans CH34]
          Length = 138

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E  +FSG+ + V LP E G++ +L GH P++T I+ G V I           V G
Sbjct: 7   DVVSAEASIFSGQAKFVALPGESGELGILPGHTPLITRIQPGAVRIEKEDGGEEFVFVAG 66

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD-QRFQME 121
           GI ++ P H TVL++T +    +D A     ++  +E+    N   D+D  R Q E
Sbjct: 67  GILEVQPQHVTVLADTAIRGTDLDEAKASEAKRAAEEMLQ--NQSSDLDLARAQSE 120


>gi|332143471|ref|YP_004429209.1| F0F1 ATP synthase subunit epsilon [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553493|gb|AEB00212.1| F0F1 ATP synthase subunit epsilon [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 137

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 59/100 (59%), Gaps = 3/100 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS EK +FSG V+S+ +    G++ +  GHAP+++ IK G+V +     E     
Sbjct: 5   VHLDVVSAEKAIFSGRVESIQVTGSEGELGINPGHAPLISAIKPGMVRLVKQHGEEEVIY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDE 103
           V GG+ ++ P++ TVL++T +    +D    Q  ++R +E
Sbjct: 65  VAGGVLEVQPNNITVLADTAVRAEDLDEQAAQEAKRRAEE 104


>gi|91226239|ref|ZP_01261079.1| F0F1 ATP synthase subunit epsilon [Vibrio alginolyticus 12G01]
 gi|262392805|ref|YP_003284659.1| ATP synthase epsilon chain [Vibrio sp. Ex25]
 gi|269965298|ref|ZP_06179419.1| ATP synthase subunit epsilon [Vibrio alginolyticus 40B]
 gi|114611|sp|P12988|ATPE_VIBAL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|48340|emb|CAA34182.1| unnamed protein product [Vibrio alginolyticus]
 gi|91189250|gb|EAS75529.1| F0F1 ATP synthase subunit epsilon [Vibrio alginolyticus 12G01]
 gi|262336399|gb|ACY50194.1| ATP synthase epsilon chain [Vibrio sp. Ex25]
 gi|269830099|gb|EEZ84327.1| ATP synthase subunit epsilon [Vibrio alginolyticus 40B]
          Length = 140

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 61/115 (53%), Gaps = 7/115 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I      EEI  
Sbjct: 6   FHLDVVSAEKKIFSGRVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKQHGHEEI-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
             V GG+ +I P   TVL++T +    +D A  +  ++R +E   + +   D  Q
Sbjct: 64  IYVSGGMVEIQPGTATVLADTAIRGEELDAAKAEEAKRRAEEQIQNQHGDMDFAQ 118


>gi|162146521|ref|YP_001600980.1| ATP synthase epsilon chain [Gluconacetobacter diazotrophicus PAl 5]
 gi|189081366|sp|A9H9B1|ATPE_GLUDA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|161785096|emb|CAP54640.1| ATP synthase epsilon chain [Gluconacetobacter diazotrophicus PAl 5]
          Length = 141

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 56/104 (53%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  E+VSPEK +FS  V   ++P   GDI  +  HAP++  ++ G+V +        R+ 
Sbjct: 4   IKVEIVSPEKVLFSRAVDMALIPGLEGDIAAMPDHAPMMLLLRGGVVELHQDGAVTDRFF 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
           V GG  D+  + CT+L++    + +  ++A + R+ E+ +  + 
Sbjct: 64  VAGGFADMTETSCTILADQATALSDLSVEAAQARLAELEASYDK 107


>gi|121592743|ref|YP_984639.1| F0F1 ATP synthase subunit epsilon [Acidovorax sp. JS42]
 gi|222109524|ref|YP_002551788.1| f0f1 ATP synthase subunit epsilon [Acidovorax ebreus TPSY]
 gi|166222428|sp|A1W2T8|ATPE_ACISJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|254809362|sp|B9MBA4|ATPE_DIAST RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|120604823|gb|ABM40563.1| ATP synthase F1 subcomplex epsilon subunit [Acidovorax sp. JS42]
 gi|221728968|gb|ACM31788.1| ATP synthase F1, epsilon subunit [Acidovorax ebreus TPSY]
          Length = 138

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +FSGE + V LP E G++ +   H P++T IK G V I L      
Sbjct: 1  MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRIKPGSVRIELPDGNEE 60

Query: 64 RYVVIGGICDIVPSHCTVLSETIL 87
             V GGI ++ P   TVLS+T +
Sbjct: 61 FVFVAGGILEVQPDCVTVLSDTAI 84


>gi|115379931|ref|ZP_01466988.1| ATP synthase F1, epsilon subunit [Stigmatella aurantiaca DW4/3-1]
 gi|310818218|ref|YP_003950576.1| ATP synthase f1 subunit epsilon [Stigmatella aurantiaca DW4/3-1]
 gi|115363056|gb|EAU62234.1| ATP synthase F1, epsilon subunit [Stigmatella aurantiaca DW4/3-1]
 gi|309391290|gb|ADO68749.1| ATP synthase F1, epsilon subunit [Stigmatella aurantiaca DW4/3-1]
          Length = 134

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 1/125 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+V+PEK + S +    ++P   G   V  GHAP L+ ++ G +T+ +       + 
Sbjct: 4   LTVEIVTPEKRILSVQADEAIVPGSRGLFGVRPGHAPFLSLVEPGALTL-IDAGRRESFF 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           + GG  ++      VL++   P+    ++A  KR+ E    L  +   D R+Q+EQ  V 
Sbjct: 63  IAGGFVEVGNDKVLVLADGAEPVGGIDVEAARKRLAEAQERLKGLSSEDARYQLEQAAVR 122

Query: 127 LSCLR 131
               R
Sbjct: 123 RETAR 127


>gi|209543480|ref|YP_002275709.1| ATP synthase F1 subunit epsilon [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209531157|gb|ACI51094.1| ATP synthase F1, epsilon subunit [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 140

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 56/104 (53%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  E+VSPEK +FS  V   ++P   GDI  +  HAP++  ++ G+V +        R+ 
Sbjct: 3   IKVEIVSPEKVLFSRAVDMALIPGLEGDIAAMPDHAPMMLLLRGGVVELHQDGAVTDRFF 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
           V GG  D+  + CT+L++    + +  ++A + R+ E+ +  + 
Sbjct: 63  VAGGFADMTETSCTILADQATALSDLSVEAAQARLAELEASYDK 106


>gi|83952826|ref|ZP_00961556.1| ATP synthase F1, epsilon subunit [Roseovarius nubinhibens ISM]
 gi|83835961|gb|EAP75260.1| ATP synthase F1, epsilon subunit [Roseovarius nubinhibens ISM]
          Length = 148

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 4/124 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   + F+LVSPE+ + S +V  V +P   GD+TV+  HAP++T+++ G++  S    E 
Sbjct: 8   MAETVQFDLVSPERRLASVQVTEVQIPGADGDMTVMADHAPLITSLRPGVLRASGPDGE- 66

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             YVV GG  +I     +VL+E  +P  +    + +  +D+    L+      + F+ E 
Sbjct: 67  SEYVVTGGFAEINADGISVLAERAVPRGDMTQDSFKALVDDAKQKLDR---AQETFKNEP 123

Query: 123 LLVD 126
             VD
Sbjct: 124 GPVD 127


>gi|83313237|ref|YP_423501.1| ATP synthase epsilon chain [Magnetospirillum magneticum AMB-1]
 gi|119367743|sp|Q2VZN3|ATPE_MAGMM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|82948078|dbj|BAE52942.1| ATP synthase epsilon chain [Magnetospirillum magneticum AMB-1]
          Length = 133

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 7/115 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   + FELVSP K + S +V  VV+P   GD   L  HAP++TT++ G++ I    +  
Sbjct: 1   MAEKIQFELVSPAKLLVSSKVDMVVVPGAEGDFGALALHAPMITTVRPGVIDIHDGGKVS 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILP-------MDNACLQALEKRIDEVCSDLNN 110
               V GG  ++     TVL+E  +P       M  A  +A ++ +D+  SD + 
Sbjct: 61  SSVFVAGGFAEVNEERITVLAEEAIPVGELTAEMAEARKKAAKEALDDAKSDRDK 115


>gi|86609666|ref|YP_478428.1| F0F1 ATP synthase subunit epsilon [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|119367800|sp|Q2JJK2|ATPE_SYNJB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|86558208|gb|ABD03165.1| ATP synthase F1, epsilon subunit [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 137

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 62/118 (52%), Gaps = 7/118 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P++ V+    + V+LP+  G + +L GHAP+LT I +G++ +    + +    
Sbjct: 3   LMVRVITPDRTVWDAPSEEVILPATSGQLGILTGHAPLLTAIGNGVMRVKADGKWLA-IA 61

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           V+GG  ++  +  TVL   +E    +D A  QAL   +DE    LN   D  +R Q +
Sbjct: 62  VMGGFAEVENNEVTVLVNRAERGEKVDKAAAQAL---LDEASKVLNTSSDKQERLQAK 116


>gi|271502666|ref|YP_003335692.1| ATP synthase F1 subunit epsilon [Dickeya dadantii Ech586]
 gi|270346221|gb|ACZ78986.1| ATP synthase F1, epsilon subunit [Dickeya dadantii Ech586]
          Length = 140

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 7   HLDVVSAEQAMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQHGEEEYIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P+  TVLS+T +    +D A     ++R +E     N+  DVD       L 
Sbjct: 67  SGGILEVQPNMVTVLSDTAIRGQDLDEARALEAKRRAEEHIR--NSHGDVDYAQASADLA 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|332527644|ref|ZP_08403690.1| ATP synthase F1 subunit epsilon [Rubrivivax benzoatilyticus JA2]
 gi|332112047|gb|EGJ12023.1| ATP synthase F1 subunit epsilon [Rubrivivax benzoatilyticus JA2]
          Length = 139

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (53%), Gaps = 6/117 (5%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   +H ++VS E+ +FSGE + V LP E G++ +L  H P++T IK G V I  +    
Sbjct: 1   MAKTIHVDVVSAEESIFSGEAKFVALPGENGELGILPRHTPLITRIKPGAVRIERADNGE 60

Query: 63  HRYV-VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
             +V V GGI ++ P+  TVL++T +    +D A     ++  +E     N   D+D
Sbjct: 61  EEFVFVAGGILEVQPNVVTVLADTAIRGHDLDEAKATEAKRLAEEAMR--NAKSDID 115


>gi|126461744|ref|YP_001042858.1| F0F1 ATP synthase subunit epsilon [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638721|ref|YP_002524983.1| F0F1 ATP synthase subunit epsilon [Rhodobacter sphaeroides KD131]
 gi|332557742|ref|ZP_08412064.1| F0F1 ATP synthase subunit epsilon [Rhodobacter sphaeroides WS8N]
 gi|126103408|gb|ABN76086.1| ATP synthase F1, epsilon subunit [Rhodobacter sphaeroides ATCC
           17029]
 gi|221159502|gb|ACM00482.1| ATP synthase epsilon chain 1 [Rhodobacter sphaeroides KD131]
 gi|332275454|gb|EGJ20769.1| F0F1 ATP synthase subunit epsilon [Rhodobacter sphaeroides WS8N]
          Length = 132

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 67/129 (51%), Gaps = 2/129 (1%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L F+LVSPE+ + S     V +P   GD+T + GHAP +TT++ GI+  +     +
Sbjct: 1   MAGTLQFDLVSPERRLASFAATEVQVPGTDGDMTAMEGHAPTITTLRPGILR-AHGPSGV 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             Y V GG  +I  +  +VL+E  + ++      L++ I E   +L ++   + R   E+
Sbjct: 60  QAYAVTGGFAEINATSISVLAEKAVAVEELTGTVLDEFIAE-ARELASVALPEDRDMAER 118

Query: 123 LLVDLSCLR 131
            L D+  L+
Sbjct: 119 TLNDMLALK 127


>gi|221069419|ref|ZP_03545524.1| ATP synthase F1, epsilon subunit [Comamonas testosteroni KF-1]
 gi|264676473|ref|YP_003276379.1| ATP synthase F1 subunit epsilon [Comamonas testosteroni CNB-2]
 gi|299531205|ref|ZP_07044616.1| F0F1 ATP synthase subunit epsilon [Comamonas testosteroni S44]
 gi|220714442|gb|EED69810.1| ATP synthase F1, epsilon subunit [Comamonas testosteroni KF-1]
 gi|262206985|gb|ACY31083.1| ATP synthase F1, epsilon subunit [Comamonas testosteroni CNB-2]
 gi|298720788|gb|EFI61734.1| F0F1 ATP synthase subunit epsilon [Comamonas testosteroni S44]
          Length = 138

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (59%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +FSGE + V LP E G++ +   H P++T IK G V I +      
Sbjct: 1  MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRIKPGSVRIEMPDGSEE 60

Query: 64 RYVVIGGICDIVPSHCTVLSETIL 87
             V GGI ++ P+  TVLS+T +
Sbjct: 61 FVFVAGGILEVQPNCVTVLSDTAI 84


>gi|238750323|ref|ZP_04611825.1| ATP synthase epsilon chain [Yersinia rohdei ATCC 43380]
 gi|238711556|gb|EEQ03772.1| ATP synthase epsilon chain [Yersinia rohdei ATCC 43380]
          Length = 140

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LTTIK G++ I     E     +
Sbjct: 7   HLDVVSAEKKMFSGVVQKIQVTGSEGELGIYPGHAPLLTTIKPGMIRIVKQFGEEEFIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ PS   VL++T +    +D A  +ALE +        N+  DVD      +L 
Sbjct: 67  SGGILEVQPSVVIVLADTAIRGTDLDEA--KALESKRKAEAHISNSHGDVDYAQASAELA 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|332186749|ref|ZP_08388491.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Sphingomonas sp. S17]
 gi|332013082|gb|EGI55145.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Sphingomonas sp. S17]
          Length = 83

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE-EIHRY 65
          LHFELV+PEK + S EV  VV+P   GD  VL GHAP ++TI+ G + +  + + E    
Sbjct: 2  LHFELVTPEKLLRSEEVHMVVVPGTEGDFGVLEGHAPFMSTIRDGAIQVYRTDKGEPESI 61

Query: 66 VVIGGICDIVPSHCTVLSE 84
           + GG  ++ P   TVL+E
Sbjct: 62 QIRGGFAEVGPKGLTVLAE 80


>gi|11465726|ref|NP_053870.1| ATP synthase CF1 epsilon subunit [Porphyra purpurea]
 gi|1703740|sp|P51260|ATPE_PORPU RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|1276726|gb|AAC08146.1| ATP synthase CF1 epsilon chain [Porphyra purpurea]
          Length = 134

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 65/129 (50%), Gaps = 4/129 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L+  +++P++ V+  E Q ++LPS  G + +L GHAP+LT +  G++ + +  E +   V
Sbjct: 3   LNIRIIAPDRTVWDAEAQEIILPSSTGQLGILTGHAPLLTALDIGVMRVRVDKEWMP-IV 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  +I  +  T+L           L   EK +D     LN+     ++ +  Q   +
Sbjct: 62  LLGGFAEIENNQLTILVNGAEEASQIDLVEAEKNLDTATQLLNDASSSKEKIEATQ---N 118

Query: 127 LSCLRRRIQ 135
           +   R R+Q
Sbjct: 119 IRKARARVQ 127


>gi|253690618|ref|YP_003019808.1| ATP synthase F1, epsilon subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259585486|sp|C6DJH3|ATPE_PECCP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|251757196|gb|ACT15272.1| ATP synthase F1, epsilon subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 139

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 6   HLDVVSAEQQMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQHGEEEYIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ P+  TVLS+T +    +D A  L+A  K  D +    N+  DVD      +L
Sbjct: 66  SGGILEVQPNTVTVLSDTAIRGQDLDEARALEAKRKAEDHIR---NSHGDVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 SKAIAKLR 130


>gi|242241388|ref|YP_002989569.1| ATP synthase F1 subunit epsilon [Dickeya dadantii Ech703]
 gi|242133445|gb|ACS87747.1| ATP synthase F1, epsilon subunit [Dickeya dadantii Ech703]
          Length = 140

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 64/125 (51%), Gaps = 1/125 (0%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 7   HLDVVSAEQALFSGLVQKIQVTGVEGELGIYPGHAPLLTAIKPGMVRIVKQYGEEEYIYL 66

Query: 68  IGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
            GG+ ++ P+  TVLS+T I   D    +ALE +        N   DVD      +L   
Sbjct: 67  SGGVLEVQPNMVTVLSDTAIRGQDLDEARALESKRKAEAHIHNTHGDVDYAQASAELAKA 126

Query: 127 LSCLR 131
           ++ LR
Sbjct: 127 IAKLR 131


>gi|260774961|ref|ZP_05883861.1| ATP synthase epsilon chain [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609051|gb|EEX35210.1| ATP synthase epsilon chain [Vibrio coralliilyticus ATCC BAA-450]
          Length = 140

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 7/115 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I      EEI  
Sbjct: 6   FHLDVVSAEKKIFSGRVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKQHGHEEI-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
             V GG+ ++ P   TVL++T +    +D A  +  ++R +E   + +   D  Q
Sbjct: 64  IYVSGGMVEVQPGTATVLADTAIRGEELDAAKAEEAKRRAEESIQNQHGDMDFAQ 118


>gi|315635258|ref|ZP_07890535.1| ATP synthase F1 sector epsilon subunit [Aggregatibacter segnis ATCC
           33393]
 gi|315476004|gb|EFU66759.1| ATP synthase F1 sector epsilon subunit [Aggregatibacter segnis ATCC
           33393]
          Length = 142

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 67/124 (54%), Gaps = 5/124 (4%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VS E+ +FSG V+SV      G++ VL GH P+LT IK GIV  +L  +      V GG
Sbjct: 8   VVSAEQKIFSGNVKSVQATGIEGELGVLPGHTPLLTAIKPGIVKFTLENDNEEVIYVSGG 67

Query: 71  ICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
             ++ P+  TVL++  +    +D+  + A +KR +E     ++  D D    M +L  +L
Sbjct: 68  FLEVQPTIVTVLADVAIRGQELDSERILAAKKRAEENIHQHHH--DADYELLMSKLSKEL 125

Query: 128 SCLR 131
           + LR
Sbjct: 126 AKLR 129


>gi|317494644|ref|ZP_07953056.1| ATP synthase F1 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917246|gb|EFV38593.1| ATP synthase F1 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 139

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ V  GHAP+LT IK G+V I     E     +
Sbjct: 6   HLDVVSAEQKMFSGLVQKIQVTGSEGELGVFPGHAPLLTAIKPGMVRIVKQHGEEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ PS  TVL++T +    +D A     +++ +E  +  N+  DVD      +L 
Sbjct: 66  SGGILEVQPSSVTVLADTAIRGQDLDEARAMESKRKAEEHIN--NSHGDVDYAQASAELS 123

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 124 KAIAKLR 130


>gi|163732294|ref|ZP_02139740.1| ATP synthase F1, epsilon subunit [Roseobacter litoralis Och 149]
 gi|161394592|gb|EDQ18915.1| ATP synthase F1, epsilon subunit [Roseobacter litoralis Och 149]
          Length = 138

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + + F+LVSPE+ + S +V +V +P   GD+T +  HAP +TT++ G++ ++   +  
Sbjct: 1  MADTVQFDLVSPERLLASVQVTAVQIPGADGDMTAMPDHAPTITTLRPGLL-VTEGPDGT 59

Query: 63 HRYVVIGGICDIVPSHCTVLSETILP 88
            YVV GG  +I  S  +VL+E  +P
Sbjct: 60 SEYVVTGGFAEITASSISVLAERAIP 85


>gi|56461718|ref|YP_156999.1| F0F1-type ATP synthase, epsilon subunit [Idiomarina loihiensis
           L2TR]
 gi|81678426|sp|Q5QZH3|ATPE_IDILO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|56180728|gb|AAV83450.1| F0F1-type ATP synthase, epsilon subunit [Idiomarina loihiensis
           L2TR]
          Length = 138

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 74/131 (56%), Gaps = 6/131 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEEIHRY 65
           L+ ++VS E  +FSG VQ+V +    G++ +  GHAP+LT IK G+V  +S + +E   Y
Sbjct: 6   LNLDVVSAEDKLFSGVVQTVQVTGSEGELGIYPGHAPLLTKIKPGMVRYVSEAGDEELLY 65

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQ---ALEKRIDEVCSDL-NNICDVDQRFQME 121
           V  GG+ ++ P H  VL++  +  D   LQ   A +KR +E  +D  +++   +   ++ 
Sbjct: 66  VA-GGVLEVQPGHVIVLADVAVRGDELDLQEAEAAKKRAEEAIADSGSDVTYAEAIAELS 124

Query: 122 QLLVDLSCLRR 132
           + L  +  +R+
Sbjct: 125 RALAQIDIIRK 135


>gi|261491752|ref|ZP_05988332.1| ATP synthase epsilon chain [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495498|ref|ZP_05991945.1| ATP synthase epsilon chain [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261308832|gb|EEY10088.1| ATP synthase epsilon chain [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261312591|gb|EEY13714.1| ATP synthase epsilon chain [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 139

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 65/119 (54%), Gaps = 6/119 (5%)

Query: 8   HFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            FEL  VS E+ +F G V SV +    G++ V  GHAP+LT IK G+V  +L+  +    
Sbjct: 4   QFELTVVSAERKIFEGTVTSVRVSGTDGELGVYAGHAPLLTAIKPGMVKFTLADGKEEFI 63

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            V GG  ++ P+  TVL++T +    +D   + A +++++E  S  ++  D+  +   E
Sbjct: 64  YVSGGFLEVQPTVVTVLADTAIRGEELDEQRILAAKRKVEETLSKTSD-ADITAKLARE 121


>gi|323496905|ref|ZP_08101933.1| F0F1 ATP synthase subunit epsilon [Vibrio sinaloensis DSM 21326]
 gi|323317979|gb|EGA70962.1| F0F1 ATP synthase subunit epsilon [Vibrio sinaloensis DSM 21326]
          Length = 140

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 7/115 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I      EEI  
Sbjct: 6   FHLDVVSAEKKIFSGRVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKQHGHEEI-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
             V GG+ ++ P   TVL++T +    +D A  +  ++R +E   + +   D  Q
Sbjct: 64  IYVSGGMVEVQPGTATVLADTAIRGEELDAAKAEEAKRRAEENIQNQHGDMDFAQ 118


>gi|293391131|ref|ZP_06635465.1| ATP synthase F1, epsilon subunit [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951665|gb|EFE01784.1| ATP synthase F1, epsilon subunit [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 142

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +FSG V+SV      G++ VL GHAP+LT IK GIV ++L  +      
Sbjct: 4   FNLTVVSAEQQIFSGNVKSVQATGIEGELGVLPGHAPLLTAIKPGIVKLTLENDSEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P+   VL++  +    +D+  + A +KR +E     ++  D D    M +L
Sbjct: 64  VSGGFLEVQPTAVIVLADIAIRGQELDSERILAAKKRAEENIRQHHH--DADYEVLMSKL 121

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 122 SKELAKLR 129


>gi|218781463|ref|YP_002432781.1| ATP synthase F1 subunit epsilon [Desulfatibacillum alkenivorans
          AK-01]
 gi|226740245|sp|B8FGT3|ATPE_DESAA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|218762847|gb|ACL05313.1| ATP synthase F1, epsilon subunit [Desulfatibacillum alkenivorans
          AK-01]
          Length = 141

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +  ++  E+V+PEK V S  VQ+V  P   G+  VLVGH P L T+K G +       ++
Sbjct: 1  MAGNILLEVVTPEKIVVSETVQTVTAPGSEGEFGVLVGHTPFLATLKLGTLNFKDETGKV 60

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
              + GG  + +P+  TVL+E+
Sbjct: 61 RAVFINGGFAETLPNKVTVLAES 83


>gi|171462854|ref|YP_001796967.1| ATP synthase F1, epsilon subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|226740272|sp|B1XSD5|ATPE_POLNS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|171192392|gb|ACB43353.1| ATP synthase F1, epsilon subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 138

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 5/109 (4%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +FS E + V LP E G++ +L GH P++T I+ G V I  + ++     V G
Sbjct: 7   DVVSTEQSIFSVEAKFVALPGESGELGILRGHTPLITRIRPGSVRIEKADDDEEFVFVAG 66

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
           G  +I   H TVL++T +    +D A     +KR +E     N   D D
Sbjct: 67  GYLEIQSDHVTVLADTAIRGHDLDEAKAIEAKKRAEEAMQ--NRGTDFD 113


>gi|254361676|ref|ZP_04977813.1| H(+)-transporting two-sector ATPase, F(1) epsilon subunit
           [Mannheimia haemolytica PHL213]
 gi|153093198|gb|EDN74209.1| H(+)-transporting two-sector ATPase, F(1) epsilon subunit
           [Mannheimia haemolytica PHL213]
          Length = 139

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 67/125 (53%), Gaps = 8/125 (6%)

Query: 8   HFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            FEL  VS E+ +F G V SV +    G++ V  GHAP+LT IK G+V  +L+  +    
Sbjct: 4   QFELTVVSAERKIFEGTVTSVRVSGTDGELGVYAGHAPLLTAIKPGMVKFTLADGKEEFI 63

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            V GG  ++ P+  TVL++T +    +D   + A +++++E    L+   D D   ++ +
Sbjct: 64  YVSGGFLEVQPTVVTVLADTAIRGEELDEQRILAAKRKVEET---LSKTSDADMTAKLAR 120

Query: 123 LLVDL 127
            +  L
Sbjct: 121 EIAKL 125


>gi|146278236|ref|YP_001168395.1| F0F1 ATP synthase subunit epsilon [Rhodobacter sphaeroides ATCC
           17025]
 gi|166222487|sp|A4WUM6|ATPE_RHOS5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|145556477|gb|ABP71090.1| ATP synthase F1, epsilon subunit [Rhodobacter sphaeroides ATCC
           17025]
          Length = 132

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 67/129 (51%), Gaps = 2/129 (1%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L F+LVSPE+ + S     V +P   GD+T + GHAP +TT++ GI+  +     +
Sbjct: 1   MAGTLQFDLVSPERRLASFAATEVQVPGTDGDMTAMEGHAPTITTLRPGILR-AQGPSGV 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             Y V GG  +I  +  +VL+E  + ++      L++ I E   +L ++   + +   E+
Sbjct: 60  QAYAVTGGFAEINATSISVLAEKAVAVEELTGTVLDEFIAE-ARELVSVALPEDKDMAER 118

Query: 123 LLVDLSCLR 131
            L D+  LR
Sbjct: 119 TLNDMLALR 127


>gi|89898926|ref|YP_521397.1| F0F1 ATP synthase subunit epsilon [Rhodoferax ferrireducens T118]
 gi|119367769|sp|Q223D7|ATPE_RHOFD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|89343663|gb|ABD67866.1| ATP synthase F1, epsilon subunit [Rhodoferax ferrireducens T118]
          Length = 138

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +N +H ++VS E+ +FSGE + V LP E+G++ +   H P+++ IK+G V I  +     
Sbjct: 1   MNTIHVDVVSAEESIFSGEARFVALPGEVGELGIYPRHTPLISRIKAGSVRIEKADGSEE 60

Query: 64  RYVVIGGICDIVPSHCTVLSETIL-------PMDNACLQALEKRIDEVCSDLN 109
              V GG+ ++ P+  TVLS+T +          NA   A E+ +    +D++
Sbjct: 61  FVFVAGGLLEVQPNCVTVLSDTAIRGKDLDEEKANAAKLAAEEAMKNAKTDID 113


>gi|124265391|ref|YP_001019395.1| F0F1 ATP synthase subunit epsilon [Methylibium petroleiphilum
          PM1]
 gi|166222470|sp|A2SC71|ATPE_METPP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|124258166|gb|ABM93160.1| putative ATP synthase epsilon chain protein [Methylibium
          petroleiphilum PM1]
          Length = 138

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSGE + V LP E+G++ +   H P++T IK G V +  +      +V
Sbjct: 4  IHVDVVSAEASIFSGEAKFVALPGEMGELGIYPRHTPLITRIKPGAVRVERADNGEEEFV 63

Query: 67 -VIGGICDIVPSHCTVLSETIL 87
           V GGI ++ P   TVL++T +
Sbjct: 64 FVAGGILEVQPDRVTVLADTAI 85


>gi|119896452|ref|YP_931665.1| F0F1 ATP synthase subunit epsilon [Azoarcus sp. BH72]
 gi|166222431|sp|A1K1S3|ATPE_AZOSB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119668865|emb|CAL92778.1| probable ATP synthase epsilon chain [Azoarcus sp. BH72]
          Length = 141

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG  + V LP E G++ +L GH P++T IK G V + +  +     V
Sbjct: 5   VHVDIVSAEEQIFSGLAEFVALPGEAGELGILPGHMPLMTRIKPGAVRVKVQNQAEEEVV 64

Query: 67  -VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICD 113
            V GG+ ++ P   TVL++T +    +D A     +++ +E  ++ ++  D
Sbjct: 65  FVAGGLLEVQPGLVTVLADTAIRGKDLDEAKALEAKRKAEEALANQSSQLD 115


>gi|218194450|gb|EEC76877.1| hypothetical protein OsI_15081 [Oryza sativa Indica Group]
          Length = 1981

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 49/84 (58%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +N +H ++VS E+ +FSGE + V LP E G++ +   H P++T IK G V I  +     
Sbjct: 700 MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRIKPGSVRIETADGGEE 759

Query: 64  RYVVIGGICDIVPSHCTVLSETIL 87
              V GGI ++ P   TVLS+T +
Sbjct: 760 FVFVAGGILEVQPERVTVLSDTAI 783


>gi|121607477|ref|YP_995284.1| F0F1 ATP synthase subunit epsilon [Verminephrobacter eiseniae
          EF01-2]
 gi|166222507|sp|A1WF59|ATPE_VEREI RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|121552117|gb|ABM56266.1| ATP synthase F1, epsilon subunit [Verminephrobacter eiseniae
          EF01-2]
          Length = 138

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 54/85 (63%), Gaps = 2/85 (2%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +F+G+ + V LP E+G++ +   HAP++T IK G V I ++     
Sbjct: 1  MNTIHVDVVSAEESIFTGQARFVALPGEVGELGIYPRHAPLITRIKPGSVRIEMADGSEE 60

Query: 64 RYVVIGGICDIVPSHC-TVLSETIL 87
             V GG+ ++ P HC TVLS+T +
Sbjct: 61 FVFVAGGLLEVQP-HCVTVLSDTAI 84


>gi|307133302|ref|YP_003885318.1| F1 sector of membrane-bound ATP synthase, subunit epsilon [Dickeya
           dadantii 3937]
 gi|306530831|gb|ADN00762.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Dickeya
           dadantii 3937]
          Length = 140

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (0%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 7   HLDVVSAEQAMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQHGEEEYIYL 66

Query: 68  IGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
            GGI ++ P+  TVLS+T I   D    +ALE +        N+  DVD       L   
Sbjct: 67  SGGILEVQPNMVTVLSDTAIRGQDLDEARALEAKRKAEEHIRNSHGDVDYAQASADLAKA 126

Query: 127 LSCLR 131
           ++ LR
Sbjct: 127 IAKLR 131


>gi|261867033|ref|YP_003254955.1| F0F1 ATP synthase subunit epsilon [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412365|gb|ACX81736.1| ATP synthase F1, epsilon subunit [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 142

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +FSG V+SV      G++ VL GHAP+LT IK GIV ++L  +      
Sbjct: 4   FNLTVVSAEQQIFSGNVKSVQATGIEGELGVLPGHAPLLTAIKPGIVKLTLENDSEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P+   VL++  +    +D+  + A +KR +E     ++  D D    M +L
Sbjct: 64  VSGGFLEVQPTAVIVLADIAIRGQELDSERIIAAKKRAEENIRQHHH--DADYEVLMSKL 121

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 122 SKELAKLR 129


>gi|22128002|ref|NP_671425.1| F0F1 ATP synthase subunit epsilon [Yersinia pestis KIM 10]
 gi|45443750|ref|NP_995289.1| F0F1 ATP synthase subunit epsilon [Yersinia pestis biovar Microtus
           str. 91001]
 gi|150260946|ref|ZP_01917674.1| ATP synthase epsilon subunit protein [Yersinia pestis CA88-4125]
 gi|153948726|ref|YP_001403117.1| F0F1 ATP synthase subunit epsilon [Yersinia pseudotuberculosis IP
           31758]
 gi|162420709|ref|YP_001608471.1| F0F1 ATP synthase subunit epsilon [Yersinia pestis Angola]
 gi|165926212|ref|ZP_02222044.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939962|ref|ZP_02228499.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009508|ref|ZP_02230406.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166213343|ref|ZP_02239378.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401657|ref|ZP_02307151.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167422829|ref|ZP_02314582.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425463|ref|ZP_02317216.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167468116|ref|ZP_02332820.1| ATP synthase F1, epsilon subunit [Yersinia pestis FV-1]
 gi|170026431|ref|YP_001722936.1| F0F1 ATP synthase subunit epsilon [Yersinia pseudotuberculosis
           YPIII]
 gi|186897469|ref|YP_001874581.1| F0F1 ATP synthase subunit epsilon [Yersinia pseudotuberculosis
           PB1/+]
 gi|218931096|ref|YP_002348971.1| F0F1 ATP synthase subunit epsilon [Yersinia pestis CO92]
 gi|229839829|ref|ZP_04459988.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229841914|ref|ZP_04462070.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229896791|ref|ZP_04511954.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis Pestoides A]
 gi|229904680|ref|ZP_04519791.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis Nepal516]
 gi|270488390|ref|ZP_06205464.1| ATP synthase F1, epsilon subunit [Yersinia pestis KIM D27]
 gi|284987828|ref|YP_072441.2| F0F1 ATP synthase subunit epsilon [Yersinia pseudotuberculosis IP
           32953]
 gi|284988146|ref|YP_001165229.2| F0F1 ATP synthase subunit epsilon [Yersinia pestis Pestoides F]
 gi|284988375|ref|YP_649904.2| F0F1 ATP synthase subunit epsilon [Yersinia pestis Nepal516]
 gi|284988610|ref|YP_654071.2| F0F1 ATP synthase subunit epsilon [Yersinia pestis Antiqua]
 gi|294505643|ref|YP_003569705.1| ATP synthase subunit epsilon [Yersinia pestis Z176003]
 gi|20137294|sp|P58647|ATPE_YERPE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166990388|sp|A7FPD9|ATPE_YERP3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740306|sp|B2K848|ATPE_YERPB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740307|sp|A9R5T8|ATPE_YERPG RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740308|sp|B1JRN3|ATPE_YERPY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|21961150|gb|AAM87676.1|AE014015_1 membrane-bound ATP synthase, F1 sector, epsilon-subunit [Yersinia
           pestis KIM 10]
 gi|45438620|gb|AAS64166.1| ATP synthase epsilon subunit protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|115349707|emb|CAL22688.1| ATP synthase epsilon subunit protein [Yersinia pestis CO92]
 gi|149290354|gb|EDM40431.1| ATP synthase epsilon subunit protein [Yersinia pestis CA88-4125]
 gi|152960221|gb|ABS47682.1| ATP synthase F1, epsilon subunit [Yersinia pseudotuberculosis IP
           31758]
 gi|162353524|gb|ABX87472.1| ATP synthase F1, epsilon subunit [Yersinia pestis Angola]
 gi|165912088|gb|EDR30728.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922072|gb|EDR39249.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991430|gb|EDR43731.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166205641|gb|EDR50121.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166958221|gb|EDR55242.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049039|gb|EDR60447.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167055477|gb|EDR65270.1| ATP synthase F1, epsilon subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169752965|gb|ACA70483.1| ATP synthase F1, epsilon subunit [Yersinia pseudotuberculosis
           YPIII]
 gi|186700495|gb|ACC91124.1| ATP synthase F1, epsilon subunit [Yersinia pseudotuberculosis
           PB1/+]
 gi|229678798|gb|EEO74903.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis Nepal516]
 gi|229691253|gb|EEO83306.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229696195|gb|EEO86242.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229700229|gb|EEO88265.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis Pestoides A]
 gi|262363808|gb|ACY60529.1| ATP synthase subunit epsilon [Yersinia pestis D106004]
 gi|262367744|gb|ACY64301.1| ATP synthase subunit epsilon [Yersinia pestis D182038]
 gi|270336894|gb|EFA47671.1| ATP synthase F1, epsilon subunit [Yersinia pestis KIM D27]
 gi|294356102|gb|ADE66443.1| ATP synthase subunit epsilon [Yersinia pestis Z176003]
 gi|320017454|gb|ADW01026.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 140

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 7   HLDVVSAEKKMFSGVVQKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGEEEFIYL 66

Query: 68  IGGICDIVPSHCTVLSETI---LPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ PS   VL++T    L +D A  +ALE +        N+  DVD      +L 
Sbjct: 67  SGGILEVQPSVVIVLADTAIRGLDLDEA--RALESKRKAEAHINNSHGDVDYAQASAELA 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|255261607|ref|ZP_05340949.1| ATP synthase F1, epsilon subunit [Thalassiobium sp. R2A62]
 gi|255103942|gb|EET46616.1| ATP synthase F1, epsilon subunit [Thalassiobium sp. R2A62]
          Length = 144

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + + F LVSPE+ + S EV  V +P   GD+T +  HAPV+TT++ G++ + +     
Sbjct: 1  MADTMQFSLVSPERALASLEVTEVQIPGADGDMTAMPNHAPVITTLRPGVLRV-VHAGGT 59

Query: 63 HRYVVIGGICDIVPSHCTVLSETILP 88
            Y+V GG  ++     +VL+E  LP
Sbjct: 60 DEYIVSGGFAEMSSEGLSVLAEQALP 85


>gi|257095875|ref|YP_003169516.1| F0F1 ATP synthase subunit epsilon [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048399|gb|ACV37587.1| ATP synthase F1, epsilon subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 140

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 60/108 (55%), Gaps = 4/108 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG+    V P E G++ +   H P+LT IK G + + +   E +  V
Sbjct: 5   VHVDVVSAEELIFSGQTDFAVFPGEAGELGIYPRHTPLLTRIKPGTIRLKIPDREEYELV 64

Query: 67  VI-GGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNN 110
            + GG+ ++ P+  TVL++T +    +D A     ++R +E   D ++
Sbjct: 65  YVSGGMLEVQPALITVLADTAIRAHDLDEAKAMEAKRRAEEALRDRSS 112


>gi|300313645|ref|YP_003777737.1| F0F1-type ATP synthase subunit epsilon [Herbaspirillum
          seropedicae SmR1]
 gi|124483596|emb|CAM32671.1| F0F1-type ATP synthase, epsilon subunit (mitochondrial delta
          subunit) protein [Herbaspirillum seropedicae]
 gi|300076430|gb|ADJ65829.1| F0F1-type ATP synthase, epsilon subunit protein [Herbaspirillum
          seropedicae SmR1]
          Length = 140

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + +H ++VS E+ +FSGE + V LP E G++ +   H P++T IK G V I +  +  
Sbjct: 1  MAHTIHVDVVSAEEEIFSGEAEFVALPGEAGELGIYPRHTPLITRIKPGAVRIKVPGQAH 60

Query: 63 HRYV-VIGGICDIVPSHCTVLSETIL 87
            +V V GG+ ++ P   TVL++T +
Sbjct: 61 EEFVFVAGGLLEVQPDAVTVLADTAI 86


>gi|270158438|ref|ZP_06187095.1| ATP synthase F1 subunit epsilon [Legionella longbeachae D-4968]
 gi|289166723|ref|YP_003456861.1| H+-transporting ATP synthase epsilon chain [Legionella
          longbeachae NSW150]
 gi|269990463|gb|EEZ96717.1| ATP synthase F1 subunit epsilon [Legionella longbeachae D-4968]
 gi|288859896|emb|CBJ13882.1| putative H+-transporting ATP synthase epsilon chain [Legionella
          longbeachae NSW150]
          Length = 140

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 49/79 (62%)

Query: 8  HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
          H ++VS E  +FSG V+ +V   ELG+I +  GHAP+LT +K G V I+L       Y V
Sbjct: 6  HLDIVSAEHEIFSGVVEMIVATGELGEIGITAGHAPLLTVLKPGEVRITLPGGNQEIYYV 65

Query: 68 IGGICDIVPSHCTVLSETI 86
           GG+ +I  ++ TVL++ +
Sbjct: 66 QGGMLEIQSNYVTVLADEV 84


>gi|60389534|sp|Q663Q9|ATPE_YERPS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119367811|sp|Q1C096|ATPE_YERPA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119367812|sp|Q1CCH6|ATPE_YERPN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166990389|sp|A4TSJ4|ATPE_YERPP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|51591532|emb|CAH23204.1| ATP synthase epsilon subunit protein [Yersinia pseudotuberculosis
           IP 32953]
 gi|108777785|gb|ABG20304.1| ATP synthase epsilon subunit protein [Yersinia pestis Nepal516]
 gi|108782068|gb|ABG16126.1| ATP synthase epsilon subunit protein [Yersinia pestis Antiqua]
 gi|145212849|gb|ABP42256.1| ATP synthase epsilon subunit protein [Yersinia pestis Pestoides F]
          Length = 137

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 4   HLDVVSAEKKMFSGVVQKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGEEEFIYL 63

Query: 68  IGGICDIVPSHCTVLSETI---LPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ PS   VL++T    L +D A  +ALE +        N+  DVD      +L 
Sbjct: 64  SGGILEVQPSVVIVLADTAIRGLDLDEA--RALESKRKAEAHINNSHGDVDYAQASAELA 121

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 122 KAIAKLR 128


>gi|50123427|ref|YP_052594.1| F0F1 ATP synthase subunit epsilon [Pectobacterium atrosepticum
           SCRI1043]
 gi|261823739|ref|YP_003261845.1| F0F1 ATP synthase subunit epsilon [Pectobacterium wasabiae WPP163]
 gi|60389563|sp|Q6CYJ6|ATPE_ERWCT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|49613953|emb|CAG77406.1| ATP synthase epsilon chain [Pectobacterium atrosepticum SCRI1043]
 gi|261607752|gb|ACX90238.1| ATP synthase F1, epsilon subunit [Pectobacterium wasabiae WPP163]
          Length = 139

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 68/128 (53%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 6   HLDVVSAEQQMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGEEEYIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P+  TVLS+T +    +D A  L+A  K  D +    N+  DVD      +L
Sbjct: 66  SGGVLEVQPNMVTVLSDTAIRGQDLDEARALEAKRKAEDHIR---NSHGDVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 TKAIAKLR 130


>gi|77462851|ref|YP_352355.1| F0F1 ATP synthase subunit epsilon [Rhodobacter sphaeroides 2.4.1]
 gi|119361399|sp|Q3J430|ATPE1_RHOS4 RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
           synthase F1 sector epsilon subunit 1; AltName:
           Full=F-ATPase epsilon subunit 1
 gi|77387269|gb|ABA78454.1| ATP synthase, delta/epsilon subunit [Rhodobacter sphaeroides 2.4.1]
          Length = 132

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 67/129 (51%), Gaps = 2/129 (1%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L F++VSPE+ + S     V +P   GD+T + GHAP +TT++ GI+  +     +
Sbjct: 1   MAGTLQFDIVSPERRLASFAATEVQVPGTDGDMTAMEGHAPTITTLRPGILR-AHGPSGV 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             Y V GG  +I  +  +VL+E  + ++      L++ I E   +L ++   + R   E+
Sbjct: 60  QAYAVTGGFAEINATSISVLAEKAVAVEELTGTVLDEFIAE-ARELASVALPEDRDMAER 118

Query: 123 LLVDLSCLR 131
            L D+  L+
Sbjct: 119 TLNDMLALK 127


>gi|239817828|ref|YP_002946738.1| F0F1 ATP synthase subunit epsilon [Variovorax paradoxus S110]
 gi|239804405|gb|ACS21472.1| ATP synthase F1, epsilon subunit [Variovorax paradoxus S110]
          Length = 139

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   +H ++VS E+ +FSGE + V LP E G++ +   H P++T I+ G V I  +    
Sbjct: 1  MAGTIHVDVVSAEESIFSGEAKFVALPGEAGELGIYPRHTPLITRIRPGAVRIETADGGE 60

Query: 63 HRYVVIGGICDIVPSHCTVLSETIL 87
              V GGI ++ P+  TVLS+T +
Sbjct: 61 EFVFVAGGILEVQPNAVTVLSDTAI 85


>gi|157368258|ref|YP_001476247.1| F0F1 ATP synthase subunit epsilon [Serratia proteamaculans 568]
 gi|270264095|ref|ZP_06192362.1| ATP synthase F1, epsilon subunit [Serratia odorifera 4Rx13]
 gi|259585491|sp|A8G7M9|ATPE_SERP5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|157320022|gb|ABV39119.1| ATP synthase F1, epsilon subunit [Serratia proteamaculans 568]
 gi|270041744|gb|EFA14841.1| ATP synthase F1, epsilon subunit [Serratia odorifera 4Rx13]
          Length = 139

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 6   HLDVVSAEKHMFSGLVQKIQVTGSEGELGIFPGHAPLLTAIKPGMVRIVKQHGEEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ PS  TVL++T +    +D A  L+A  K  + + S      DVD      +L
Sbjct: 66  SGGILEVQPSVVTVLADTAIRGTDLDEARALEAKRKAEEHISSSHG---DVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|323144390|ref|ZP_08078998.1| ATP synthase F1, epsilon subunit [Succinatimonas hippei YIT 12066]
 gi|322415843|gb|EFY06569.1| ATP synthase F1, epsilon subunit [Succinatimonas hippei YIT 12066]
          Length = 142

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 73/136 (53%), Gaps = 9/136 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS    ++SG V+++ +    G++ +  GHAP+LTTIK+G+V ++ +  +  ++ 
Sbjct: 6   FHLDVVSAVGSLYSGRVRTMRITGSEGEMGIRHGHAPLLTTIKAGMVLLTTAEGKEDQFY 65

Query: 67  VIGGICDIVPSHCTVLSETILPMDN---ACLQALEKRIDEVCSDLNNICDVDQRF----- 118
           + GG+ ++ P   TVL++T L  D+   A  +   +   E     +   D ++ F     
Sbjct: 66  LAGGLLEVQPDSVTVLADTALRADDIDEAKAKEAMREAQEAIKHQSGDKDYNKAFAQLAE 125

Query: 119 QMEQL-LVDLSCLRRR 133
            M QL +++LS   RR
Sbjct: 126 AMAQLKVIELSRSTRR 141


>gi|322835103|ref|YP_004215130.1| ATP synthase F1 subunit epsilon [Rahnella sp. Y9602]
 gi|321170304|gb|ADW76003.1| ATP synthase F1, epsilon subunit [Rahnella sp. Y9602]
          Length = 140

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +F+G VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 7   HLDVVSAEKRMFTGMVQKIQVTGSEGELGIFPGHAPLLTAIKPGMVRIVKEHGEEEYIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P+  TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 67  SGGILEVQPNATTVLADTAIRGQDLDEARALEAKRKAEEHISGSHG--DVDYAQASAELA 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|74317760|ref|YP_315500.1| H+-transporting two-sector ATPase, delta/subunit epsilon
           [Thiobacillus denitrificans ATCC 25259]
 gi|119361400|sp|Q3SI38|ATPE1_THIDA RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
           synthase F1 sector epsilon subunit 1; AltName:
           Full=F-ATPase epsilon subunit 1
 gi|74057255|gb|AAZ97695.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Thiobacillus denitrificans ATCC 25259]
          Length = 141

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 70/136 (51%), Gaps = 10/136 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E  +FSG V+SVV P+E+G + +  GHAP+LT +K G V + +  +     V
Sbjct: 5   MRLDVVSVEGSLFSGIVESVVAPAEMGAVGIYPGHAPLLTRLKPGAVRLRIPYQAEEEIV 64

Query: 67  VI-GGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQME- 121
            + GG+ ++ P   T+L++  +    +  A L A + R + V  D     D   R ++E 
Sbjct: 65  YVSGGMLEVQPYKVTLLADVAMREKALAEADLHAEKHRAEAVLKD-RVTADAYARLEVEL 123

Query: 122 ----QLLVDLSCLRRR 133
                 +  +  LRRR
Sbjct: 124 AKALTYVQGVQKLRRR 139


>gi|307153842|ref|YP_003889226.1| ATP synthase F1 subunit epsilon [Cyanothece sp. PCC 7822]
 gi|306984070|gb|ADN15951.1| ATP synthase F1, epsilon subunit [Cyanothece sp. PCC 7822]
          Length = 138

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+  E Q V+LPS  G + +L GHAP+LT + +G+V +  S ++     
Sbjct: 3   LSVRIITPDKIVWDDEAQEVILPSTTGQLGILTGHAPLLTALNTGVVRVRPS-KDWQAIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V+GG  +I  +   +L        N   +A +K   E  S L+      +R ++ Q    
Sbjct: 62  VMGGFAEIENNEVKILVNAADVGVNIDKEAAQKEWSEAQSRLDEATRSGERQKIIQAEQA 121

Query: 127 LSCLRRRIQ 135
               R R Q
Sbjct: 122 WKRARARYQ 130


>gi|217968673|ref|YP_002353907.1| F0F1 ATP synthase subunit epsilon [Thauera sp. MZ1T]
 gi|217506000|gb|ACK53011.1| ATP synthase F1, epsilon subunit [Thauera sp. MZ1T]
          Length = 141

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 72/131 (54%), Gaps = 5/131 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-SLSCEEIHRY 65
           +H ++VS E+ +FSG  + V LP E G++ +L GH P++T IK G V + + +  E    
Sbjct: 5   VHVDIVSAEEQIFSGLAEFVALPGEAGELGILPGHMPLMTRIKPGAVRVRAQNATEEELI 64

Query: 66  VVIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ-RFQME 121
            V GG+ ++ P   TVL++T +    +D A     +++ +E  ++     D  + + ++ 
Sbjct: 65  FVAGGLLEVQPGLVTVLADTAIRGKDLDEAKALEAKRKAEETMANQTARLDYAKAQAELM 124

Query: 122 QLLVDLSCLRR 132
           + +  L+ ++R
Sbjct: 125 EAVAQLAAIQR 135


>gi|23015480|ref|ZP_00055255.1| COG0355: F0F1-type ATP synthase, epsilon subunit (mitochondrial
           delta subunit) [Magnetospirillum magnetotacticum MS-1]
          Length = 133

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 59/123 (47%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   + FELVSP K + S +V  VV+P   GD   L  HAP++TT++ G++ I    +  
Sbjct: 1   MAEKIQFELVSPAKLLVSSKVDMVVVPGSEGDFGALALHAPMITTVRPGVIDIHDGGKVS 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
               V GG  ++     TVL+E  +P+     +  E R       L++     ++    +
Sbjct: 61  SSIFVAGGFAEVNEERITVLAEEAIPVAELTAELAEARKKAAKDALDDAKSEREKASASR 120

Query: 123 LLV 125
           L++
Sbjct: 121 LML 123


>gi|307294135|ref|ZP_07573979.1| ATPase, F1 complex, delta/epsilon subunit-like protein
          [Sphingobium chlorophenolicum L-1]
 gi|306880286|gb|EFN11503.1| ATPase, F1 complex, delta/epsilon subunit-like protein
          [Sphingobium chlorophenolicum L-1]
          Length = 84

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LHFELV+PEK V S EV  VV+P   GD  VL GHAP ++T++ G + I  S       +
Sbjct: 3  LHFELVTPEKLVRSEEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGAIQIFASAGSAPEVI 62

Query: 67 -VIGGICDIVPSHCTVLSE 84
           V GG  ++     TVL+E
Sbjct: 63 PVRGGFAEVNEKGLTVLAE 81


>gi|152998456|ref|YP_001343291.1| ATP synthase F1 subunit epsilon [Marinomonas sp. MWYL1]
 gi|189081368|sp|A6W3S7|ATPE_MARMS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|150839380|gb|ABR73356.1| ATP synthase F1, epsilon subunit [Marinomonas sp. MWYL1]
          Length = 139

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 7/129 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG VQS+V     GD+ ++ GHAP+LTT+++G V +     +     
Sbjct: 5   VHCDIVSAEQEIFSGTVQSLVAAGSYGDLGIMPGHAPLLTTLQAGPVRVVKENGDEEVIF 64

Query: 67  VIGGICDIVPSHCTVLSETILPM----DNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           V GG  ++ P   TVL+ T        + A L+A E   + +    N   DVD      +
Sbjct: 65  VSGGFLEVQPHRVTVLANTATRARDLDEEAALKAQEHAKELLA---NQKPDVDYTRATAE 121

Query: 123 LLVDLSCLR 131
           L+  ++ LR
Sbjct: 122 LVEAMARLR 130


>gi|90413755|ref|ZP_01221743.1| ATP synthase subunit epsilon [Photobacterium profundum 3TCK]
 gi|90325224|gb|EAS41721.1| ATP synthase subunit epsilon [Photobacterium profundum 3TCK]
          Length = 140

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG  Q+V +    G++ +  GH P+LT I  G+V I+   +E     
Sbjct: 6   FHLDVVSAEKKLFSGRAQNVQVTGSEGELGIHAGHTPLLTAITPGMVRITKQNDEEEVIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           + GG+ ++ PS  TVL++T +    +D A  +  +++ +E   + +   D  Q
Sbjct: 66  LSGGMLEVQPSTVTVLADTAIRGEDLDAAKAEEAKRQAEERIHNQHGDIDFAQ 118


>gi|254454901|ref|ZP_05068338.1| ATP synthase F1, epsilon subunit [Octadecabacter antarcticus 238]
 gi|198269307|gb|EDY93577.1| ATP synthase F1, epsilon subunit [Octadecabacter antarcticus 238]
          Length = 134

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + +   F+LVSPE+ +   +   V +P   GD+T +  H+P +TT++ GI+ ++ S   +
Sbjct: 1  MADAFTFDLVSPERRLAQMDATEVQIPGADGDMTAMAHHSPTITTLRPGILAVTHSG-GV 59

Query: 63 HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEK 99
            YVV GG  +I  +  +VL+E   P   A  + ++K
Sbjct: 60 AEYVVSGGFAEITATGVSVLAEKAFPRGEAKREHMDK 96


>gi|330812734|ref|YP_004357196.1| ATP synthase subunit epsilon [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380842|gb|AEA72192.1| putative ATP synthase, epsilon chain [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 139

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 61/110 (55%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ V+   ELGD+ + +GHAP++T +K G + +     E   Y 
Sbjct: 3   VHCDIVSAEGEIFSGLVEMVIAHGELGDLGIALGHAPLITNLKPGPIRLIKQGGEAEVYY 62

Query: 67  VIGGICDIVPSHCTVLSETI---LPMDNACLQ----ALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A  Q    A EK + E  ++ +
Sbjct: 63  ISGGFLEVQPNMVKVLADTVQRAADLDEASAQEAVKAAEKALHERGAEFD 112


>gi|254418464|ref|ZP_05032188.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain
          [Brevundimonas sp. BAL3]
 gi|196184641|gb|EDX79617.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain
          [Brevundimonas sp. BAL3]
          Length = 89

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   L F LVSPE+ VFSG V  V  P   GD  VL  HAP +T ++ G+VT+ +     
Sbjct: 1  MAGKLSFSLVSPEREVFSGLVDQVDAPGVEGDFGVLPDHAPFMTALREGLVTVYVGAART 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
           +Y V GG  D+     T+L+E
Sbjct: 61 -QYDVKGGFADVNGEGLTILAE 81


>gi|238783023|ref|ZP_04627050.1| ATP synthase epsilon chain [Yersinia bercovieri ATCC 43970]
 gi|238797872|ref|ZP_04641364.1| ATP synthase epsilon chain [Yersinia mollaretii ATCC 43969]
 gi|238716024|gb|EEQ08009.1| ATP synthase epsilon chain [Yersinia bercovieri ATCC 43970]
 gi|238718288|gb|EEQ10112.1| ATP synthase epsilon chain [Yersinia mollaretii ATCC 43969]
          Length = 140

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 64/125 (51%), Gaps = 1/125 (0%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 7   HLDVVSAEKKMFSGVVQKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGEEEFIYL 66

Query: 68  IGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
            GGI ++ PS   VL++T I   D    +ALE +        N+  DVD      +L   
Sbjct: 67  SGGILEVQPSVVIVLADTAIRGQDLDEAKALESKRKAEAHINNSHGDVDYAQASAELAKA 126

Query: 127 LSCLR 131
           ++ LR
Sbjct: 127 IAKLR 131


>gi|153870903|ref|ZP_02000203.1| ATPase, delta/epsilon subunit [Beggiatoa sp. PS]
 gi|152072633|gb|EDN69799.1| ATPase, delta/epsilon subunit [Beggiatoa sp. PS]
          Length = 140

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +F+G  + V+ P+  G++ +L  HAP +T +  G V + L+  +   + 
Sbjct: 5   VHVDIVSAEAEIFAGLAEMVIAPAVQGEVGILPRHAPYITQLSEGAVRLKLNENDEESFY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSD 107
           + GG+ ++ P   TVLS+T L    +D       +KR +++ SD
Sbjct: 65  ISGGMLEVQPHKVTVLSDTALRAHDLDEKAAVEAKKRAEQLLSD 108


>gi|82701445|ref|YP_411011.1| F0F1 ATP synthase subunit epsilon [Nitrosospira multiformis ATCC
           25196]
 gi|119367750|sp|Q2YCA2|ATPE_NITMU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|82409510|gb|ABB73619.1| ATP synthase F1 subcomplex epsilon subunit [Nitrosospira
           multiformis ATCC 25196]
          Length = 139

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (48%), Gaps = 9/135 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ ++SG  + +V P+E G++ +   H P+LT IK G V I    +E     
Sbjct: 4   FHVDIVSAEESIYSGPAEFLVAPAEGGEVGIYPQHTPMLTRIKPGSVRIKAPLKEEELVY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQME-- 121
           V GG+ +I P   T+L++T +    +D A     +K  +E   D  +  D   R Q E  
Sbjct: 64  VSGGMLEIQPDIVTILADTAVRGADLDEAKAIEAKKHAEEAVRDRASTLDY-ARAQAELS 122

Query: 122 ---QLLVDLSCLRRR 133
                L  +  LR+R
Sbjct: 123 EAIAQLAAIQKLRKR 137


>gi|152990963|ref|YP_001356685.1| F0F1 ATP synthase subunit epsilon [Nitratiruptor sp. SB155-2]
 gi|166222479|sp|A6Q4B9|ATPE_NITSB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|151422824|dbj|BAF70328.1| F0F1-type ATP synthase, epsilon subunit [Nitratiruptor sp. SB155-2]
          Length = 129

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 55/101 (54%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           ++ L  E+V+PE  +F G+V+SV  P E G+  VL  HA +L+ +K G++ I L   +  
Sbjct: 1   MDTLKLEIVTPEGLIFQGDVKSVTFPGEEGEFGVLPKHASLLSLLKPGVIEIELPDGKKE 60

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV 104
             V+  G  ++  +  T L E  +P++      + K+I+E 
Sbjct: 61  SIVINWGHVNVSENQATALVEGAVPLEGTTESEIAKKIEEA 101


>gi|194335227|ref|YP_002017021.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Pelodictyon phaeoclathratiforme BU-1]
 gi|194307704|gb|ACF42404.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Pelodictyon phaeoclathratiforme BU-1]
          Length = 88

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           H E+V+P K  FSGE+ SV  P ELG   VL  HAP+L+++  G V ++L+      + 
Sbjct: 8  FHIEIVTPLKLHFSGEIVSVTAPGELGQFQVLKNHAPLLSSLTKGTVKLALADRSEQSFS 67

Query: 67 VIGGICDIVPSHCTVLSETI 86
          ++ G  ++  +   +L+ETI
Sbjct: 68 ILDGFFEVSSNKAILLTETI 87


>gi|239993103|ref|ZP_04713627.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
          [Alteromonas macleodii ATCC 27126]
          Length = 137

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 56/93 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS EK +FSG V+++ +    G++ +  GHAP+++ IK G+V +     E     
Sbjct: 5  VHLDVVSAEKAIFSGRVEAIQVTGSEGELGIHPGHAPLISAIKPGMVRLVKQHGEEEVIY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDNACLQALEK 99
          V GG+ ++ P + TVL++T +  ++   QA E+
Sbjct: 65 VAGGVLEVQPGNVTVLADTAVRAEDLDEQAAEE 97


>gi|56477134|ref|YP_158723.1| F0F1 ATP synthase subunit epsilon [Aromatoleum aromaticum EbN1]
 gi|81677477|sp|Q5P4E1|ATPE_AZOSE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|56313177|emb|CAI07822.1| F1-ATP synthase, epsilon subunit [Aromatoleum aromaticum EbN1]
          Length = 141

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 3/100 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG  + V LP E G++ +L GH P++T IK G V +    +     V
Sbjct: 5   VHVDIVSAEEQIFSGLAEFVALPGEAGELGILPGHMPLMTRIKPGAVRVKRPDQAEEELV 64

Query: 67  -VIGGICDIVPSHCTVLSET-ILPMDNACLQALE-KRIDE 103
            V GGI ++ P   TVL++T I   D    +ALE KRI E
Sbjct: 65  FVAGGILEVQPGLVTVLADTAIRGKDLDEAKALEAKRIAE 104


>gi|83854831|ref|ZP_00948361.1| ATP synthase F1, epsilon subunit [Sulfitobacter sp. NAS-14.1]
 gi|83941354|ref|ZP_00953816.1| ATP synthase F1, epsilon subunit [Sulfitobacter sp. EE-36]
 gi|83842674|gb|EAP81841.1| ATP synthase F1, epsilon subunit [Sulfitobacter sp. NAS-14.1]
 gi|83847174|gb|EAP85049.1| ATP synthase F1, epsilon subunit [Sulfitobacter sp. EE-36]
          Length = 145

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S +V +V +P   GD+T +  HAP +TT++ G++ +    E  
Sbjct: 1   MADTMQFDLVSPERRLASMQVTAVQIPGADGDMTAMPDHAPTITTLRPGVLRVE-GPEGT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCS 106
             YVV GG  +I     +VL+E  +   +   + L++ I E  +
Sbjct: 60  AEYVVTGGFAEISSEGVSVLAERAVSKGDMTQEHLDEMIAEAKA 103


>gi|163803595|ref|ZP_02197461.1| F0F1 ATP synthase subunit epsilon [Vibrio sp. AND4]
 gi|159172589|gb|EDP57447.1| F0F1 ATP synthase subunit epsilon [Vibrio sp. AND4]
          Length = 140

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG V++  +    G++ +  GH P+L+ IK G+V I           
Sbjct: 6   FHLDVVSAEKSIFSGRVETFQVTGSEGELGIFHGHTPLLSAIKPGMVRIVKQHGHEEFIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           V GG+ ++ P   TVL++T +    +D A  +  ++R +E   + +   D  Q
Sbjct: 66  VSGGMVEVQPGTATVLADTAIRGEDLDAAKAEEAKRRAEEKIQNQHGDMDFAQ 118


>gi|149925409|ref|ZP_01913673.1| ATP synthase subunit epsilon [Limnobacter sp. MED105]
 gi|149825526|gb|EDM84734.1| ATP synthase subunit epsilon [Limnobacter sp. MED105]
          Length = 147

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 73/139 (52%), Gaps = 10/139 (7%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           MS+ + +  ++VS E+ +F GE + V LP E G++ +   H P++T IK G V I ++ +
Sbjct: 7   MSM-STIRVDVVSAEESIFEGEAEFVALPGEQGELGIYPRHTPLITRIKPGTVRIKIAGQ 65

Query: 61  EIHRYVVI-GGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVD- 115
                V + GG+ ++ P+  TVL++T L    +D A     ++  +E  +  N   D+D 
Sbjct: 66  AEEEVVFVNGGVLEVQPNSVTVLADTALRGSDLDEAKATEAKRLAEEALA--NRSADIDY 123

Query: 116 --QRFQMEQLLVDLSCLRR 132
              + ++   +  L  ++R
Sbjct: 124 AQAQAELASAIAQLQAIKR 142


>gi|255321980|ref|ZP_05363130.1| ATP synthase F1, epsilon subunit [Campylobacter showae RM3277]
 gi|255301084|gb|EET80351.1| ATP synthase F1, epsilon subunit [Campylobacter showae RM3277]
          Length = 129

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 2/82 (2%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N LH E+V+PE  VFS +++SVVLP   G+  VL GHA +++ +K+G++ I  S ++ H
Sbjct: 1  MNKLHLEIVTPEGLVFSNDIKSVVLPGSEGEFGVLPGHASLISLLKAGVIDIE-SEDKSH 59

Query: 64 RYVVIG-GICDIVPSHCTVLSE 84
            V I  G  +I     T+L++
Sbjct: 60 DAVAINWGYAEINEGKATILAD 81


>gi|319778926|ref|YP_004129839.1| ATP synthase epsilon chain [Taylorella equigenitalis MCE9]
 gi|317108950|gb|ADU91696.1| ATP synthase epsilon chain [Taylorella equigenitalis MCE9]
          Length = 142

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++VS E+ +FSG    VVLP   G+I VL GH P+++ IK G V I+          
Sbjct: 6   LKVDVVSAEESMFSGTASMVVLPGVTGEIGVLPGHTPLISRIKPGRVKITREDGSEETLF 65

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQ-ALEKR 100
           V GG+ ++ P   TVL++T++ M++   Q ALE R
Sbjct: 66  VAGGLLEVQPFAVTVLADTVVRMEDLDEQKALEAR 100


>gi|149071997|ref|YP_001293560.1| ATP synthase subunit E [Rhodomonas salina]
 gi|134302948|gb|ABO70752.1| ATP synthase subunit E [Rhodomonas salina]
          Length = 131

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 62/129 (48%), Gaps = 4/129 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH  +++P++ V+    + V+LPS  G + +L GHAP+LT +  G++ + +  ++    V
Sbjct: 3   LHINIIAPDRTVWDANAEEVILPSSTGQLGILRGHAPLLTALDIGVMRVRIE-KDWTPIV 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  ++     T+L               EK ++E+    N      +R Q  Q   +
Sbjct: 62  LMGGFAEVENDELTILVNGAEEGSKINKDEAEKELEEMTMRFNEATSSKERIQATQ---N 118

Query: 127 LSCLRRRIQ 135
           L   R R+Q
Sbjct: 119 LRKARARVQ 127


>gi|325921270|ref|ZP_08183130.1| ATP synthase F1 subcomplex epsilon subunit [Xanthomonas gardneri
           ATCC 19865]
 gi|325548237|gb|EGD19231.1| ATP synthase F1 subcomplex epsilon subunit [Xanthomonas gardneri
           ATCC 19865]
          Length = 140

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 70/127 (55%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS EK +F GE   VV   ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTASGEQLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           GI ++ P   TVL +T +    +D A ++ +++  + + ++  +  DV + + ++ +  V
Sbjct: 67  GILEVQPQVVTVLVDTAVRAQDIDEAAVRKVKEEAERLLANRGDAVDVAEAQRRLAEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|291615435|ref|YP_003525592.1| ATP synthase F1, subunit epsilon [Sideroxydans lithotrophicus ES-1]
 gi|291585547|gb|ADE13205.1| ATP synthase F1, epsilon subunit [Sideroxydans lithotrophicus ES-1]
          Length = 141

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 8/111 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG  + VV+P E+G++ +  GH  ++T IK G V I    +E    +
Sbjct: 5   VHVDVVSAEEQIFSGVAEVVVVPGEMGELGIYPGHTALMTRIKPGAVRIKRPDQEQEELI 64

Query: 67  VI-GGICDIVPSHCTVLSETIL---PMDNA----CLQALEKRIDEVCSDLN 109
            + GG+ ++ PS  TVL++T +    +D A      QA E+ I    SD++
Sbjct: 65  YVSGGMLEVQPSVVTVLADTAIRGHDLDEARALEAKQAAEEAIKNRTSDID 115


>gi|227113922|ref|ZP_03827578.1| F0F1 ATP synthase subunit epsilon [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227327855|ref|ZP_03831879.1| F0F1 ATP synthase subunit epsilon [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 139

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 68/128 (53%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 6   HLDVVSAEQQMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGEEEYIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P+  TVLS+T +    +D A  L+A  K  D +    N+  DVD      +L
Sbjct: 66  SGGVLEVQPNIVTVLSDTAIRGQDLDEARALEAKRKAEDHIR---NSHGDVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 TKAIAKLR 130


>gi|332533719|ref|ZP_08409578.1| ATP synthase epsilon chain [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036883|gb|EGI73344.1| ATP synthase epsilon chain [Pseudoalteromonas haloplanktis ANT/505]
          Length = 140

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 63/113 (55%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG V+S+ +    G++ V +GHAP+LT +K G+V +           
Sbjct: 6   VHLDVVSAEQSLFSGLVESIQVSGSEGELGVNLGHAPLLTALKPGMVRLVKQYGHEDVLY 65

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQ 119
           V GG  ++ P+H T+L++T +  ++    +++K   E    + N   V+  +Q
Sbjct: 66  VAGGTLEVQPNHITILADTAVRGEDLDEDSVQKAKREAEEHMANSSAVEFDYQ 118


>gi|294012672|ref|YP_003546132.1| H+-transporting two-sector ATPase delta/epsilon subunit
          [Sphingobium japonicum UT26S]
 gi|292676002|dbj|BAI97520.1| H+-transporting two-sector ATPase delta/epsilon subunit
          [Sphingobium japonicum UT26S]
          Length = 84

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LHFELV+PEK V S EV  VV+P   GD  VL GHAP ++T++ G + +  S       +
Sbjct: 3  LHFELVTPEKLVRSEEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGAIQVFASAGAAPEVI 62

Query: 67 -VIGGICDIVPSHCTVLSE 84
           V GG  ++     TVL+E
Sbjct: 63 PVRGGFAEVNEKGLTVLAE 81


>gi|94495683|ref|ZP_01302263.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Sphingomonas sp. SKA58]
 gi|94425071|gb|EAT10092.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Sphingomonas sp. SKA58]
          Length = 84

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LHFELV+PEK V S EV  VV+P   GD  VL GHAP ++T++ G + I  S       +
Sbjct: 3  LHFELVTPEKLVRSVEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGAIQIFASAGAAPEVI 62

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG  ++     TVL+E
Sbjct: 63 PVEGGFAEVNEKGLTVLAE 81


>gi|300115591|ref|YP_003762166.1| ATP synthase F1 subunit epsilon [Nitrosococcus watsonii C-113]
 gi|299541528|gb|ADJ29845.1| ATP synthase F1, epsilon subunit [Nitrosococcus watsonii C-113]
          Length = 140

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 69/131 (52%), Gaps = 6/131 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG V  +  P+E+G++ ++  HAP++T +K G V +     +   + 
Sbjct: 5   MHVDIVSAEREIFSGTVNMLFAPAEMGEVGIMPRHAPLITRLKPGEVRLQRPEGQEDFFY 64

Query: 67  VIGGICDIVPSHCTVLSET---ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME-- 121
           V GG+ ++ P   TVL++T      +D A   A ++R +E   D     D   R Q E  
Sbjct: 65  VSGGLLEVQPHVVTVLADTAQRAADIDEAAALAAKQRAEEALQDQEGKMDY-ARAQAELA 123

Query: 122 QLLVDLSCLRR 132
           + +  L  ++R
Sbjct: 124 EAIAQLRAIQR 134


>gi|119947322|ref|YP_945002.1| ATP synthase F1, epsilon subunit [Psychromonas ingrahamii 37]
 gi|119865926|gb|ABM05403.1| ATP synthase F1, epsilon subunit [Psychromonas ingrahamii 37]
          Length = 139

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 68/134 (50%), Gaps = 5/134 (3%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           M+     H ++VS E+ +FSG V  + +  + G++ ++ GH P+LT IK G+V +     
Sbjct: 1   MTKAMTTHLDVVSAEESLFSGRVSHLQVSGQEGELGIMPGHTPLLTPIKPGMVKMVKQHG 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQR 117
           +   + + GG  ++ P   TVL++T +    +D A  +  ++   E  S+ N   D+D  
Sbjct: 61  DEEVFYISGGFLEVQPGGVTVLADTAIRGADLDKAKAEEAKRTAQEQISNPNQ--DIDYA 118

Query: 118 FQMEQLLVDLSCLR 131
               QL   ++ LR
Sbjct: 119 LVTAQLAQAIAQLR 132


>gi|77361903|ref|YP_341478.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Pseudoalteromonas haloplanktis TAC125]
 gi|119367761|sp|Q3IK29|ATPE_PSEHT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|76876814|emb|CAI88036.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 140

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 66/127 (51%), Gaps = 2/127 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG V+S+ +    G++ V  GHAP+LT +K G+V +     E     
Sbjct: 6   VHLDVVSAEQSLFSGRVESIQVTGSEGELGVNAGHAPLLTALKPGMVRLVKQFGEEEFIY 65

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALE--KRIDEVCSDLNNICDVDQRFQMEQLL 124
           + GG  ++ P+  TVL++T +  ++   QA E  KR  E         ++D      QL 
Sbjct: 66  IAGGTLEVQPNLVTVLADTAVRGEDLDEQAAEAAKRDAEAQMAKGASAELDYNQAAVQLA 125

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 126 EAIAQLR 132


>gi|289668362|ref|ZP_06489437.1| F0F1 ATP synthase subunit epsilon [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 140

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 69/127 (54%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS EK +F GE   VV   ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTANGEHLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           GI ++ P   T+L +T +    +D A ++ +++  +   ++  N  DV + + ++ +  V
Sbjct: 67  GILEVQPQVVTILVDTAVRAQDIDEAAVRKVKEEAERQLANRGNTVDVAEAQRRLAEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|312882262|ref|ZP_07742008.1| F0F1 ATP synthase subunit epsilon [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370106|gb|EFP97612.1| F0F1 ATP synthase subunit epsilon [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 140

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 7/115 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I      EEI  
Sbjct: 6   FHLDVVSAEKRIFSGLVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKQHGHEEI-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
             + GG+ ++ P   TVL++T +    +D A  +  ++R +E   + +   D  Q
Sbjct: 64  VYISGGMVEVQPGSATVLADTAIRAEELDAAKAEEAKRRAEEKIQNQHGDMDFAQ 118


>gi|71909724|ref|YP_287311.1| F0F1 ATP synthase subunit epsilon [Dechloromonas aromatica RCB]
 gi|119361425|sp|Q477Z0|ATPE_DECAR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|71849345|gb|AAZ48841.1| ATP synthase F1 subcomplex epsilon subunit [Dechloromonas aromatica
           RCB]
          Length = 141

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 61/111 (54%), Gaps = 4/111 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE-EIHRY 65
           +H ++VS E+ +FSG V+  V P E G++ +L  H P+LT IK G + + +  + E    
Sbjct: 5   VHCDVVSAEESIFSGLVEIAVFPGEAGELGILPRHTPLLTRIKPGTIRLKVPDQSEFELV 64

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICD 113
            V GG+ ++ P   TVL++T +    +D A     +KR +E  ++ N   D
Sbjct: 65  YVSGGMLEVQPDMITVLADTAIRAHDLDEAKALEAKKRAEEALANRNAEMD 115


>gi|21675044|ref|NP_663109.1| ATP synthase F1, epsilon subunit [Chlorobium tepidum TLS]
 gi|25452811|sp|Q8KAC8|ATPE_CHLTE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|21648280|gb|AAM73451.1| ATP synthase F1, epsilon subunit [Chlorobium tepidum TLS]
          Length = 88

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 46/77 (59%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          ++V+P+K  FSGE+ SV+ P   G   VL GHAP+L  +KSG V +SLS      + + G
Sbjct: 11 DIVTPQKLFFSGEINSVIAPGLNGLFQVLKGHAPLLAALKSGKVRLSLSDRSEDTFQIAG 70

Query: 70 GICDIVPSHCTVLSETI 86
          G  ++  +   +L+E +
Sbjct: 71 GFFEVSGNKAILLTEEV 87


>gi|293393690|ref|ZP_06637999.1| ATP synthase F1 sector epsilon subunit [Serratia odorifera DSM
           4582]
 gi|291423812|gb|EFE97032.1| ATP synthase F1 sector epsilon subunit [Serratia odorifera DSM
           4582]
          Length = 139

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 6   HLDVVSAEKQMFSGLVQKIQVTGSEGELGIFPGHAPLLTAIKPGMVRIVKQHGEEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETILP---MDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ PS  TVL++T +    +D A  L+A  K  + + S      DVD      +L
Sbjct: 66  SGGILEVQPSVVTVLADTAIRGTDLDEARALEAKRKAEEHIRSSHG---DVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|149190473|ref|ZP_01868744.1| F0F1 ATP synthase subunit epsilon [Vibrio shilonii AK1]
 gi|148835727|gb|EDL52693.1| F0F1 ATP synthase subunit epsilon [Vibrio shilonii AK1]
          Length = 140

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I           
Sbjct: 6   FHLDVVSAEKKLFSGRVETFQVSGSEGELGIFHGHTPLLTAIKPGMVRIVKQHGHEEFIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           V GGI ++ P   TVL++T +    +D A  +  +++ +E   + +   D  Q
Sbjct: 66  VSGGIVEVQPGTATVLADTAIRGEELDAAKAEEAKRKAEEHIQNQHGDMDFAQ 118


>gi|282896619|ref|ZP_06304634.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Raphidiopsis brookii D9]
 gi|281198489|gb|EFA73375.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Raphidiopsis brookii D9]
          Length = 137

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 59/130 (45%), Gaps = 2/130 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-SLSCEEIHRY 65
           L   +VSP+K V+ G    V+LPS  G + VL GHAP+LT +  G++ + +         
Sbjct: 3   LTIRVVSPDKTVWDGPADEVILPSTTGQLGVLSGHAPMLTALDIGVMRVRAEKNANWQSI 62

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLV 125
            ++GG  ++     T+L       D   L+      +   + LN +   D++ Q+ Q   
Sbjct: 63  ALLGGFAEVEEDEVTILVNGAQRGDTINLEEARSEFNAAQTKLNQVAGGDRQAQI-QATA 121

Query: 126 DLSCLRRRIQ 135
            L   R R Q
Sbjct: 122 ALKRARARFQ 131


>gi|238787861|ref|ZP_04631658.1| ATP synthase epsilon chain [Yersinia frederiksenii ATCC 33641]
 gi|238724204|gb|EEQ15847.1| ATP synthase epsilon chain [Yersinia frederiksenii ATCC 33641]
          Length = 140

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 7   HLDVVSAEKKMFSGVVQKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQFGEEEFIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ PS   VL++T +    +D A  +ALE +        N+  DVD      +L 
Sbjct: 67  SGGILEVQPSVVIVLADTAIRGTDLDEA--KALESKRKAEAHINNSHGDVDYAQASAELA 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|166713523|ref|ZP_02244730.1| F0F1 ATP synthase subunit epsilon [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 140

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 71/127 (55%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS EK +F GE   VV   ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTANGEHLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           GI ++ P   T+L +T +    ++ A ++ +++  +++ ++  N  DV + + ++ +  V
Sbjct: 67  GILEVQPQVVTILVDTAVRAQDIEEAAVRKVKEEAEQLLANRGNTVDVAEAQRRLTEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|91786239|ref|YP_547191.1| F0F1 ATP synthase subunit epsilon [Polaromonas sp. JS666]
 gi|119367755|sp|Q12GP9|ATPE_POLSJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|91695464|gb|ABE42293.1| ATP synthase F1 subcomplex epsilon subunit [Polaromonas sp.
          JS666]
          Length = 138

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 49/84 (58%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +FSGE + V LP E G++ +   H P++T IK G V I        
Sbjct: 1  MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRIKPGAVRIEKEDGTEE 60

Query: 64 RYVVIGGICDIVPSHCTVLSETIL 87
             V GG+ ++ P+  TVLS+T +
Sbjct: 61 FVFVAGGLLEVQPNCVTVLSDTAI 84


>gi|294678489|ref|YP_003579104.1| ATP synthase F1 subunit epsilon [Rhodobacter capsulatus SB 1003]
 gi|2493042|sp|P72248|ATPE_RHOCA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|1524325|emb|CAA67911.1| FoF1 ATP synthase [Rhodobacter capsulatus]
 gi|294477309|gb|ADE86697.1| ATP synthase F1, epsilon subunit [Rhodobacter capsulatus SB 1003]
          Length = 132

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + + F+LVSPE+ + S     V LP   GD+T + GHAPV+ +++ GI+T+ +S    
Sbjct: 1  MADTMQFDLVSPERRLASVAASEVRLPGVEGDLTAMPGHAPVILSLRPGILTV-VSAAGT 59

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
            Y V GG  ++     TVL+E
Sbjct: 60 AEYAVTGGFAEVSGEKVTVLAE 81


>gi|307547033|ref|YP_003899512.1| F0F1 ATP synthase subunit epsilon [Halomonas elongata DSM 2581]
 gi|307219057|emb|CBV44327.1| F0F1 ATP synthase subunit epsilon [Halomonas elongata DSM 2581]
          Length = 142

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+VS E  ++SGE + VV    +GD+ +L GH P+LT +  G V I     E   + V G
Sbjct: 8  EVVSAEASIYSGEAEQVVAAGRMGDLGILGGHTPLLTELAPGPVRIVRGGGEEDHFYVSG 67

Query: 70 GICDIVPSHCTVLSETILPMDN 91
          G  ++ P   TVL++T +  D+
Sbjct: 68 GFLEVQPDVVTVLADTAVRADD 89


>gi|15603360|ref|NP_246434.1| F0F1 ATP synthase subunit epsilon [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|20137463|sp|Q9CKW0|ATPE_PASMU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|12721879|gb|AAK03579.1| AtpC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 142

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 61/106 (57%), Gaps = 6/106 (5%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           MS+ N     +VS E+ +FSG+V+S+      G++ +L GH P+LT IK GIV ++L   
Sbjct: 1   MSVFN---LTVVSAEQQIFSGQVESIQATGIEGELGILAGHTPLLTAIKPGIVKLTLEDG 57

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDE 103
           +     V GG  ++ P+  TVL++T +    +D   + A +KR +E
Sbjct: 58  KEEVIYVSGGFLEVQPNVVTVLADTAIRGDELDGDRILAAKKRAEE 103


>gi|28899842|ref|NP_799447.1| F0F1 ATP synthase subunit epsilon [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153839886|ref|ZP_01992553.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus AQ3810]
 gi|260361992|ref|ZP_05774997.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus K5030]
 gi|260876521|ref|ZP_05888876.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus AN-5034]
 gi|260897422|ref|ZP_05905918.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus Peru-466]
 gi|260901307|ref|ZP_05909702.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus AQ4037]
 gi|31339962|sp|Q87KA9|ATPE_VIBPA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|28808094|dbj|BAC61331.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149746594|gb|EDM57582.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus AQ3810]
 gi|308087906|gb|EFO37601.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus Peru-466]
 gi|308090371|gb|EFO40066.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus AN-5034]
 gi|308109902|gb|EFO47442.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus AQ4037]
 gi|308114169|gb|EFO51709.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus K5030]
 gi|328471194|gb|EGF42096.1| F0F1 ATP synthase subunit epsilon [Vibrio parahaemolyticus 10329]
          Length = 140

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG V++  +    G++ +  GH P+L+ IK G+V I           
Sbjct: 6   FHLDVVSAEKRIFSGRVETFQVTGSEGELGIFHGHTPLLSAIKPGMVRIVKQHGHEEFIY 65

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ 116
           V GG+ ++ P   TVL++T +    +D A  +  ++R +E   + +   D  Q
Sbjct: 66  VSGGMVEVQPGTATVLADTAIRGEDLDAAKAEEAKRRAEEKIQNQHGDMDFAQ 118


>gi|320160784|ref|YP_004174008.1| ATP synthase epsilon chain [Anaerolinea thermophila UNI-1]
 gi|319994637|dbj|BAJ63408.1| ATP synthase epsilon chain [Anaerolinea thermophila UNI-1]
          Length = 138

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+VS ++ VF+ +V  V+LP   G + VL  H+PVLTT++ GI+ +    EE + + V G
Sbjct: 6  EIVSQDRVVFAEDVDMVILPGGGGQMGVLPNHSPVLTTLQYGIIHVKKQGEEYY-FTVAG 64

Query: 70 GICDIVPSHCTVLSETILPMDNACLQ 95
          G  ++ P   TVL++    ++   LQ
Sbjct: 65 GFAEVQPDQVTVLADAAENVEEINLQ 90


>gi|323493010|ref|ZP_08098146.1| F0F1 ATP synthase subunit epsilon [Vibrio brasiliensis LMG 20546]
 gi|323312746|gb|EGA65874.1| F0F1 ATP synthase subunit epsilon [Vibrio brasiliensis LMG 20546]
          Length = 140

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 7/115 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I      EEI  
Sbjct: 6   FHLDVVSAEKKIFSGLVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKQHGHEEI-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
             V GG+ ++ P   TVL++T +    +D A  +  ++R +E   + +   D  Q
Sbjct: 64  IYVSGGMVEVQPGTATVLADTAIRGEELDAAKAEEAKRRAEENIQNQHGDMDFAQ 118


>gi|121603173|ref|YP_980502.1| F0F1 ATP synthase subunit epsilon [Polaromonas naphthalenivorans
          CJ2]
 gi|166222481|sp|A1VIV3|ATPE_POLNA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|120592142|gb|ABM35581.1| ATP synthase F1 subcomplex epsilon subunit [Polaromonas
          naphthalenivorans CJ2]
          Length = 138

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 50/84 (59%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +FSGE + V LP E G++ +   H P++T I+ G V I  +     
Sbjct: 1  MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRIRPGAVRIEKADGTEE 60

Query: 64 RYVVIGGICDIVPSHCTVLSETIL 87
             V GG+ ++ P+  TVLS+T +
Sbjct: 61 FVFVAGGLLEVQPNCVTVLSDTAI 84


>gi|153834295|ref|ZP_01986962.1| ATP synthase F1, epsilon subunit [Vibrio harveyi HY01]
 gi|156972755|ref|YP_001443662.1| F0F1 ATP synthase subunit epsilon [Vibrio harveyi ATCC BAA-1116]
 gi|269962671|ref|ZP_06177016.1| ATP synthase subunit epsilon [Vibrio harveyi 1DA3]
 gi|148869303|gb|EDL68317.1| ATP synthase F1, epsilon subunit [Vibrio harveyi HY01]
 gi|156524349|gb|ABU69435.1| hypothetical protein VIBHAR_00420 [Vibrio harveyi ATCC BAA-1116]
 gi|269832594|gb|EEZ86708.1| ATP synthase subunit epsilon [Vibrio harveyi 1DA3]
          Length = 140

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG V++  +    G++ +  GH P+L+ IK G+V I           
Sbjct: 6   FHLDVVSAEKRIFSGRVETFQVTGSEGELGIFHGHTPLLSAIKPGMVRIVKQHGHEEFIY 65

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ 116
           V GG+ ++ P   TVL++T +    +D A  +  ++R +E   + +   D  Q
Sbjct: 66  VSGGMVEVQPGTATVLADTAIRGEDLDAAKAEEAKRRAEEQIQNQHGDMDFAQ 118


>gi|298385488|ref|ZP_06995046.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides sp. 1_1_14]
 gi|298261629|gb|EFI04495.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides sp. 1_1_14]
          Length = 82

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 46/72 (63%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          ++ +LH  +VSPEK VF GEV+ V LP  +G  ++L GHAP+++++K+G +  +    E 
Sbjct: 1  MMKELHLSIVSPEKSVFDGEVKIVTLPGTVGSFSILPGHAPIVSSLKAGTLGYTTMDGEE 60

Query: 63 HRYVVIGGICDI 74
          H   + GG  ++
Sbjct: 61 HTLDIQGGFVEM 72


>gi|221135160|ref|ZP_03561463.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Glaciecola
           sp. HTCC2999]
          Length = 137

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 73/132 (55%), Gaps = 9/132 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG V+++ +    G++ +  GHAP++T I+ G+V +  + +E   Y+
Sbjct: 6   VHLDVVSAEEAIFSGAVEAIQVTGSEGELGIHPGHAPLITNIRPGMVRLVQNGKEDFIYI 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQR---FQM 120
             GG  +I P   TVL++T +    +D +  +  +++ +E  +  N   D D      Q+
Sbjct: 66  A-GGTLEIQPHTVTVLADTAIRADDLDESTAEEAKRQAEESIA--NPGADFDHNAASIQL 122

Query: 121 EQLLVDLSCLRR 132
           E+ L  L  +++
Sbjct: 123 EEALAQLRLIQQ 134


>gi|104784433|ref|YP_610931.1| F0F1 ATP synthase subunit epsilon [Pseudomonas entomophila L48]
 gi|123255141|sp|Q1I2I8|ATPE_PSEE4 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|95113420|emb|CAK18148.1| ATP synthase F1, epsilon subunit [Pseudomonas entomophila L48]
          Length = 139

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 61/110 (55%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ VV    LGD+ +  GHAP++T +K G +T++    +   + 
Sbjct: 5   VHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGDREVFY 64

Query: 67  VIGGICDIVPSHCTVLSETI---LPMDNA----CLQALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A     L+A E  ++   SD +
Sbjct: 65  ISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAAENALNAKSSDFD 114


>gi|90994451|ref|YP_536941.1| ATP synthase CF1 epsilon subunit [Porphyra yezoensis]
 gi|122238240|sp|Q1XDM7|ATPE_PORYE RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|90819015|dbj|BAE92384.1| ATP synthase CF1 epsilon chain [Porphyra yezoensis]
          Length = 134

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 64/129 (49%), Gaps = 4/129 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L+  +++P++ V+  E Q ++LPS  G + +L GHAP+LT +  G++ + +  E +   V
Sbjct: 3   LNIRIIAPDRTVWDAEAQEIILPSSTGQLGILTGHAPLLTALDIGVMRVRVDKEWMP-IV 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  +I  +  T+L           L   EK +D     L++     ++ +  Q    
Sbjct: 62  LLGGFAEIENNQLTILVNGAEEASQIDLSEAEKNLDTATQLLSDASSNKEKIEATQ---K 118

Query: 127 LSCLRRRIQ 135
           +   R R+Q
Sbjct: 119 IRKARARVQ 127


>gi|220936459|ref|YP_002515358.1| F0F1 ATP synthase subunit epsilon [Thioalkalivibrio sp. HL-EbGR7]
 gi|254809439|sp|B8GRB7|ATPE_THISH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|219997769|gb|ACL74371.1| F0F1 ATP synthase subunit epsilon [Thioalkalivibrio sp. HL-EbGR7]
          Length = 141

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 6/129 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEEIHRY 65
            H ++VS E+ ++SG  Q VV P+E G++ +L  H+  +  +K G V + +S   E H  
Sbjct: 5   FHVDIVSAEESIYSGTAQMVVAPAEGGEVGILPRHSQYIAQLKPGEVRVKVSDSGEEHSI 64

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            + GG+ ++ P   TVL++T +    +D A  +   +R +E  SD     D D      +
Sbjct: 65  FISGGLLEVQPHVVTVLADTAVRAKDLDEAEAKEAMRRAEEALSDRK--ADFDYAKAQAE 122

Query: 123 LLVDLSCLR 131
           L+   + LR
Sbjct: 123 LIEAAARLR 131


>gi|119475219|ref|ZP_01615572.1| ATP synthase subunit epsilon [marine gamma proteobacterium
           HTCC2143]
 gi|119451422|gb|EAW32655.1| ATP synthase subunit epsilon [marine gamma proteobacterium
           HTCC2143]
          Length = 140

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (53%), Gaps = 5/112 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG V+ +V    LGD+ +  GHAP+LT+++ G + I     +   Y 
Sbjct: 5   IHCDIVSAEEEIFSGLVEMIVATGALGDLGISYGHAPLLTSLQPGPIRIKTQAGDEEVYY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
           V GG  ++ P   +VL++T +    +D A     +K  ++  S  N   D D
Sbjct: 65  VSGGYLEVQPGTVSVLADTAIRAGDIDEASAVEAQKEAEQALS--NQSGDFD 114


>gi|289665456|ref|ZP_06487037.1| F0F1 ATP synthase subunit epsilon [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 140

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS EK +F GE   VV   ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTANGEHLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           GI ++ P   T+L +T +    +D A ++ +++  +   +   N  DV + + ++ +  V
Sbjct: 67  GILEVQPQVVTILVDTAVRAQDIDEAAVRKVKEEAERQLASRGNTVDVAEAQRRLAEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|238765106|ref|ZP_04626040.1| ATP synthase epsilon chain [Yersinia kristensenii ATCC 33638]
 gi|238793103|ref|ZP_04636731.1| ATP synthase epsilon chain [Yersinia intermedia ATCC 29909]
 gi|238696658|gb|EEP89441.1| ATP synthase epsilon chain [Yersinia kristensenii ATCC 33638]
 gi|238727476|gb|EEQ19002.1| ATP synthase epsilon chain [Yersinia intermedia ATCC 29909]
          Length = 140

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 67/128 (52%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 7   HLDVVSAEKKMFSGVVQKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGEEEFIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ PS   VL++T +    +D A  L++  K  D +    N+  DVD      +L
Sbjct: 67  SGGILEVQPSVVIVLADTAIRGTDLDEAKALESKRKAEDHIN---NSHGDVDYAQASAEL 123

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 124 AKAIAKLR 131


>gi|85060393|ref|YP_456095.1| F0F1 ATP synthase subunit epsilon [Sodalis glossinidius str.
           'morsitans']
 gi|119367788|sp|Q2NQ85|ATPE_SODGM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|84780913|dbj|BAE75690.1| ATP synthase epsilon subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 140

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG V+ + +    G++ +  GHAP+LT IK G+V I           +
Sbjct: 7   HLDVVSAEKQMFSGLVEKIQVTGSEGELGIFPGHAPLLTAIKPGMVRIVKEHGNEEYIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GG+ ++ PS  TVL++T +    +D A     +++ +E  +  N+  D+D      +L 
Sbjct: 67  SGGVLEVQPSTVTVLADTAIRGEDLDEARAMESKRKAEEHIN--NSHGDIDYAQASAELS 124

Query: 125 VDLSCLR 131
             L+ LR
Sbjct: 125 KALAKLR 131


>gi|262273111|ref|ZP_06050928.1| ATP synthase epsilon chain [Grimontia hollisae CIP 101886]
 gi|262222867|gb|EEY74175.1| ATP synthase epsilon chain [Grimontia hollisae CIP 101886]
          Length = 140

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 61/115 (53%), Gaps = 7/115 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG  +S+ +    G++ +  GH P+LT +  G++ I  + +  H  V
Sbjct: 6   FHLDVVSAEKQLFSGRAESIQVTGSEGELGIFPGHTPLLTAVTPGMIRI--TKQHGHEEV 63

Query: 67  VI--GGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           +   GG  ++ PS  TVL++T +    +D A  +  ++R +E   + N   D  Q
Sbjct: 64  IYLSGGTLEVQPSTVTVLADTAIRGVDLDQAKAEEAKRRAEERILNKNGDMDFAQ 118


>gi|84622326|ref|YP_449698.1| F0F1 ATP synthase subunit epsilon [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|119367810|sp|Q2P7Q3|ATPE_XANOM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|84366266|dbj|BAE67424.1| ATP synthase epsilon chain [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 140

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 70/127 (55%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS EK +F GE   VV   ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTANGEHLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           GI ++ P   T+L +T +    ++ A ++ +++  + + ++  N  DV + + ++ +  V
Sbjct: 67  GILEVQPQVVTILVDTAVRAQDIEEAAVRKVKEEAERLLANRGNTVDVAEAQRRLTEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|149911799|ref|ZP_01900403.1| ATP synthase subunit epsilon [Moritella sp. PE36]
 gi|149805145|gb|EDM65167.1| ATP synthase subunit epsilon [Moritella sp. PE36]
          Length = 141

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 5/118 (4%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           M++  DL+  +VS E  +FSG  +SV +    G+  +L GH P+LT I  G+V +     
Sbjct: 1   MAMTFDLN--VVSAEGVLFSGRAESVQITGSGGEFGILAGHTPLLTGIVPGMVRLVKQHG 58

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
           E     V GG C++ P   TVL++T +    +D A  Q  +++ +E+ ++     DVD
Sbjct: 59  EEEIIFVSGGTCEVQPGEVTVLADTAIRAEDLDLAKAQEAKRQAEELLNNSATNQDVD 116


>gi|297539942|ref|YP_003675711.1| ATP synthase F1 subunit epsilon [Methylotenera sp. 301]
 gi|297259289|gb|ADI31134.1| ATP synthase F1, epsilon subunit [Methylotenera sp. 301]
          Length = 141

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 54/85 (63%), Gaps = 3/85 (3%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS--CE 60
          + N +H ++VS E  +F+GE + VV+P+  G++ +   HAP++TTIK G + I L+   E
Sbjct: 1  MANTVHIDVVSAEASIFAGEAEFVVVPASTGEVGIYPHHAPMVTTIKPGSLRIKLADTAE 60

Query: 61 EIHRYVVIGGICDIVPSHCTVLSET 85
          E   ++  GG+ ++ P   TVL++T
Sbjct: 61 ETLIFIS-GGLLEVQPGLITVLADT 84


>gi|218130968|ref|ZP_03459772.1| hypothetical protein BACEGG_02570 [Bacteroides eggerthii DSM
          20697]
 gi|317476279|ref|ZP_07935529.1| ATP synthase [Bacteroides eggerthii 1_2_48FAA]
 gi|217986840|gb|EEC53172.1| hypothetical protein BACEGG_02570 [Bacteroides eggerthii DSM
          20697]
 gi|316907553|gb|EFV29257.1| ATP synthase [Bacteroides eggerthii 1_2_48FAA]
          Length = 81

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 48/75 (64%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LH ++VSP+K +F+GEV SV LP  LG  T+L  HAP+++++K+G+++      E H   
Sbjct: 4  LHLDIVSPDKEIFNGEVDSVTLPGTLGSFTILPKHAPIVSSLKAGVLSYVTKDGEEHVQD 63

Query: 67 VIGGICDIVPSHCTV 81
          + GG  ++  +  +V
Sbjct: 64 IHGGFVEMNDNKASV 78


>gi|320539770|ref|ZP_08039431.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Serratia
           symbiotica str. Tucson]
 gi|320030173|gb|EFW12191.1| F1 sector of membrane-bound ATP synthase, epsilon subunit [Serratia
           symbiotica str. Tucson]
          Length = 139

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 6   HLDVVSAEKQMFSGLVQKIQVTGSEGELGIFPGHAPLLTAIKPGMVHIVNQHGEEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ PS  T+L++T +    +D A  ++LE +        N+  DVD      +L 
Sbjct: 66  SGGILEVQPSVVTLLADTAIRGTDLDEA--RSLEAKYKAEEHIRNSHGDVDYAQASAELA 123

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 124 KAIAKLR 130


>gi|53802690|ref|YP_112554.1| ATP synthase F1 subunit epsilon [Methylococcus capsulatus str.
          Bath]
 gi|81683268|sp|Q60CR3|ATPE1_METCA RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
          synthase F1 sector epsilon subunit 1; AltName:
          Full=F-ATPase epsilon subunit 1
 gi|53756451|gb|AAU90742.1| ATP synthase F1, epsilon subunit [Methylococcus capsulatus str.
          Bath]
          Length = 140

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG+ + VV P + G++ +   HAP L+ +K G V +    +E   + 
Sbjct: 5  MHVDIVSAEGEIFSGQAELVVAPGQEGEVGIAARHAPFLSPLKPGEVRVKSEGQEPLSFY 64

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG+ ++ P   T+LSET
Sbjct: 65 VSGGMLEVQPYLVTILSET 83


>gi|85712586|ref|ZP_01043633.1| F0F1-type ATP synthase, epsilon subunit [Idiomarina baltica OS145]
 gi|85693577|gb|EAQ31528.1| F0F1-type ATP synthase, epsilon subunit [Idiomarina baltica OS145]
          Length = 138

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 5/105 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEEIHRY 65
           L+ E+VS E+ +F+G VQ+V +    G++ +  GHAP+LT IK G+V  +S   +E   Y
Sbjct: 6   LNLEIVSAERRLFTGVVQTVQVSGSEGELGIYPGHAPLLTKIKPGMVRFLSEEGQEELLY 65

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSD 107
           V  GG+ ++ P    VL++  +    +D    +A  KR +E  +D
Sbjct: 66  VA-GGVLEVQPGQVIVLADVAVRGHELDEQEAEAARKRAEEAIAD 109


>gi|332995859|gb|AEF05914.1| F0F1 ATP synthase subunit epsilon [Alteromonas sp. SN2]
          Length = 138

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS EK +FSG V+++ +    G++ +  GHAP+++ IK G+V +     E     
Sbjct: 6   VHLDVVSAEKEIFSGLVETIQVTGSEGELGIHPGHAPLISAIKPGMVRLVKQFGEEEVIY 65

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALE---KRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG+ ++ P + TVL++T + +++   QA E   +R  E  +  N   D D     ++L
Sbjct: 66  VAGGVLEVQPGNVTVLADTAVRVEDLDEQAAEEAKRRAQEHIA--NPGADFDYAEAAQEL 123

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 124 SEAIAQLR 131


>gi|123444372|ref|YP_001008337.1| F0F1 ATP synthase subunit epsilon [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332163549|ref|YP_004300126.1| F0F1 ATP synthase subunit epsilon [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|166222509|sp|A1JTC5|ATPE_YERE8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|122091333|emb|CAL14219.1| ATP synthase epsilon subunit protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|318608056|emb|CBY29554.1| ATP synthase epsilon chain [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667779|gb|ADZ44423.1| F0F1 ATP synthase subunit epsilon [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861779|emb|CBX71952.1| ATP synthase epsilon chain [Yersinia enterocolitica W22703]
          Length = 140

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 7   HLDVVSAEKKMFSGVVQKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGEEEFIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ PS   VL++T +    +D A     +++ +E  +  N+  DVD      +L 
Sbjct: 67  SGGILEVQPSVVIVLADTAIRGTDLDEAKALESKRKAEEHIN--NSHGDVDYAQASAELA 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|89074729|ref|ZP_01161187.1| ATP synthase subunit epsilon [Photobacterium sp. SKA34]
 gi|90581152|ref|ZP_01236951.1| ATP synthase subunit epsilon [Vibrio angustum S14]
 gi|89049493|gb|EAR55054.1| ATP synthase subunit epsilon [Photobacterium sp. SKA34]
 gi|90437673|gb|EAS62865.1| ATP synthase subunit epsilon [Vibrio angustum S14]
          Length = 140

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 60/113 (53%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H E+VS EK +FSG  +++ +    G++ +  GH P+LT I  G+V I+    E     
Sbjct: 6   FHLEVVSAEKRLFSGRAENIQVTGSEGELGIHAGHTPLLTAITPGMVRITKQGGEEDVIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           + GG+ ++ PS  TVL++T +    +D A  +  +++ +E   + +   D  Q
Sbjct: 66  LSGGMLEVQPSAVTVLADTAIRGVDLDAAKAEEAKRQAEERIHNQHGDIDFAQ 118


>gi|313903635|ref|ZP_07837025.1| ATP synthase F1 subcomplex epsilon subunit [Thermaerobacter
          subterraneus DSM 13965]
 gi|313466188|gb|EFR61712.1| ATP synthase F1 subcomplex epsilon subunit [Thermaerobacter
          subterraneus DSM 13965]
          Length = 140

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 9  FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           E+++PE+ VF  EV S+++P   G + VL GHAP++  +K GI+T     E   R  V 
Sbjct: 8  LEVITPERVVFREEVDSLIVPGAEGLLGVLPGHAPMVAALKIGILTYRKDGER-RRVAVA 66

Query: 69 GGICDIVPSHCTVLSET 85
          GG  ++  +H  VLS+ 
Sbjct: 67 GGFFEVADNHAVVLSDA 83


>gi|240950010|ref|ZP_04754318.1| F0F1 ATP synthase subunit epsilon [Actinobacillus minor NM305]
 gi|240295488|gb|EER46231.1| F0F1 ATP synthase subunit epsilon [Actinobacillus minor NM305]
          Length = 139

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 3/111 (2%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +     +VS E+ +FSG V SV +    G++ V  GH P+LT+IK G+V  +L     
Sbjct: 1   MASQFELNIVSAEEKIFSGSVVSVRVTGVDGELGVYAGHTPLLTSIKPGMVKYTLQDGRE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN 110
               V GG  ++ P+  TVL++  +    +D   + A +++ +E+ S  NN
Sbjct: 61  EFIYVSGGFLEVQPTIVTVLADVAIRGEELDQQRILAAKRKAEEILSKSNN 111


>gi|114762050|ref|ZP_01441518.1| ATP synthase F1, epsilon subunit [Pelagibaca bermudensis HTCC2601]
 gi|114545074|gb|EAU48077.1| ATP synthase F1, epsilon subunit [Roseovarius sp. HTCC2601]
          Length = 144

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 59/111 (53%), Gaps = 2/111 (1%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + + F+LVSPE+ + S + ++V +P   GD+T   GHA V+TT++ GI+ +       
Sbjct: 1   MADTMQFDLVSPERSLLSTQAKTVSIPGTDGDMTAGPGHAAVITTLRPGILKVETET-GT 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
             +VV GG  +I  +  +VL+E  +P  +   +  E  + E  +    + +
Sbjct: 60  EEFVVTGGFAEIG-TTMSVLAERAVPYADMTQETYEDLVREAQAYYKKVVE 109


>gi|85374585|ref|YP_458647.1| F0F1 ATP synthase subunit epsilon [Erythrobacter litoralis
          HTCC2594]
 gi|84787668|gb|ABC63850.1| ATP synthase F1, epsilon subunit [Erythrobacter litoralis
          HTCC2594]
          Length = 85

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 51/84 (60%), Gaps = 7/84 (8%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV----TISLSCEEI 62
          LHFELV+PE+ V S +V  VV+P   G+  VL GHAP ++TI+ G V    T   + EEI
Sbjct: 3  LHFELVTPERQVRSEDVHMVVVPGSEGEFGVLEGHAPFMSTIRDGAVQVFKTEGATPEEI 62

Query: 63 HRYVVIGGICDIVPSHCTVLSETI 86
             +V GG  ++  +  TVL+E +
Sbjct: 63 ---MVEGGFAEVGENGLTVLAEKV 83


>gi|237714626|ref|ZP_04545107.1| H+-transporting two-sector ATPase [Bacteroides sp. D1]
 gi|262406491|ref|ZP_06083040.1| ATP synthase, Delta/Epsilon chain, beta-sandwich
          domain-containing protein [Bacteroides sp. 2_1_22]
 gi|229445395|gb|EEO51186.1| H+-transporting two-sector ATPase [Bacteroides sp. D1]
 gi|262355194|gb|EEZ04285.1| ATP synthase, Delta/Epsilon chain, beta-sandwich
          domain-containing protein [Bacteroides sp. 2_1_22]
          Length = 82

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 47/72 (65%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          ++ +LH  +VSPEK +F G+V+ V LP  +G  ++L GHAP+++++K+G ++ +    E 
Sbjct: 1  MMKELHLSIVSPEKSIFDGDVKIVTLPGMIGSFSILPGHAPIVSSLKAGTLSYTTMEGEE 60

Query: 63 HRYVVIGGICDI 74
          H   + GG  ++
Sbjct: 61 HTMDIQGGFVEM 72


>gi|317050179|ref|YP_004117827.1| ATP synthase F1 subunit epsilon [Pantoea sp. At-9b]
 gi|316951796|gb|ADU71271.1| ATP synthase F1, epsilon subunit [Pantoea sp. At-9b]
          Length = 139

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 6   HLDVVSAEQQMFSGLVQKIQVSGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGEEEYIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GG+ ++ P   TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 66  SGGVLEVQPGSTTVLADTAIRGEDLDEARALEAKRKAEEHMSSSHG--DVDYAQASAELA 123

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 124 KAIAKLR 130


>gi|312892093|ref|ZP_07751593.1| ATP synthase F1 subcomplex epsilon subunit [Mucilaginibacter
          paludis DSM 18603]
 gi|311295465|gb|EFQ72634.1| ATP synthase F1 subcomplex epsilon subunit [Mucilaginibacter
          paludis DSM 18603]
          Length = 82

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 53/81 (65%), Gaps = 1/81 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          ++ E+++P+K VF GEV+SV +P  +G   +L  HA +++T++ G + +  S +E   Y+
Sbjct: 1  MNLEILTPDKKVFEGEVKSVTVPGTMGSFEILNNHAAIISTLEDGKLIVRTSGKE-EVYI 59

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG+ +++ +   VL+E I+
Sbjct: 60 VKGGVVEVLNNKVMVLAEGII 80


>gi|298481152|ref|ZP_06999346.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides sp. D22]
 gi|298272726|gb|EFI14293.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides sp. D22]
          Length = 82

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 47/72 (65%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          ++ +LH  +VSPEK +F G+V+ V LP  +G  ++L GHAP+++++K+G ++ +    E 
Sbjct: 1  MMKELHLSIVSPEKSIFDGDVKIVTLPGMIGSFSILPGHAPIVSSLKAGTLSYTTMEGEE 60

Query: 63 HRYVVIGGICDI 74
          H   + GG  ++
Sbjct: 61 HTMDIQGGFVEM 72


>gi|29346122|ref|NP_809625.1| ATP synthase subunit epsilon [Bacteroides thetaiotaomicron
          VPI-5482]
 gi|29338016|gb|AAO75819.1| ATP synthase epsilon chain [Bacteroides thetaiotaomicron
          VPI-5482]
          Length = 81

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          + +LH  +VSPEK VF GEV+ V LP  +G  ++L GHAP+++++K+G +  +    E H
Sbjct: 1  MKELHLSIVSPEKSVFDGEVKIVTLPGTVGSFSILPGHAPIVSSLKAGTLGYTTMDGEEH 60

Query: 64 RYVVIGGICDI 74
             + GG  ++
Sbjct: 61 TLDIQGGFVEM 71


>gi|330831704|ref|YP_004394656.1| ATP synthase subunit epsilon [Aeromonas veronii B565]
 gi|328806840|gb|AEB52039.1| ATP synthase epsilon chain [Aeromonas veronii B565]
          Length = 142

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 11/112 (9%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS E  +FSG VQS  +    G++ +  GHAP+LT IK G+V +      EE+  
Sbjct: 7   FHLDVVSAEGKLFSGRVQSAQVSGSEGELGLRHGHAPLLTAIKPGLVRLVKQNGTEEV-- 64

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDEVCSDLN 109
             + GG+ ++ P   TVL++T +  D+          +A E+RI     D++
Sbjct: 65  LYISGGMLEVQPESVTVLADTAIRADDLDEAKAQEAKRAAEERIHSSHGDID 116


>gi|108763162|ref|YP_635035.1| F0F1 ATP synthase subunit epsilon [Myxococcus xanthus DK 1622]
 gi|119367749|sp|Q1CX38|ATPE_MYXXD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|108467042|gb|ABF92227.1| ATP synthase F1, epsilon subunit [Myxococcus xanthus DK 1622]
          Length = 136

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 1/125 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+V+PEK + S +    ++P   G   V  GH P L+ ++ G +T+ +       Y 
Sbjct: 4   LTVEIVTPEKRILSVQADEAIVPGGRGLFGVRPGHTPFLSLMEPGALTL-IESGRRESYF 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  ++      VL++   P+    ++   +R+ E    +  +   D RF++EQ  V 
Sbjct: 63  VAGGFVEVGNDKVLVLADAAEPVTGIDVEGARRRMAEAQERMKGMSSEDARFELEQATVR 122

Query: 127 LSCLR 131
               R
Sbjct: 123 REAAR 127


>gi|158520621|ref|YP_001528491.1| ATP synthase F1, epsilon subunit [Desulfococcus oleovorans Hxd3]
 gi|226740246|sp|A8ZUA2|ATPE_DESOH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|158509447|gb|ABW66414.1| ATP synthase F1, epsilon subunit [Desulfococcus oleovorans Hxd3]
          Length = 133

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 57/113 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +L  E+V+PEK V S + Q V+ P  LG+  VLV H P LT++  G +    + E+ 
Sbjct: 1   MAENLRLEVVTPEKTVVSDDAQIVMAPGVLGEFGVLVNHTPFLTSLMPGALHYKDTGEKE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD 115
           H   V  G  +++P   TVL E+    ++  LQ  E   +     L +  DVD
Sbjct: 61  HLLFVSDGFAEVLPDRITVLVESAERKEDIDLQRAEAARERAEKRLESGEDVD 113


>gi|461574|sp|P35111|ATPE_CHLLI RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|7239816|gb|AAB25775.2| F-ATPase epsilon subunit [Chlorobium limicola]
          Length = 88

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             ++V+P+K  FSGEV SV+ P   G   ++ GHAP+L  +KSG V +SLS +    + 
Sbjct: 8  FKLDIVTPQKLFFSGEVTSVIAPGLDGLFQIMKGHAPLLAALKSGKVRLSLSDKSEDSFQ 67

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++  +   +L+E +
Sbjct: 68 IEGGFFEVSGNKAILLTEDV 87


>gi|117620223|ref|YP_858678.1| F0F1 ATP synthase subunit epsilon [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561630|gb|ABK38578.1| ATP synthase F1, epsilon subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 139

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 11/112 (9%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS E  +FSG VQS  +    G++ +  GHAP+LT IK G+V +      EE+  
Sbjct: 4   FHLDVVSAEGKLFSGRVQSAQVSGSEGELGLRHGHAPLLTAIKPGLVRLVKQNGTEEV-- 61

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDEVCSDLN 109
             + GG+ ++ P   TVL++T +  D+          +A E+RI     D++
Sbjct: 62  LYISGGMLEVQPEAVTVLADTAIRADDLDEAKAQEAKRAAEERIHSSHGDID 113


>gi|86606207|ref|YP_474970.1| F0F1 ATP synthase subunit epsilon [Synechococcus sp. JA-3-3Ab]
 gi|119367799|sp|Q2JUB3|ATPE_SYNJA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|86554749|gb|ABC99707.1| ATP synthase F1, epsilon subunit [Synechococcus sp. JA-3-3Ab]
          Length = 135

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P++ V+    + V+LP+  G + +L  HAP+LT I +G++ +  +  +     
Sbjct: 3   LMVRVITPDRTVWDAPAEEVILPATSGQLGILTNHAPLLTAIGNGVMRVK-AGGKWSAIA 61

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           V+GG  ++  +  TVL   +E    +D A  QAL   +D+    LN   D  +R Q +
Sbjct: 62  VMGGFAEVENNEVTVLVNRAERGEKVDKAAAQAL---LDKASQVLNTSSDKQERLQAK 116


>gi|119386526|ref|YP_917581.1| ATP synthase F1, epsilon subunit [Paracoccus denitrificans
          PD1222]
 gi|189081371|sp|A1B8P1|ATPE_PARDP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|119377121|gb|ABL71885.1| ATP synthase F1 subcomplex epsilon subunit [Paracoccus
          denitrificans PD1222]
          Length = 148

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + + F+LVSPE+ + S  V+ V LP   GD+T + GHAP +  ++ G+VT+       
Sbjct: 1  MADTMQFDLVSPERNLVSVPVREVRLPGADGDLTAMPGHAPAIVNLRPGLVTVVAGDGSE 60

Query: 63 HRYVVIGGICDIVPSHCTVLSETILP 88
            + V GG  +I     T+L+E   P
Sbjct: 61 TEFAVTGGFAEINNESVTLLAERGHP 86


>gi|255037512|ref|YP_003088133.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Dyadobacter fermentans DSM 18053]
 gi|254950268|gb|ACT94968.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Dyadobacter fermentans DSM 18053]
          Length = 80

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H E+++P+K VF+GE  +V LP   G   VL  HAP+++T+  G V +     +   +V
Sbjct: 1  MHLEIITPDKKVFAGEANAVTLPGTEGQFQVLNRHAPLVSTLGKGDVVVDTGAGK-QNFV 59

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          + GG+ +++ +   VL+E +L
Sbjct: 60 IDGGVVEVLNNKVLVLAEAVL 80


>gi|189345586|ref|YP_001942115.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Chlorobium limicola DSM 245]
 gi|189339733|gb|ACD89136.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Chlorobium limicola DSM 245]
          Length = 88

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 6  DLHFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          D  FE+  V+P+K  FSGEV SV  P + G   VL  HAP+L+ +K+G V I L+ + + 
Sbjct: 5  DKGFEIDIVTPQKLFFSGEVTSVTAPGQDGLFQVLKNHAPLLSALKNGKVKIVLADKSVK 64

Query: 64 RYVVIGGICDIVPSHCTVLSETI 86
           + V  G  ++  +   +L+E I
Sbjct: 65 NFTVADGFFEVSGNKAILLTENI 87


>gi|77166519|ref|YP_345044.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Nitrosococcus oceani ATCC 19707]
 gi|254436069|ref|ZP_05049576.1| ATP synthase F1, epsilon subunit [Nitrosococcus oceani AFC27]
 gi|119367751|sp|Q3J6N2|ATPE_NITOC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|76884833|gb|ABA59514.1| ATP synthase F1 subcomplex epsilon subunit [Nitrosococcus oceani
           ATCC 19707]
 gi|207089180|gb|EDZ66452.1| ATP synthase F1, epsilon subunit [Nitrosococcus oceani AFC27]
          Length = 140

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 68/131 (51%), Gaps = 6/131 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG V  +  P+E+G++ ++  H P++T +K G V +     +   + 
Sbjct: 5   MHVDIVSAEREIFSGTVNMLFAPAEMGEVGIMPRHTPLITRLKPGEVRLQRPEGQEDFFY 64

Query: 67  VIGGICDIVPSHCTVLSET---ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME-- 121
           V GG+ ++ P   TVL++T      +D A   A ++R +E   D     D   R Q E  
Sbjct: 65  VSGGLLEVQPHVVTVLADTAQRAADIDEAAALAAKQRAEEALQDREGKLDY-ARAQAELA 123

Query: 122 QLLVDLSCLRR 132
           + +  L  ++R
Sbjct: 124 EAIAQLKAIQR 134


>gi|167762916|ref|ZP_02435043.1| hypothetical protein BACSTE_01280 [Bacteroides stercoris ATCC
          43183]
 gi|167699256|gb|EDS15835.1| hypothetical protein BACSTE_01280 [Bacteroides stercoris ATCC
          43183]
          Length = 81

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +  LH ++VSPEK +F+GEV SV LP  LG  T+LV HAP+++++K+G +       E  
Sbjct: 1  MKGLHLDIVSPEKEIFTGEVDSVTLPGTLGSFTILVQHAPIVSSLKAGTLAYVTKDGEER 60

Query: 64 RYVVIGGICDIVPSHCTV 81
             + GG  ++  +  +V
Sbjct: 61 ALDIHGGFVEMNSNRVSV 78


>gi|110598292|ref|ZP_01386567.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Chlorobium ferrooxidans DSM 13031]
 gi|110340100|gb|EAT58600.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Chlorobium ferrooxidans DSM 13031]
          Length = 88

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 46/80 (57%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             E+V+P+K  FSGE++SV  P E G   VL  HAP+L+ +K+G V ++++      + 
Sbjct: 8  FQIEIVTPQKLYFSGEIESVTAPGEDGLFQVLKNHAPLLSALKAGKVKLAMADRSEQTFT 67

Query: 67 VIGGICDIVPSHCTVLSETI 86
          +  G  ++  +   +L+E I
Sbjct: 68 ISDGFFEVSSNKAILLTENI 87


>gi|253568454|ref|ZP_04845865.1| H+-transporting two-sector ATPase [Bacteroides sp. 1_1_6]
 gi|251842527|gb|EES70607.1| H+-transporting two-sector ATPase [Bacteroides sp. 1_1_6]
          Length = 82

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (63%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          ++ +LH  +VSPEK VF GEV+ V LP  +G  ++L GHAP+++++K+G +  +    + 
Sbjct: 1  MMKELHLSIVSPEKSVFDGEVKIVTLPGTVGSFSILPGHAPIVSSLKAGTLGYTTMDGDE 60

Query: 63 HRYVVIGGICDI 74
          H   + GG  ++
Sbjct: 61 HTLDIQGGFVEM 72


>gi|87200416|ref|YP_497673.1| F0F1 ATP synthase subunit epsilon [Novosphingobium
          aromaticivorans DSM 12444]
 gi|119367753|sp|Q2G5N4|ATPE_NOVAD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|87136097|gb|ABD26839.1| ATP synthase F1 subcomplex epsilon subunit [Novosphingobium
          aromaticivorans DSM 12444]
          Length = 85

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 7/85 (8%)

Query: 6  DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSC----EE 61
           LHFELV+P + V S EV  VV+P   G+  VL GHAP ++T+K G + +  S     EE
Sbjct: 2  SLHFELVTPARLVRSEEVHMVVVPGTDGEFGVLEGHAPFMSTVKDGAIKVYRSAGAAPEE 61

Query: 62 IHRYVVIGGICDIVPSHCTVLSETI 86
          I    V GG  ++     TVL+E +
Sbjct: 62 IQ---VQGGFAEVSAKGLTVLAEHV 83


>gi|160884430|ref|ZP_02065433.1| hypothetical protein BACOVA_02414 [Bacteroides ovatus ATCC 8483]
 gi|237718127|ref|ZP_04548608.1| H+transporting two-sector ATPase [Bacteroides sp. 2_2_4]
 gi|260174636|ref|ZP_05761048.1| ATP synthase epsilon chain [Bacteroides sp. D2]
 gi|293369733|ref|ZP_06616309.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides ovatus SD CMC 3f]
 gi|315922900|ref|ZP_07919140.1| ATP synthase subunit epsilon [Bacteroides sp. D2]
 gi|156110169|gb|EDO11914.1| hypothetical protein BACOVA_02414 [Bacteroides ovatus ATCC 8483]
 gi|229452548|gb|EEO58339.1| H+transporting two-sector ATPase [Bacteroides sp. 2_2_4]
 gi|292635155|gb|EFF53671.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides ovatus SD CMC 3f]
 gi|313696775|gb|EFS33610.1| ATP synthase subunit epsilon [Bacteroides sp. D2]
          Length = 82

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 46/72 (63%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          ++ +LH  +VSPEK +F G V+ V LP  +G  ++L GHAP+++++K+G ++ +    E 
Sbjct: 1  MMKELHLSIVSPEKSIFDGNVKIVTLPGMIGSFSILPGHAPIVSSLKAGTLSYTTMDGEE 60

Query: 63 HRYVVIGGICDI 74
          H   + GG  ++
Sbjct: 61 HTMDIQGGFVEM 72


>gi|186684533|ref|YP_001867729.1| F0F1 ATP synthase subunit epsilon [Nostoc punctiforme PCC 73102]
 gi|226740270|sp|B2IUL1|ATPE_NOSP7 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|186466985|gb|ACC82786.1| ATP synthase F1, epsilon subunit [Nostoc punctiforme PCC 73102]
          Length = 137

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 59/116 (50%), Gaps = 1/116 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-SLSCEEIHRY 65
           L   ++SP+K V+    + VVLPS  G + +L GHAP+LT + +G++ + +   +     
Sbjct: 3   LTVRVISPDKTVWDAPAEEVVLPSTTGQLGILTGHAPLLTALDTGVMRVRAAKNQNWEAI 62

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            ++GG  ++  +  T+L       D   L+      ++  + LN +   D++ Q++
Sbjct: 63  ALLGGFAEVEENEVTILVNGAERGDKINLEEARAAYNKAEAGLNQVSSEDRQAQIK 118


>gi|33151293|ref|NP_872646.1| F0F1 ATP synthase subunit epsilon [Haemophilus ducreyi 35000HP]
 gi|60389739|sp|Q7VPN9|ATPE_HAEDU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|33147513|gb|AAP95035.1| ATP synthase epsilon chain [Haemophilus ducreyi 35000HP]
          Length = 139

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 59/111 (53%), Gaps = 3/111 (2%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +     +VS EK +F+G+V SV +    G++ +  GH P+LT IK G+V  +L   + 
Sbjct: 1   MASQFELRIVSAEKQIFNGQVVSVRVSGVEGELGIYAGHTPLLTAIKPGMVKYTLEDNKE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN 110
               V GG  ++ P+  TVL++  +    +D   + A +++ ++  S  NN
Sbjct: 61  EFIYVSGGFLEVQPTIVTVLADIAIRGEELDQQRIIAAKRKAEDTLSKTNN 111


>gi|223041785|ref|ZP_03611976.1| FOF1 ATP synthase subunit epsilon [Actinobacillus minor 202]
 gi|223017411|gb|EEF15831.1| FOF1 ATP synthase subunit epsilon [Actinobacillus minor 202]
          Length = 139

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 3/111 (2%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +     +VS E+ +FSG V SV +    G++ V  GH P+LT+IK G+V  +L     
Sbjct: 1   MASQFELNIVSAEEKIFSGSVVSVRVTGVDGELGVYAGHTPLLTSIKPGMVKYTLQDGRE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN 110
               V GG  ++ P+  TVL++  +    +D   + A +++ +E  S  NN
Sbjct: 61  EFIYVSGGFLEVQPTIVTVLADVAIRGEELDQQRILAAKRKAEETLSKTNN 111


>gi|156936111|ref|YP_001440027.1| F0F1 ATP synthase subunit epsilon [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166222457|sp|A7MMW8|ATPE_ENTS8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|156534365|gb|ABU79191.1| hypothetical protein ESA_04005 [Cronobacter sakazakii ATCC BAA-894]
          Length = 139

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEKQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEYIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P + TVL++T +    +D A  L+A  K  D + S   +  DVD      +L
Sbjct: 66  SGGVLEVQPGNVTVLADTAIRGQDLDEARALEAKRKAEDHIRS---SHGDVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|153806531|ref|ZP_01959199.1| hypothetical protein BACCAC_00795 [Bacteroides caccae ATCC 43185]
 gi|149131208|gb|EDM22414.1| hypothetical protein BACCAC_00795 [Bacteroides caccae ATCC 43185]
          Length = 81

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 46/71 (64%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          + +LH  +VSPEK VF G+V+ V LP  +G  ++L GHAP+++++K+G ++ +    E H
Sbjct: 1  MKELHLSIVSPEKSVFDGDVKIVTLPGTIGSFSILPGHAPIVSSLKAGTLSYTTLDGEEH 60

Query: 64 RYVVIGGICDI 74
             + GG  ++
Sbjct: 61 TLDIQGGFVEL 71


>gi|146284501|ref|YP_001174654.1| F0F1 ATP synthase subunit epsilon [Pseudomonas stutzeri A1501]
 gi|145572706|gb|ABP81812.1| ATP synthase F1, epsilon subunit [Pseudomonas stutzeri A1501]
          Length = 144

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 1  MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
          M++   +H ++VS E+ +FSG V+ V+    LGDI VL GHAP+LT +K G V +     
Sbjct: 1  MNMAMTVHCDIVSAEEELFSGLVEMVIAHGNLGDIGVLPGHAPLLTDLKPGPVRVIKQGG 60

Query: 61 EIHRYVVIGGICDIVPSHCTVLSET 85
          E   + + GG  ++ P+   VL++T
Sbjct: 61 EEEIFYISGGFIEVQPNMVKVLADT 85


>gi|325275311|ref|ZP_08141264.1| F0F1 ATP synthase subunit epsilon [Pseudomonas sp. TJI-51]
 gi|324099559|gb|EGB97452.1| F0F1 ATP synthase subunit epsilon [Pseudomonas sp. TJI-51]
          Length = 137

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 60/110 (54%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ VV    LGD+ +  GHAP++T +K G +T++        + 
Sbjct: 3   VHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGTQEVFY 62

Query: 67  VIGGICDIVPSHCTVLSETI---LPMDNA----CLQALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A     L+A E  ++   SD +
Sbjct: 63  ISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAAENALNTKGSDFD 112


>gi|325297376|ref|YP_004257293.1| ATPase, F1 complex, delta/epsilon subunit [Bacteroides
          salanitronis DSM 18170]
 gi|324316929|gb|ADY34820.1| ATPase, F1 complex, delta/epsilon subunit [Bacteroides
          salanitronis DSM 18170]
          Length = 81

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          + +LH  + SPE+ VF G+V   VLP ELG+  VLV HAP+++++ +G V  + + +E H
Sbjct: 1  MKELHLVIASPEQTVFDGKVDMAVLPGELGEFQVLVNHAPLISSLMAGEVRYT-AGKESH 59

Query: 64 RYVVIGGICDIVPSHCTVLSE 84
             + GG  ++  +  +V +E
Sbjct: 60 ALAIKGGFVEVRDNQISVCAE 80


>gi|88705418|ref|ZP_01103129.1| ATP synthase epsilon chain [Congregibacter litoralis KT71]
 gi|88700508|gb|EAQ97616.1| ATP synthase epsilon chain [Congregibacter litoralis KT71]
          Length = 141

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 52/81 (64%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+S++   E+G++ V  GHAP+L+++  G V I+L   E   Y 
Sbjct: 5  IHCDIVSAEEEIFSGLVESLIATGEMGELGVNYGHAPLLSSLIPGPVRITLQNGEEQVYY 64

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG  ++ P   ++L++T +
Sbjct: 65 VSGGYLEVQPGVVSILADTAM 85


>gi|326797427|ref|YP_004315247.1| ATP synthase epsilon chain [Marinomonas mediterranea MMB-1]
 gi|326548191|gb|ADZ93411.1| ATP synthase epsilon chain [Marinomonas mediterranea MMB-1]
          Length = 138

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+S+V     GD+ ++ GHAP+LT+++ G V +     E     
Sbjct: 5  VHCDIVSAEQEIFSGSVESLVAAGSFGDLGIMPGHAPLLTSLQPGPVRVVKENGEEELIF 64

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  ++ P   TVL++T
Sbjct: 65 VSGGFLEVQPRKITVLADT 83


>gi|330447293|ref|ZP_08310943.1| ATP synthase F1, epsilon subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491484|dbj|GAA05440.1| ATP synthase F1, epsilon subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 140

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 60/113 (53%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H E+VS EK +FSG  +++ +    G++ +  GH P+LT I  G+V I+    E     
Sbjct: 6   FHLEVVSAEKRLFSGRAENIQVTGSEGELGIHAGHTPLLTAITPGMVRITKQGGEEDVIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           + GG+ ++ P+  TVL++T +    +D A  +  +++ +E   + +   D  Q
Sbjct: 66  LSGGMLEVQPAAVTVLADTAIRGVDLDAAKAEEAKRQAEERIHNQHGDIDFAQ 118


>gi|298490973|ref|YP_003721150.1| ATP synthase F1 subuint epsilon ['Nostoc azollae' 0708]
 gi|298232891|gb|ADI64027.1| ATP synthase F1, epsilon subunit ['Nostoc azollae' 0708]
          Length = 137

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 59/116 (50%), Gaps = 1/116 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +VSP+K V+  +   V+LPS  G + +L GHAP+L+ + +G++ +  +     + +
Sbjct: 3   LTVRVVSPDKTVWDAQADEVILPSTTGQLGILTGHAPMLSALDTGVMRVRATKNSNWQAI 62

Query: 67  V-IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
             +GG  ++     T+L       D   L+   +  +E  + LN +   D++ Q++
Sbjct: 63  ALLGGFAEVEEDEVTILVNGAEYGDAINLEEARQAYNESQTKLNQVAAGDRQAQIQ 118


>gi|294646117|ref|ZP_06723780.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides ovatus SD CC 2a]
 gi|294808288|ref|ZP_06767046.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides xylanisolvens SD CC 1b]
 gi|292638561|gb|EFF56916.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides ovatus SD CC 2a]
 gi|294444507|gb|EFG13216.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides xylanisolvens SD CC 1b]
 gi|295084022|emb|CBK65545.1| ATP synthase F1 subcomplex epsilon subunit [Bacteroides
          xylanisolvens XB1A]
          Length = 81

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 46/71 (64%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          + +LH  +VSPEK +F G+V+ V LP  +G  ++L GHAP+++++K+G ++ +    E H
Sbjct: 1  MKELHLSIVSPEKSIFDGDVKIVTLPGMIGSFSILPGHAPIVSSLKAGTLSYTTMEGEEH 60

Query: 64 RYVVIGGICDI 74
             + GG  ++
Sbjct: 61 TMDIQGGFVEM 71


>gi|304398018|ref|ZP_07379893.1| ATP synthase F1, epsilon subunit [Pantoea sp. aB]
 gi|308188720|ref|YP_003932851.1| membrane-bound ATP synthase, F1 sector, epsilon- subunit [Pantoea
           vagans C9-1]
 gi|304354304|gb|EFM18676.1| ATP synthase F1, epsilon subunit [Pantoea sp. aB]
 gi|308059230|gb|ADO11402.1| membrane-bound ATP synthase, F1 sector, epsilon- subunit [Pantoea
           vagans C9-1]
          Length = 139

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 6   HLDVVSAEEQLFSGLVQKIQVSGSEGELGIFPGHAPLLTAIKPGMIRIVKQHGEEEYIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P   TVL++T +    +D A  L+A  K  + + S   +  DVD      +L
Sbjct: 66  SGGVLEVQPGSSTVLADTAIRGTDLDEARALEAKRKAEEHMNS---SHGDVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|92115398|ref|YP_575326.1| ATP synthase F1, epsilon subunit [Chromohalobacter salexigens DSM
          3043]
 gi|119361420|sp|Q1QSD1|ATPE_CHRSD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|91798488|gb|ABE60627.1| ATP synthase F1 subcomplex epsilon subunit [Chromohalobacter
          salexigens DSM 3043]
          Length = 141

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 44/76 (57%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          ++VS EK +FSG  + ++     GD+ +L GHAP+LT +K G V +     E   Y V G
Sbjct: 7  DIVSAEKAIFSGSAEQLIAAGVSGDLGILRGHAPLLTELKPGPVRVMREGGEEEVYYVTG 66

Query: 70 GICDIVPSHCTVLSET 85
          G  ++ P   +VL++T
Sbjct: 67 GFLEVQPDVVSVLADT 82


>gi|326387010|ref|ZP_08208620.1| F0F1 ATP synthase subunit epsilon [Novosphingobium
          nitrogenifigens DSM 19370]
 gi|326208191|gb|EGD58998.1| F0F1 ATP synthase subunit epsilon [Novosphingobium
          nitrogenifigens DSM 19370]
          Length = 86

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 7/84 (8%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS----CEEI 62
          LHFELV+P + V S EV  VV+P   G+  VL GHAP  +T+K G++ +  S     EEI
Sbjct: 5  LHFELVTPARLVLSEEVHQVVVPGTEGEFGVLEGHAPFTSTVKDGVIRVWRSENGHPEEI 64

Query: 63 HRYVVIGGICDIVPSHCTVLSETI 86
              V GG  ++     TVL+E +
Sbjct: 65 ---PVKGGFAEVSAKGLTVLAEHV 85


>gi|170724355|ref|YP_001752043.1| F0F1 ATP synthase subunit epsilon [Pseudomonas putida W619]
 gi|226740276|sp|B1JFU0|ATPE_PSEPW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|169762358|gb|ACA75674.1| ATP synthase F1, epsilon subunit [Pseudomonas putida W619]
          Length = 139

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 48/80 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ VV    LGD+ +  GHAP++T +K G +T++        Y 
Sbjct: 5  VHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGAQEVYY 64

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 65 ISGGFLEVQPNMVKVLADTV 84


>gi|332289263|ref|YP_004420115.1| F0F1 ATP synthase subunit epsilon [Gallibacterium anatis UMN179]
 gi|330432159|gb|AEC17218.1| F0F1 ATP synthase subunit epsilon [Gallibacterium anatis UMN179]
          Length = 141

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 68/128 (53%), Gaps = 6/128 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +FSG V+S+ +    G++ +L GH P+LT+IK GIV +    +E   YV
Sbjct: 4   FNLTVVSAEEKIFSGVVESIQVTGSEGELGILAGHTPLLTSIKPGIVKVMKEGKEEVIYV 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
             GG  ++ P +  VL++T +    +D   + A ++R +E     +   D +      +L
Sbjct: 64  S-GGFLEVQPGNVIVLADTAIRGEELDKERILAAKRRAEENIRSAHK--DGNYELMASKL 120

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 121 SRELAKLR 128


>gi|190575941|ref|YP_001973786.1| F0F1 ATP synthase subunit epsilon [Stenotrophomonas maltophilia
           K279a]
 gi|194367282|ref|YP_002029892.1| F0F1 ATP synthase subunit epsilon [Stenotrophomonas maltophilia
           R551-3]
 gi|254524571|ref|ZP_05136626.1| ATP synthase F1, epsilon subunit [Stenotrophomonas sp. SKA14]
 gi|226740291|sp|B4SJR8|ATPE_STRM5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740292|sp|B2FHY7|ATPE_STRMK RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|190013863|emb|CAQ47501.1| putative ATP synthase epsilon chain [Stenotrophomonas maltophilia
           K279a]
 gi|194350086|gb|ACF53209.1| ATP synthase F1, epsilon subunit [Stenotrophomonas maltophilia
           R551-3]
 gi|219722162|gb|EED40687.1| ATP synthase F1, epsilon subunit [Stenotrophomonas sp. SKA14]
          Length = 140

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +F GE   VV   ELG++ +   HAP++T +K G V ++    E   + + G
Sbjct: 7   DIVSAEQEIFRGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVTTPNGEQLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQRFQ-MEQLLV 125
           GI ++ P   TVL++T +    +D A ++  ++  + + ++     +V +  Q + + +V
Sbjct: 67  GILEVQPQVVTVLADTAIRAQDIDEASVRKAKEEAERILANRGEAMEVAEAQQKLAEAVV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|254441013|ref|ZP_05054506.1| ATP synthase F1, epsilon subunit [Octadecabacter antarcticus 307]
 gi|198251091|gb|EDY75406.1| ATP synthase F1, epsilon subunit [Octadecabacter antarcticus 307]
          Length = 133

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 9/111 (8%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           D  F+LVSPE+ +   +   V +P   GD+T +  H+P +TT++ GI+ ++ S   +  Y
Sbjct: 3   DFTFDLVSPERRLAQMDATEVQIPGADGDMTAMADHSPTITTLRPGILAVTHSG-GVAEY 61

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKR--IDEVCSDLNNICDV 114
           +V GG  +I  +  +VL+E       A L+   KR  +D++ +D     + 
Sbjct: 62  IVSGGFAEITATGVSVLAE------KAFLRTEAKREHMDKLVADATTAVEA 106


>gi|148260679|ref|YP_001234806.1| ATP synthase F1, epsilon subunit [Acidiphilium cryptum JF-5]
 gi|326403873|ref|YP_004283955.1| ATP synthase subunit epsilon [Acidiphilium multivorum AIU301]
 gi|146402360|gb|ABQ30887.1| ATP synthase F1 subcomplex epsilon subunit [Acidiphilium cryptum
          JF-5]
 gi|325050735|dbj|BAJ81073.1| ATP synthase subunit epsilon [Acidiphilium multivorum AIU301]
          Length = 137

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%)

Query: 9  FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           E++SPE+ + +  V  VV+P   GD+ VL GH+ ++T+++ G++ +    + + R+ V 
Sbjct: 5  LEIISPERLLLARPVSMVVIPGTEGDLGVLPGHSKMITSLRGGLIDLYEDEKLVDRFFVS 64

Query: 69 GGICDIVPSHCTVLSETI 86
          GG   I    CTVL++ I
Sbjct: 65 GGFAQITEERCTVLADAI 82


>gi|119509844|ref|ZP_01628987.1| ATP synthase subunit epsilon [Nodularia spumigena CCY9414]
 gi|119465453|gb|EAW46347.1| ATP synthase subunit epsilon [Nodularia spumigena CCY9414]
          Length = 137

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 62/130 (47%), Gaps = 2/130 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEEIHRY 65
           L   +VSP+K V+    + VVLPS  G + +L GHAP+LT + +G++ +  S  E+    
Sbjct: 3   LTVRVVSPDKTVWDAVAEEVVLPSTTGQLGILSGHAPMLTALDTGVMRVRASKNEDWQAI 62

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLV 125
            ++GG  ++     T+L       D   L+      ++  + LN +   +++ Q+ Q   
Sbjct: 63  ALLGGFAEVEEDEVTILVNGAERGDAIKLEDARAAFNQAQTRLNQVTPGEKQAQI-QATQ 121

Query: 126 DLSCLRRRIQ 135
                R R Q
Sbjct: 122 AFKRARARFQ 131


>gi|58580356|ref|YP_199372.1| F0F1 ATP synthase subunit epsilon [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188578710|ref|YP_001915639.1| F0F1 ATP synthase subunit epsilon [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|75508328|sp|Q5H4Y3|ATPE_XANOR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740305|sp|B2SQA9|ATPE_XANOP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|58424950|gb|AAW73987.1| ATP synthase epsilon chain [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188523162|gb|ACD61107.1| ATP synthase F1, epsilon subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 140

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 69/127 (54%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS EK +F GE   VV   ELG++ +   HAP++T +K G V +  +  E   + + G
Sbjct: 7   DIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKVVVITANGEHLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           GI ++ P   T+L +T +    ++ A ++ +++  + + ++  N  DV + + ++ +  V
Sbjct: 67  GILEVQPQVVTILVDTAVRAQDIEEAAVRKVKEEAERLLANRGNTVDVAEAQRRLTEATV 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|260222683|emb|CBA32487.1| ATP synthase epsilon chain [Curvibacter putative symbiont of
          Hydra magnipapillata]
          Length = 138

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 48/82 (58%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H ++VS E+ +FSGE   V LP E G++ +   H P++T IK G V I  +     
Sbjct: 1  MNTIHVDVVSAEESIFSGEAVFVALPGEAGELGIKPRHTPLITRIKPGSVRIQKADGSEE 60

Query: 64 RYVVIGGICDIVPSHCTVLSET 85
             V GG+ ++ P+  TVLS+T
Sbjct: 61 FVFVAGGLLEVQPNCVTVLSDT 82


>gi|75908514|ref|YP_322810.1| F0F1 ATP synthase subunit epsilon [Anabaena variabilis ATCC 29413]
 gi|119361411|sp|Q3MAS1|ATPE_ANAVT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|75702239|gb|ABA21915.1| ATP synthase F1 subcomplex epsilon subunit [Anabaena variabilis
           ATCC 29413]
          Length = 137

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 1/116 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEEIHRY 65
           L   ++SP+K V+  E   V+LPS  G + +L GHAP+LT + +G++ +  S  +     
Sbjct: 3   LTVRVISPDKTVWDAEADEVILPSTTGQLGILSGHAPLLTALDTGVLRVRTSKSQNWQAI 62

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            ++GG  ++     T+L       D   L+       +  + LN +   D++ Q++
Sbjct: 63  ALLGGFAEVEEDEVTILVNGGERGDTINLEEARTAYSQAQTKLNQVPAGDRQAQIQ 118


>gi|167856120|ref|ZP_02478861.1| F0F1 ATP synthase subunit epsilon [Haemophilus parasuis 29755]
 gi|219871750|ref|YP_002476125.1| F0F1 ATP synthase subunit epsilon [Haemophilus parasuis SH0165]
 gi|167852761|gb|EDS24034.1| F0F1 ATP synthase subunit epsilon [Haemophilus parasuis 29755]
 gi|219691954|gb|ACL33177.1| F0F1 ATP synthase subunit epsilon/H(+)-transporting two-sector
           ATPase, F(1) epsilon subunit [Haemophilus parasuis
           SH0165]
          Length = 138

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (51%), Gaps = 6/118 (5%)

Query: 9   FEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           FEL  VS E+ +F G+V SV +    G++ V  GH P+LT IK G+V  +L   +     
Sbjct: 4   FELTVVSAERKIFEGQVTSVRVSGVDGELGVYAGHTPLLTAIKPGMVKFTLEDNKEEYIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           V GG  ++ P+  TVL++  +    +D   + A +++ +E  S  N   D+  +   E
Sbjct: 64  VSGGFLEVQPTVVTVLADVAIRGEELDEQRILAAKRKAEETISKTNE-ADMTAKLARE 120


>gi|17232530|ref|NP_489078.1| F0F1 ATP synthase subunit epsilon [Nostoc sp. PCC 7120]
 gi|20141200|sp|P06542|ATPE_ANASP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|17134176|dbj|BAB76737.1| ATP synthase epsilon subunit [Nostoc sp. PCC 7120]
          Length = 137

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 1/116 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEEIHRY 65
           L   ++SP+K V+  E   V+LPS  G + +L GHAP+LT + +G++ +  S  +     
Sbjct: 3   LTVRVISPDKTVWDAEADEVILPSTTGQLGILSGHAPLLTALDTGVLRVRTSKSQNWQAI 62

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            ++GG  ++     T+L       D   L+       +  + LN +   D++ Q++
Sbjct: 63  ALLGGFAEVEEDEVTILVNGGERGDTINLEEARTAYSQAQTKLNQVPAGDRQAQIQ 118


>gi|303256394|ref|ZP_07342408.1| ATP synthase F1, epsilon subunit [Burkholderiales bacterium
          1_1_47]
 gi|331001479|ref|ZP_08325097.1| ATP synthase F1, epsilon subunit [Parasutterella
          excrementihominis YIT 11859]
 gi|302859885|gb|EFL82962.1| ATP synthase F1, epsilon subunit [Burkholderiales bacterium
          1_1_47]
 gi|329568208|gb|EGG50025.1| ATP synthase F1, epsilon subunit [Parasutterella
          excrementihominis YIT 11859]
          Length = 137

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ +FSG  + V LP   G++ +L GH P++T I+ G+V I  S ++     
Sbjct: 5  LKVDVVNAEESLFSGNAEFVALPGIEGELGILPGHTPLITLIRPGLVRIRKSAQDEEEIF 64

Query: 67 VIGGICDIVPSHCTVLSE 84
          V GG+ +I P H  VL++
Sbjct: 65 VAGGVLEIQPFHVIVLAD 82


>gi|146329853|ref|YP_001210025.1| ATP synthase F1, epsilon subunit [Dichelobacter nodosus VCS1703A]
 gi|166222456|sp|A5EXL3|ATPE_DICNV RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|146233323|gb|ABQ14301.1| ATP synthase F1, epsilon subunit [Dichelobacter nodosus VCS1703A]
          Length = 143

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 69/135 (51%), Gaps = 10/135 (7%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VSP++ +FSGEV  +V P+E G++ +L  H P++ T+K G V ++ S  E     V GG
Sbjct: 9   IVSPDRALFSGEVVQIVAPAEYGELGILSNHIPLIATLKPGQVRLTKSDGEEEVLYVSGG 68

Query: 71  ICDIVPSHCTVLSE---TILPMDNACLQALEKRIDEVCSDLNNICDVD-----QRFQME- 121
             ++      +L++       +D   ++  + R +++    +   + +     ++ Q+E 
Sbjct: 69  FIEVQSKQTIILADEAARAAELDEEKIKEAKARAEKLIKSPDGEINYERMKNYEKMQIEL 128

Query: 122 -QLLVDLSCLRRRIQ 135
            QL   L+ +RR  Q
Sbjct: 129 VQLTAQLAAIRRHRQ 143


>gi|302381247|ref|YP_003817070.1| ATPase, F1 complex, delta/subunit epsilon-like protein
          [Brevundimonas subvibrioides ATCC 15264]
 gi|302191875|gb|ADK99446.1| ATPase, F1 complex, delta/epsilon subunit-like protein
          [Brevundimonas subvibrioides ATCC 15264]
          Length = 89

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   L F LVSPE+ VFSG V  V  P   GD  VL  HAP +T ++ G V +       
Sbjct: 1  MAGKLSFSLVSPEREVFSGLVDQVDAPGVEGDFGVLADHAPFMTALREGPVVV-FDGSSR 59

Query: 63 HRYVVIGGICDIVPSHCTVL 82
            + V GG  D+ P+  ++L
Sbjct: 60 RTFTVRGGFADVTPAGLSIL 79


>gi|119471626|ref|ZP_01614011.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
          [Alteromonadales bacterium TW-7]
 gi|119445405|gb|EAW26692.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
          [Alteromonadales bacterium TW-7]
          Length = 140

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+S+ +    G++ V  GHAP+LT +K G+V +     E     
Sbjct: 6  VHLDVVSAEQNLFSGLVESIQVSGSEGELGVNAGHAPLLTALKPGMVRLVKQFGEEELIY 65

Query: 67 VIGGICDIVPSHCTVLSETILPMDNACLQALEK 99
          + GG  ++ P+  TVL++T +  ++   QA E+
Sbjct: 66 IAGGTLEVQPNIVTVLADTAVRGEDLDEQAAEQ 98


>gi|297192039|ref|ZP_06909437.1| F0F1 ATP synthase subunit epsilon [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197719512|gb|EDY63420.1| F0F1 ATP synthase subunit epsilon [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 124

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 56/111 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVELVAADRSVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
               V GG      +  ++L+E     D   +Q  E+ ++   SD +   +
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEIAELADEIDVQRAERALERAKSDTDAAAE 111


>gi|282899705|ref|ZP_06307669.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Cylindrospermopsis raciborskii CS-505]
 gi|281195584|gb|EFA70517.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Cylindrospermopsis raciborskii CS-505]
          Length = 137

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 2/130 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   ++SP+K V+ G    V+LPS  G + VL GHAP+LT + +G++ +        + +
Sbjct: 3   LTIRVISPDKTVWDGPADEVILPSTTGQLGVLSGHAPMLTALDTGVMRVRAEKNASWQSI 62

Query: 67  V-IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLV 125
             +GG  ++     T+L       D   L+      +   S +N +    ++ Q+ Q   
Sbjct: 63  ALLGGFAEVEEDEVTILVNGAQRGDTINLEEARSEFNAAQSKINQVVAGHRQAQI-QATA 121

Query: 126 DLSCLRRRIQ 135
            L   R R Q
Sbjct: 122 ALKRARARFQ 131


>gi|153002860|ref|YP_001368541.1| F0F1 ATP synthase subunit epsilon [Shewanella baltica OS185]
 gi|160877607|ref|YP_001556923.1| F0F1 ATP synthase subunit epsilon [Shewanella baltica OS195]
 gi|217975447|ref|YP_002360198.1| F0F1 ATP synthase subunit epsilon [Shewanella baltica OS223]
 gi|304412686|ref|ZP_07394289.1| ATP synthase F1, epsilon subunit [Shewanella baltica OS183]
 gi|307305849|ref|ZP_07585595.1| ATP synthase F1, epsilon subunit [Shewanella baltica BA175]
 gi|166222494|sp|A6WUI9|ATPE_SHEB8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|189081376|sp|A9KX05|ATPE_SHEB9 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|254809382|sp|B8EDU9|ATPE_SHEB2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|151367478|gb|ABS10478.1| ATP synthase F1, epsilon subunit [Shewanella baltica OS185]
 gi|160863129|gb|ABX51663.1| ATP synthase F1, epsilon subunit [Shewanella baltica OS195]
 gi|217500582|gb|ACK48775.1| ATP synthase F1, epsilon subunit [Shewanella baltica OS223]
 gi|304348896|gb|EFM13311.1| ATP synthase F1, epsilon subunit [Shewanella baltica OS183]
 gi|306911342|gb|EFN41768.1| ATP synthase F1, epsilon subunit [Shewanella baltica BA175]
 gi|315269805|gb|ADT96658.1| ATP synthase F1, epsilon subunit [Shewanella baltica OS678]
          Length = 142

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
           +H ++VS E  +FSG V S+ +    G++ ++ GHAP+L+ IK G+  I      EE+  
Sbjct: 6   VHLDIVSAESKIFSGRVASLQVTGSEGELGIMHGHAPLLSYIKPGMARIVKQDGSEEV-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQ-ALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           + + GGI ++ PS  +VL++ ++   +   Q ALE +        N   D +    M +L
Sbjct: 64  FYLSGGILEVQPSTVSVLADVVMRAKDIDEQAALEAKRRAEAHMANAGADFNYDAAMVEL 123

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 124 AKAMAQLR 131


>gi|282861131|ref|ZP_06270196.1| ATP synthase F1, epsilon subunit [Streptomyces sp. ACTE]
 gi|282563789|gb|EFB69326.1| ATP synthase F1, epsilon subunit [Streptomyces sp. ACTE]
          Length = 123

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 56/111 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVELVAADRNVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
               V GG      +  ++L+E     D   +Q  E+ ++   SD +   +
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEIAELADEIDVQRAERALERAKSDTDGAAE 111


>gi|223038734|ref|ZP_03609027.1| ATP synthase F1, epsilon subunit [Campylobacter rectus RM3267]
 gi|222880136|gb|EEF15224.1| ATP synthase F1, epsilon subunit [Campylobacter rectus RM3267]
          Length = 129

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 52/82 (63%), Gaps = 2/82 (2%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          ++ LH E+V+P+  VFS +++SVVLP   G+  VL GHA +++ +K+G++ I  S ++ H
Sbjct: 1  MDKLHLEIVTPDGLVFSNDIKSVVLPGSEGEFGVLPGHASLISLLKAGVIDIE-SEDKSH 59

Query: 64 RYVVIG-GICDIVPSHCTVLSE 84
            V I  G  +I     T+L++
Sbjct: 60 DAVAINWGYAEINEGKATILAD 81


>gi|254447549|ref|ZP_05061015.1| ATP synthase F1, epsilon subunit [gamma proteobacterium HTCC5015]
 gi|198262892|gb|EDY87171.1| ATP synthase F1, epsilon subunit [gamma proteobacterium HTCC5015]
          Length = 131

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 3/107 (2%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VS E  +FSGEV  +V P   G++ +   HAP+LT +K G V I    +E     V GG
Sbjct: 3   IVSAETELFSGEVSLLVAPGAQGELGIKPKHAPLLTNLKPGEVRIKRDGQEDENIFVSGG 62

Query: 71  ICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDV 114
             ++ P+  T+L++T +    +D A     ++R +E  ++  +  DV
Sbjct: 63  YLEVQPNVVTILADTAVRAHDIDEAAAIEAKQRAEEALANRKSDMDV 109


>gi|260595803|ref|YP_003208374.1| F0F1 ATP synthase subunit epsilon [Cronobacter turicensis z3032]
 gi|260214980|emb|CBA26616.1| ATP synthase epsilon chain [Cronobacter turicensis z3032]
          Length = 139

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (51%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS EK +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEKQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEYIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P   TVL++T +    +D A  L+A  K  D + S   +  DVD      +L
Sbjct: 66  SGGVLEVQPGTVTVLADTAIRGQDLDEARALEAKRKAEDHIRS---SHGDVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|254515888|ref|ZP_05127948.1| ATP synthase F1, epsilon subunit [gamma proteobacterium NOR5-3]
 gi|219675610|gb|EED31976.1| ATP synthase F1, epsilon subunit [gamma proteobacterium NOR5-3]
          Length = 143

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 51/81 (62%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+S+V   E+G++ V  GHAP+L+ +  G V I+L   E   Y 
Sbjct: 5  IHCDIVSAEEEIFSGLVESLVATGEVGELGVNYGHAPLLSALVPGPVRITLQNGEEQVYY 64

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG  ++ P   ++L++T +
Sbjct: 65 VSGGFLEVQPGVVSILADTAI 85


>gi|322513162|ref|ZP_08066293.1| ATP synthase F1 sector epsilon subunit [Actinobacillus ureae ATCC
           25976]
 gi|322121058|gb|EFX92882.1| ATP synthase F1 sector epsilon subunit [Actinobacillus ureae ATCC
           25976]
          Length = 139

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 60/108 (55%), Gaps = 5/108 (4%)

Query: 8   HFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            FEL  VS EK +F+G+V SV +    G++ V  GH P+LT+IK G+V  +L   +    
Sbjct: 4   QFELSIVSAEKEIFNGDVVSVRVTGVDGELGVYAGHTPLLTSIKPGMVKYTLEDGKEEFI 63

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN 110
            V GG  ++ P+  TVL++  +    +D   + A +++ ++  S  NN
Sbjct: 64  YVSGGFLEVQPTIVTVLADIAIRGEELDQQRILAAKRKAEDTLSKSNN 111


>gi|329955020|ref|ZP_08296001.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Bacteroides clarus YIT 12056]
 gi|328526310|gb|EGF53325.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Bacteroides clarus YIT 12056]
          Length = 81

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LH ++VSP+K +F+GEV SV LP  LG  T+L  HAP+++++K+G +       E H   
Sbjct: 4  LHLDIVSPDKEIFNGEVDSVTLPGTLGSFTILSQHAPIVSSLKAGTLAYVTKDGEEHVQD 63

Query: 67 VIGGICDIVPSHCTV 81
          + GG  ++  +  +V
Sbjct: 64 IHGGFVEMNGNKVSV 78


>gi|88860638|ref|ZP_01135275.1| ATP synthase subunit epsilon [Pseudoalteromonas tunicata D2]
 gi|88817233|gb|EAR27051.1| ATP synthase subunit epsilon [Pseudoalteromonas tunicata D2]
          Length = 138

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS EK +FSG V+++ +    G++ +  GHAP+LT +K G+V +     +     
Sbjct: 5  VHLDVVSAEKTIFSGRVETLQVSGSEGELGIYPGHAPLLTALKPGMVRVVKQNGDEEMIY 64

Query: 67 VIGGICDIVPSHCTVLSE 84
          V GG  ++ P + TVL++
Sbjct: 65 VAGGTLEVQPGNVTVLAD 82


>gi|126209109|ref|YP_001054334.1| F0F1 ATP synthase subunit epsilon [Actinobacillus pleuropneumoniae
           L20]
 gi|166222429|sp|A3N2U3|ATPE_ACTP2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|126097901|gb|ABN74729.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 139

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 5/108 (4%)

Query: 8   HFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            FEL  VS EK +F+G V SV +    G++ V  GH P+LT+IK G+V  +L   +    
Sbjct: 4   QFELSVVSAEKEIFNGNVVSVRVSGIDGELGVYAGHTPLLTSIKPGMVKYTLENGKEEFI 63

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN 110
            V GG  ++ P+  TVL++  +    +D   + A +++ ++  S  NN
Sbjct: 64  YVSGGFLEVQPTIVTVLADVAIRGEELDQQRILAAKRKAEDTLSKSNN 111


>gi|226315032|ref|YP_002774928.1| ATP synthase epsilon chain [Brevibacillus brevis NBRC 100599]
 gi|259585476|sp|C0Z775|ATPE_BREBN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226097982|dbj|BAH46424.1| ATP synthase epsilon chain [Brevibacillus brevis NBRC 100599]
          Length = 132

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           ++ +  E+V+PE+ V+SG+ + V+     G+I ++  H P++T +K+  V I    ++  
Sbjct: 1   MSKMTVEVVTPERVVYSGQAEMVIARGLQGEIGIMPNHMPLVTPLKTAPVRIKTEGDKEV 60

Query: 64  RYVVIGGICDIVPSHCTVLSETI-LPMD------NACLQALEKRIDEVCSDLNNICDVDQ 116
           +  V GG  ++     T+L+ET  LP D       A  +  EKR+ E  ++L ++   ++
Sbjct: 61  KMAVSGGFMEVRGDKVTILAETAELPGDIDVERAKAARERAEKRLTEKYAEL-DVKRAER 119

Query: 117 RFQMEQLLVDLS 128
             Q     +D+S
Sbjct: 120 ALQRAMARLDVS 131


>gi|34496128|ref|NP_900343.1| F0F1 ATP synthase subunit epsilon [Chromobacterium violaceum ATCC
           12472]
 gi|60389719|sp|Q7P094|ATPE_CHRVO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|34101982|gb|AAQ58349.1| H+-transporting two-sector ATPase, epsilon subunit [Chromobacterium
           violaceum ATCC 12472]
          Length = 140

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 69/139 (49%), Gaps = 10/139 (7%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEE 61
           ++ +  E+VS E+ +FSGE + VV P+  G+I V   H P+LT IK G++ + +  + EE
Sbjct: 1   MSKMRVEVVSTEQLIFSGEAEFVVAPATEGEIGVYPQHVPLLTRIKPGVLRLKVPGTKEE 60

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMD-------NACLQALEKRIDEVCSDLNNICDV 114
           +    V GG+ ++ PS  TVL++T +  +       N   +A E  +     D++     
Sbjct: 61  V-LVAVSGGMMEVQPSLITVLADTAIRGEDLDEARANEAKRAAEDALKHATDDMSTAKAH 119

Query: 115 DQRFQMEQLLVDLSCLRRR 133
                    L  L  L++R
Sbjct: 120 AALAVAIAELKTLDYLKKR 138


>gi|285019665|ref|YP_003377376.1| ATP synthase subunit epsilon [Xanthomonas albilineans GPE PC73]
 gi|283474883|emb|CBA17382.1| probable atp synthase epsilon subunit protein [Xanthomonas
           albilineans]
          Length = 140

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E  ++ GE   VV+  ELG++ +   HAP++T +K G V ++ +  E   + + G
Sbjct: 7   DIVSAENEIYHGEATLVVVTGELGELGIAPKHAPLITRLKPGKVVVTTASGEQLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           GI ++ P   T+L++T +    +D A ++  ++  + + +      DV + + ++ Q+  
Sbjct: 67  GILEVQPQVVTILADTAIRAQDIDEASVRKAKEEAERLLAGRGEGIDVAEAQAKLAQVTA 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|189462118|ref|ZP_03010903.1| hypothetical protein BACCOP_02798 [Bacteroides coprocola DSM
          17136]
 gi|189431199|gb|EDV00184.1| hypothetical protein BACCOP_02798 [Bacteroides coprocola DSM
          17136]
          Length = 81

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          + ++H  +VSPE+ +F G+V  V LP E+G+  VL  HAP+++++ +G ++ + S  E  
Sbjct: 1  MKEMHLVIVSPERMLFDGKVSQVTLPGEMGEFQVLTNHAPIISSLVAGKISYT-SGAETQ 59

Query: 64 RYVVIGGICDIVPSHCTV 81
             + GG  DI  +  +V
Sbjct: 60 SLQIAGGFADINNNQISV 77


>gi|110636760|ref|YP_676967.1| H+-transporting two-sector ATPase subunit epsilon [Cytophaga
          hutchinsonii ATCC 33406]
 gi|110279441|gb|ABG57627.1| ATP synthase F1 subcomplex epsilon subunit [Cytophaga
          hutchinsonii ATCC 33406]
          Length = 80

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 52/81 (64%), Gaps = 1/81 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          ++ E+++P++ VFSG++ SV +P   G   VL  HA +++T++ G VTI L+ EE   + 
Sbjct: 1  MYLEILTPDQKVFSGDITSVQVPGTSGRFEVLTNHAAIISTLEKGDVTIRLAKEE-KVFK 59

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          + GG+ +++     VL+E IL
Sbjct: 60 IDGGVVEVLHDKVIVLAEAIL 80


>gi|292493903|ref|YP_003529342.1| ATP synthase F1 subunit epsilon [Nitrosococcus halophilus Nc4]
 gi|291582498|gb|ADE16955.1| ATP synthase F1, epsilon subunit [Nitrosococcus halophilus Nc4]
          Length = 143

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG    V  P+E+G++ ++  H P+LT +K G V +     +   + 
Sbjct: 5   MHVDVVSAEREIFSGTANMVFAPAEMGEVGIMPRHTPLLTRLKPGEVRVQRPEGQEDLFY 64

Query: 67  VIGGICDIVPSHCTVLSET---ILPMDNACLQALEKRIDEVCSDLNNICD 113
           V GG+ ++ P   TVL++T      +D A   A ++R +E   +     D
Sbjct: 65  VSGGLLEVQPHVVTVLADTAQRATDIDEAAALAAKQRAEEALRNREGEMD 114


>gi|329296426|ref|ZP_08253762.1| F0F1 ATP synthase subunit epsilon [Plautia stali symbiont]
          Length = 139

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 6   HLDVVSAEQQMFSGLVQRIQVSGSEGELGIYPGHAPLLTAIKLGMIRIVKQHGEEEYIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P   TVL++T +    +D A  L+A  K  + + S   +  DVD      +L
Sbjct: 66  SGGVLEVQPGSTTVLADTAIRGEDLDEARALEAKRKAEEHMNS---SHGDVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|320008535|gb|ADW03385.1| ATP synthase F1, epsilon subunit [Streptomyces flavogriseus ATCC
           33331]
          Length = 124

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 55/107 (51%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVELVAADRSVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLN 109
               V GG      +  ++L+E     D   +Q  E+ ++   SD +
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEIAELADEIDVQRAERALERAKSDTD 107


>gi|291615581|ref|YP_003518323.1| AtpC [Pantoea ananatis LMG 20103]
 gi|291150611|gb|ADD75195.1| AtpC [Pantoea ananatis LMG 20103]
 gi|327395851|dbj|BAK13273.1| ATP synthase epsilon chain AtpC [Pantoea ananatis AJ13355]
          Length = 139

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (51%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E  +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     +
Sbjct: 6   HLDVVSAESQLFSGLVQKIQVSGSEGELGIFPGHAPLLTAIKPGMIRIVKQHGEEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P   TVL++T +    +D A  L+A  K  + + S   +  DVD      +L
Sbjct: 66  SGGVLEVQPGSTTVLADTAIRGTDLDEARALEAKRKAEEHMNS---SHGDVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|163745701|ref|ZP_02153061.1| ATP synthase F1, epsilon subunit [Oceanibulbus indolifex HEL-45]
 gi|161382519|gb|EDQ06928.1| ATP synthase F1, epsilon subunit [Oceanibulbus indolifex HEL-45]
          Length = 146

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + + F+LVSPE+ + S +V +V +P   GD+T +  HAP +TT++ G++ +    E  
Sbjct: 1  MADTMQFDLVSPERRLASMQVTAVQIPGTEGDMTAMADHAPTITTLRPGLLRVE-GPEGT 59

Query: 63 HRYVVIGGICDI 74
            YVV GG  +I
Sbjct: 60 FEYVVTGGFAEI 71


>gi|317121019|ref|YP_004101022.1| ATP synthase F1 subcomplex subunit epsilon [Thermaerobacter
          marianensis DSM 12885]
 gi|315590999|gb|ADU50295.1| ATP synthase F1 subcomplex epsilon subunit [Thermaerobacter
          marianensis DSM 12885]
          Length = 140

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 9  FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           E+++PE+ VF  EV S+++P   G + VL  HAP++  +K GI+T   + E+  R  V 
Sbjct: 8  LEVITPERVVFREEVDSLIVPGAEGLLGVLPDHAPMVAALKIGILTYRKNGEK-RRVAVA 66

Query: 69 GGICDIVPSHCTVLSET 85
          GG  ++  +H  VLS+ 
Sbjct: 67 GGFFEVADNHAVVLSDA 83


>gi|52843174|ref|YP_096973.1| F0F1 ATP synthase subunit epsilon [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|54298985|ref|YP_125354.1| F0F1 ATP synthase subunit epsilon [Legionella pneumophila str.
          Paris]
 gi|148361321|ref|YP_001252528.1| ATP synthase F1 subunit epsilon [Legionella pneumophila str.
          Corby]
 gi|296108662|ref|YP_003620363.1| F-type H -transporting ATPase epsilon chain [Legionella
          pneumophila 2300/99 Alcoy]
 gi|81679358|sp|Q5X0P4|ATPE_LEGPA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|81680368|sp|Q5ZRA2|ATPE_LEGPH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|166222468|sp|A5III2|ATPE_LEGPC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|52630285|gb|AAU29026.1| ATP synthase epsilon chain, ATP synthase F1 epsilon subunit
          [Legionella pneumophila subsp. pneumophila str.
          Philadelphia 1]
 gi|53752770|emb|CAH14205.1| hypothetical protein lpp3052 [Legionella pneumophila str. Paris]
 gi|148283094|gb|ABQ57182.1| ATP synthase epsilon chain, ATP synthase F1 epsilon subunit
          [Legionella pneumophila str. Corby]
 gi|295650564|gb|ADG26411.1| F-type H -transporting ATPase epsilon chain [Legionella
          pneumophila 2300/99 Alcoy]
 gi|307611865|emb|CBX01581.1| hypothetical protein LPW_32681 [Legionella pneumophila 130b]
          Length = 140

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%)

Query: 8  HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
          H ++VS E  +FSG V+ VV   ELG+I +  GHAP+LT ++ G V I+L       Y V
Sbjct: 6  HLDIVSAEHEIFSGVVEMVVATGELGEIGITPGHAPLLTVLRPGEVRITLQGGTQDIYYV 65

Query: 68 IGGICDIVPSHCTVLSE 84
           GG+ ++ P   T+L++
Sbjct: 66 QGGMLEVQPHCVTILAD 82


>gi|126656479|ref|ZP_01727740.1| F0F1 ATP synthase subunit epsilon [Cyanothece sp. CCY0110]
 gi|126622165|gb|EAZ92872.1| F0F1 ATP synthase subunit epsilon [Cyanothece sp. CCY0110]
          Length = 136

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 1/102 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+ G+VQ ++LPS  G + +L GHAP+LT + +G++ +    ++     
Sbjct: 3   LTVRVITPDKTVWDGDVQEIILPSTSGQLGILSGHAPLLTALDTGVIRVRPD-KDWKSIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDL 108
           V+GG  ++      VL  +    DN    A ++  +   S L
Sbjct: 62  VMGGFAEVEQDEIKVLVNSAEAGDNIDKDAAKEEYNAAQSRL 103


>gi|307246570|ref|ZP_07528641.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307255555|ref|ZP_07537360.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307257727|ref|ZP_07539484.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307260006|ref|ZP_07541718.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306852442|gb|EFM84676.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306861404|gb|EFM93393.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306863633|gb|EFM95559.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306865842|gb|EFM97718.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
          Length = 139

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 5/108 (4%)

Query: 8   HFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            FEL  VS EK +F+G V SV +    G++ V  GH P+LT+IK G+V  +L   +    
Sbjct: 4   QFELSVVSAEKEIFNGNVVSVRVSGIDGELGVYAGHTPLLTSIKPGMVKYTLEDGKEEFI 63

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN 110
            V GG  ++ P+  TVL++  +    +D   + A +++ ++  S  NN
Sbjct: 64  YVSGGFLEVQPTIVTVLADVAIRGEELDQQRILAAKRKAEDTLSKSNN 111


>gi|209696442|ref|YP_002264373.1| F0F1 ATP synthase subunit epsilon [Aliivibrio salmonicida LFI1238]
 gi|208010396|emb|CAQ80742.1| ATP synthase epsilon subunit [Aliivibrio salmonicida LFI1238]
          Length = 140

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG V+++ +    G++ +  GH P+LT I  G+V I           
Sbjct: 6   FHLDVVSAEKSLFSGLVETIQVTGSEGELGIFHGHTPLLTAITPGMVRIVKQHGHEEYIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GGI ++ P   TVL++T +    +D A  +  +++ +E      NI +        Q 
Sbjct: 66  VSGGIVEVQPGSATVLADTAIRGEDLDAAKAEEAKRKAEE------NIKNQHGDINFAQA 119

Query: 124 LVDLS 128
             DL+
Sbjct: 120 ASDLA 124


>gi|56551138|ref|YP_161977.1| F0F1 ATP synthase subunit epsilon [Zymomonas mobilis subsp.
          mobilis ZM4]
 gi|241761494|ref|ZP_04759582.1| H+transporting two-sector ATPase delta/epsilon subunit [Zymomonas
          mobilis subsp. mobilis ATCC 10988]
 gi|260753211|ref|YP_003226104.1| F0F1 ATP synthase subunit epsilon [Zymomonas mobilis subsp.
          mobilis NCIMB 11163]
 gi|56542712|gb|AAV88866.1| H+transporting two-sector ATPase delta/epsilon subunit [Zymomonas
          mobilis subsp. mobilis ZM4]
 gi|241374401|gb|EER63898.1| H+transporting two-sector ATPase delta/epsilon subunit [Zymomonas
          mobilis subsp. mobilis ATCC 10988]
 gi|258552574|gb|ACV75520.1| H+transporting two-sector ATPase delta/epsilon subunit [Zymomonas
          mobilis subsp. mobilis NCIMB 11163]
          Length = 88

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 6  DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH-R 64
          +LH+ELV+P +   SG+   VV+P   GD+ V+ GH P +T I+ G V I  S  +I  +
Sbjct: 3  ELHYELVTPSRLARSGDAFMVVVPGTEGDLGVMAGHMPTMTAIRDGEVAIYSSEHQIETK 62

Query: 65 YVVIGGICDIVPSHCTVLSE 84
          + + GG  +I      +L+E
Sbjct: 63 FHISGGFAEINEKGLIILAE 82


>gi|84393417|ref|ZP_00992174.1| ATP synthase subunit epsilon [Vibrio splendidus 12B01]
 gi|86147153|ref|ZP_01065469.1| ATP synthase subunit epsilon [Vibrio sp. MED222]
 gi|218711022|ref|YP_002418643.1| F0F1 ATP synthase subunit epsilon [Vibrio splendidus LGP32]
 gi|84375933|gb|EAP92823.1| ATP synthase subunit epsilon [Vibrio splendidus 12B01]
 gi|85835037|gb|EAQ53179.1| ATP synthase subunit epsilon [Vibrio sp. MED222]
 gi|218324041|emb|CAV20403.1| ATP synthase epsilon chain [Vibrio splendidus LGP32]
          Length = 140

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I      EEI  
Sbjct: 6   FHLDVVSAEKQIFSGLVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKQHGHEEI-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDN-ACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
             V GG+ ++ P   TVL++T +  +     +A E +   V +  N   D+D      +L
Sbjct: 64  IYVSGGMVEVQPGTATVLADTAIRGEELDAAKAEEAKRKAVENIQNQHGDIDFAQAAGEL 123

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 124 AKAIAQLR 131


>gi|313496402|gb|ADR57768.1| AtpC [Pseudomonas putida BIRD-1]
          Length = 137

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 60/110 (54%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ VV    LGD+ +  GHAP++T +K G +T++        + 
Sbjct: 3   VHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGAQEVFY 62

Query: 67  VIGGICDIVPSHCTVLSETI---LPMDNA----CLQALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A     L+A E  ++   +D +
Sbjct: 63  ISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAAENALNLKGADFD 112


>gi|41179023|ref|NP_958379.1| ATP synthase CF1 epsilon subunit [Chlamydomonas reinhardtii]
 gi|114595|sp|P07891|ATPE_CHLRE RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|11431|emb|CAA37928.1| ATP synthase epsilon subunit [Chlamydomonas reinhardtii]
 gi|28269746|tpg|DAA00924.1| TPA_inf: CF1 ATP synthase epsilon subunit [Chlamydomonas
           reinhardtii]
          Length = 141

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-----SLSCEE 61
           L   +++PE+  ++G+   ++LP+E G++ VL  HAP++T +  G + I     S S +E
Sbjct: 3   LQISILTPERPFWNGQADEIILPTETGEMGVLKNHAPIITGLNVGAMLIRGGQASGSKDE 62

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
            + Y ++GG   +  +  T+L+   +  +N   +  +   +   ++L     V ++
Sbjct: 63  WNSYAIMGGFALVKQNQVTILANEAVSAENINPEEAKDAFETAKANLEKAEGVKEK 118


>gi|165977081|ref|YP_001652674.1| F0F1 ATP synthase subunit epsilon [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190150976|ref|YP_001969501.1| ATP synthase subunit epsilion [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249888|ref|ZP_07336090.1| F0F1 ATP synthase subunit epsilon [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303252036|ref|ZP_07338206.1| F0F1 ATP synthase subunit epsilon [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248694|ref|ZP_07530707.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307253312|ref|ZP_07535184.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307264333|ref|ZP_07545921.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|226740217|sp|B3H2P2|ATPE_ACTP7 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740218|sp|B0BRX1|ATPE_ACTPJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|165877182|gb|ABY70230.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189916107|gb|ACE62359.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302649100|gb|EFL79286.1| F0F1 ATP synthase subunit epsilon [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302650951|gb|EFL81105.1| F0F1 ATP synthase subunit epsilon [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306854621|gb|EFM86811.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306859176|gb|EFM91217.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306870285|gb|EFN02041.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 139

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 5/108 (4%)

Query: 8   HFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            FEL  VS EK +F+G V SV +    G++ V  GH P+LT+IK G+V  +L   +    
Sbjct: 4   QFELSVVSAEKEIFNGNVVSVRVTGIDGELGVYAGHTPLLTSIKPGMVKYTLEDGKEEFI 63

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN 110
            V GG  ++ P+  TVL++  +    +D   + A +++ ++  S  NN
Sbjct: 64  YVSGGFLEVQPTIVTVLADVAIRGEELDQQRILAAKRKAEDTLSKSNN 111


>gi|336669|gb|AAA84147.1| CF1/CF0 ATPase epsilon subunit [Chlamydomonas reinhardtii]
 gi|225837|prf||1314297A H ATPase epsilon
          Length = 141

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-----SLSCEE 61
           L   +++PE+  ++G+   ++LP+E G++ VL  HAP++T +  G + I     S S +E
Sbjct: 3   LQISILTPERPFWNGQADEIILPTETGEMGVLKNHAPIITGLNVGAMLIRGGQASGSKDE 62

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
            + Y ++GG   +  +  T+L+   +  +N   +  +   +   ++L     V ++
Sbjct: 63  WNSYAIMGGFALVKQNQVTILANEAVSAENINPEEAKDAFETAKANLEKAEGVKEK 118


>gi|269140875|ref|YP_003297576.1| F0F1-type ATP synthase, epsilon subunit [Edwardsiella tarda EIB202]
 gi|267986536|gb|ACY86365.1| F0F1-type ATP synthase, epsilon subunit [Edwardsiella tarda EIB202]
 gi|304560633|gb|ADM43297.1| ATP synthase epsilon chain [Edwardsiella tarda FL6-60]
          Length = 139

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     
Sbjct: 5   FHLDVVSAERQMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQHGEEEFIY 64

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ 116
           + GGI ++  S  TVL++T +    +D A     +++ +E     +   D  Q
Sbjct: 65  LSGGILEVQSSAVTVLADTAIRGQDLDEARAMESKRKAEEHIRSSHGDVDYAQ 117


>gi|6729899|pdb|1BSH|A Chain A, Solution Structure Of The Epsilon Subunit Of The F1-
           Atpsynthase From Escherichia Coli And Orientation Of The
           Subunit Relative To The Beta Subunits Of The Complex
 gi|6729900|pdb|1BSN|A Chain A, Solution Structure Of The Epsilon Subunit Of The F1-
           Atpsynthase From Escherichia Coli And Orientation Of The
           Subunit Relative To The Beta Subunits Of The Complex
 gi|14278248|pdb|1FS0|E Chain E, Complex Of GammaEPSILON ATP SYNTHASE FROM E.COLI
          Length = 138

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 5   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 64

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P + TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 65  SGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHG--DVDYAQASAELA 122

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 123 KAIAQLR 129


>gi|294638350|ref|ZP_06716603.1| ATP synthase F1, epsilon subunit [Edwardsiella tarda ATCC 23685]
 gi|291088603|gb|EFE21164.1| ATP synthase F1, epsilon subunit [Edwardsiella tarda ATCC 23685]
          Length = 139

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     
Sbjct: 5   FHLDVVSAERQMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQHGEEEFIY 64

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ 116
           + GGI ++  S  TVL++T +    +D A     +++ +E     +   D  Q
Sbjct: 65  LSGGILEVQSSAVTVLADTAIRGQDLDEARAMESKRKAEEHIRSSHGDVDYAQ 117


>gi|238921744|ref|YP_002935259.1| ATP synthase F1, epsilon subunit, [Edwardsiella ictaluri 93-146]
 gi|238871313|gb|ACR71024.1| ATP synthase F1, epsilon subunit, putative [Edwardsiella ictaluri
           93-146]
          Length = 137

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ +FSG VQ + +    G++ +  GHAP+LT IK G+V I     E     
Sbjct: 3   FHLDVVSAERQMFSGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQHGEEEFIY 62

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           + GGI ++  S  TVL++T +    +D A     +++ +E     +   D  Q
Sbjct: 63  LSGGILEVQSSAVTVLADTAIRGQDLDEARAMESKRKAEEHIRSSHGDVDYAQ 115


>gi|238060774|ref|ZP_04605483.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Micromonospora sp. ATCC 39149]
 gi|237882585|gb|EEP71413.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Micromonospora sp. ATCC 39149]
          Length = 94

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTI-KSGIVTISLSCEE 61
          +   LH ELV+ E+ V+SGE + VV  +  G++ VL GHAP+L  + + G V I L   E
Sbjct: 1  MAQQLHVELVAVEEKVWSGEAEMVVARTTEGELGVLPGHAPLLGQLAEPGQVRIKLPGGE 60

Query: 62 IHRYVVIGGICDIVPSHCTVLSETILPMDNA 92
             Y V GG   +     TVL+E+  P   A
Sbjct: 61 QISYEVAGGFLSVSSEGVTVLAESATPASAA 91


>gi|108773049|ref|YP_635959.1| ATP synthase CF1 epsilon subunit [Scenedesmus obliquus]
 gi|122244023|sp|Q1KVW5|ATPE_SCEOB RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|88696615|gb|ABD48241.1| CF1 epsilon subunit of ATP synthase [Scenedesmus obliquus]
          Length = 136

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 48/77 (62%), Gaps = 1/77 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++PEK  ++G+ + ++LP+E G++ VL  HAP++T +  G + +  + EE + Y 
Sbjct: 3  LQISILTPEKPFWNGQAEEIILPTETGEMGVLKNHAPIITGLDVGAMLVR-TKEEWNSYA 61

Query: 67 VIGGICDIVPSHCTVLS 83
          ++GG   +  +  T+L+
Sbjct: 62 LMGGFAVVKKNKVTILA 78


>gi|142007|gb|AAA21994.1| ATPase epsilon-subunit [Anabaena sp.]
          Length = 137

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 1/116 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEEIHRY 65
           L   ++SP+K V+  EV  V+LPS  G + +L GHAP+ T + +G++ +  S  +     
Sbjct: 3   LTVRVISPDKTVWDAEVDEVILPSTTGQLGILSGHAPLSTALDTGVLRVRTSKSQNWQAI 62

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            ++GG  ++     T+L       D   L+       +  + LN +   D++ Q++
Sbjct: 63  ALLGGFAEVEEDEVTILVNGGERGDTINLEEARTAYSQAQTKLNQVPAGDRQAQIQ 118


>gi|78224595|ref|YP_386342.1| F0F1 ATP synthase subunit epsilon [Geobacter metallireducens GS-15]
 gi|119367732|sp|Q39Q57|ATPE_GEOMG RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|78195850|gb|ABB33617.1| ATP synthase F1 subcomplex epsilon subunit [Geobacter
           metallireducens GS-15]
          Length = 138

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 63/132 (47%), Gaps = 1/132 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  +LV+P K + S EV  +     LG+ +VL GHAP LT++K G +T     +  
Sbjct: 1   MAEKLKVDLVTPYKKILSEEVDEITATGALGEFSVLPGHAPFLTSLKIGELTYKKGGQFF 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           H   V  G  ++     TVL ET    D   L+  +  +    + L  +   D+ ++ ++
Sbjct: 61  H-LAVNWGYFEVEDDKVTVLVETAERADEIDLERAKAALGRAEAALKGLSPEDKSYKTQE 119

Query: 123 LLVDLSCLRRRI 134
             ++ + +R ++
Sbjct: 120 AALERALIRMQV 131


>gi|172037725|ref|YP_001804226.1| F0F1 ATP synthase subunit epsilon [Cyanothece sp. ATCC 51142]
 gi|254809358|sp|B1WU98|ATPE_CYAA5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|171699179|gb|ACB52160.1| ATP synthase epsilon subunit [Cyanothece sp. ATCC 51142]
          Length = 136

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 2/116 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+ G+VQ  +LPS  G + +L GHAP+LT + +G++ +    +E     
Sbjct: 3   LTVRVITPDKTVWDGDVQEAILPSTSGQLGILAGHAPLLTALDTGVIRVRPD-KEWKSIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQME 121
           V+GG  ++      VL  +    D    +A +   D   S L       + R QM+
Sbjct: 62  VMGGFAEVELDEIKVLVNSAEAGDAIDKEAAKAEYDAAQSRLEEASKGGEPREQMK 117


>gi|30064964|ref|NP_839135.1| F0F1 ATP synthase subunit epsilon [Shigella flexneri 2a str. 2457T]
 gi|56480423|ref|NP_709544.2| F0F1 ATP synthase subunit epsilon [Shigella flexneri 2a str. 301]
 gi|195936358|ref|ZP_03081740.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O157:H7 str.
           EC4024]
 gi|256021247|ref|ZP_05435112.1| F0F1 ATP synthase subunit epsilon [Shigella sp. D9]
 gi|306815917|ref|ZP_07450055.1| F0F1 ATP synthase subunit epsilon [Escherichia coli NC101]
 gi|307140431|ref|ZP_07499787.1| F0F1 ATP synthase subunit epsilon [Escherichia coli H736]
 gi|6625704|gb|AAF19363.1|AF188265_9 ATP synthase subunit epsilon [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|30043225|gb|AAP18946.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Shigella
           flexneri 2a str. 2457T]
 gi|56383974|gb|AAN45251.2| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Shigella
           flexneri 2a str. 301]
 gi|305850313|gb|EFM50770.1| F0F1 ATP synthase subunit epsilon [Escherichia coli NC101]
 gi|307555870|gb|ADN48645.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Escherichia coli ABU 83972]
 gi|307628805|gb|ADN73109.1| F0F1 ATP synthase subunit epsilon [Escherichia coli UM146]
 gi|313647653|gb|EFS12101.1| ATP synthase F1, epsilon subunit [Shigella flexneri 2a str. 2457T]
 gi|320180087|gb|EFW55029.1| ATP synthase epsilon chain [Shigella boydii ATCC 9905]
 gi|320191165|gb|EFW65815.1| ATP synthase epsilon chain [Escherichia coli O157:H7 str. EC1212]
 gi|320193724|gb|EFW68357.1| ATP synthase epsilon chain [Escherichia coli WV_060327]
 gi|320639459|gb|EFX09074.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O157:H7 str.
           G5101]
 gi|320644899|gb|EFX13935.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O157:H- str.
           493-89]
 gi|320655514|gb|EFX23449.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661137|gb|EFX28573.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|323173356|gb|EFZ58985.1| ATP synthase F1, epsilon subunit [Escherichia coli LT-68]
 gi|323949974|gb|EGB45858.1| ATP synthase F1 [Escherichia coli H252]
 gi|323954974|gb|EGB50752.1| ATP synthase F1 [Escherichia coli H263]
 gi|323965799|gb|EGB61250.1| ATP synthase F1 [Escherichia coli M863]
 gi|323975201|gb|EGB70305.1| ATP synthase F1 [Escherichia coli TW10509]
 gi|324115913|gb|EGC09839.1| ATP synthase F1 [Escherichia coli E1167]
 gi|332084603|gb|EGI89797.1| ATP synthase F1, epsilon subunit [Shigella boydii 5216-82]
 gi|332345721|gb|AEE59055.1| ATP synthase F1, epsilon subunit AtpC [Escherichia coli UMNK88]
          Length = 137

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 4   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 63

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P + TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 64  SGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHG--DVDYAQASAELA 121

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 122 KAIAQLR 128


>gi|148550494|ref|YP_001270596.1| F0F1 ATP synthase subunit epsilon [Pseudomonas putida F1]
 gi|166990387|sp|A5WBA2|ATPE_PSEP1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|148514552|gb|ABQ81412.1| ATP synthase F1, epsilon subunit [Pseudomonas putida F1]
          Length = 139

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 48/80 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ VV    LGD+ +  GHAP++T +K G +T++        + 
Sbjct: 5  VHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGAQEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 65 ISGGFLEVQPNMVKVLADTV 84


>gi|119355898|ref|YP_910542.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Chlorobium phaeobacteroides DSM 266]
 gi|119353247|gb|ABL64118.1| ATP synthase F1 subcomplex epsilon subunit [Chlorobium
          phaeobacteroides DSM 266]
          Length = 88

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 47/77 (61%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+V+P++  FSGE+QS++ P   G   VL  HAP+L+ +K+G V ++L+ +    + +  
Sbjct: 11 EIVTPQQQYFSGEIQSIIAPGRDGLFQVLKSHAPLLSALKNGTVRLTLANKSEKTFTISD 70

Query: 70 GICDIVPSHCTVLSETI 86
          G  ++  +   +L+E I
Sbjct: 71 GFFEVSNNKAILLTEEI 87


>gi|16131599|ref|NP_418187.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli str. K-12 substr. MG1655]
 gi|26250475|ref|NP_756515.1| F0F1 ATP synthase subunit epsilon [Escherichia coli CFT073]
 gi|74314243|ref|YP_312662.1| F0F1 ATP synthase subunit epsilon [Shigella sonnei Ss046]
 gi|82779077|ref|YP_405426.1| F0F1 ATP synthase subunit epsilon [Shigella dysenteriae Sd197]
 gi|89110276|ref|AP_004056.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli str. K-12 substr. W3110]
 gi|91213256|ref|YP_543242.1| F0F1 ATP synthase subunit epsilon [Escherichia coli UTI89]
 gi|110644072|ref|YP_671802.1| F0F1 ATP synthase subunit epsilon [Escherichia coli 536]
 gi|110807555|ref|YP_691075.1| F0F1 ATP synthase subunit epsilon [Shigella flexneri 5 str. 8401]
 gi|157157156|ref|YP_001465222.1| F0F1 ATP synthase subunit epsilon [Escherichia coli E24377A]
 gi|157163213|ref|YP_001460531.1| F0F1 ATP synthase subunit epsilon [Escherichia coli HS]
 gi|170022232|ref|YP_001727186.1| F0F1 ATP synthase subunit epsilon [Escherichia coli ATCC 8739]
 gi|170083232|ref|YP_001732552.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170682907|ref|YP_001746061.1| F0F1 ATP synthase subunit epsilon [Escherichia coli SMS-3-5]
 gi|187775713|ref|ZP_02797227.2| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188024738|ref|ZP_02773561.2| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|188495845|ref|ZP_03003115.1| ATP synthase F1, epsilon subunit [Escherichia coli 53638]
 gi|189010127|ref|ZP_02804973.2| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189401850|ref|ZP_02778640.2| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189402777|ref|ZP_02791238.2| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189404882|ref|ZP_02811581.2| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|189405729|ref|ZP_02823786.2| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|191165803|ref|ZP_03027641.1| ATP synthase F1, epsilon subunit [Escherichia coli B7A]
 gi|191170513|ref|ZP_03032066.1| ATP synthase F1, epsilon subunit [Escherichia coli F11]
 gi|193063855|ref|ZP_03044942.1| ATP synthase F1, epsilon subunit [Escherichia coli E22]
 gi|193069195|ref|ZP_03050152.1| ATP synthase F1, epsilon subunit [Escherichia coli E110019]
 gi|194428110|ref|ZP_03060654.1| ATP synthase F1, epsilon subunit [Escherichia coli B171]
 gi|194431351|ref|ZP_03063644.1| ATP synthase F1, epsilon subunit [Shigella dysenteriae 1012]
 gi|194435700|ref|ZP_03067803.1| ATP synthase F1, epsilon subunit [Escherichia coli 101-1]
 gi|208807440|ref|ZP_03249777.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208812283|ref|ZP_03253612.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820751|ref|ZP_03261071.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209399630|ref|YP_002273259.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209921212|ref|YP_002295296.1| F0F1 ATP synthase subunit epsilon [Escherichia coli SE11]
 gi|215489069|ref|YP_002331500.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218551265|ref|YP_002385057.1| F0F1 ATP synthase subunit epsilon [Escherichia fergusonii ATCC
           35469]
 gi|218556302|ref|YP_002389216.1| F0F1 ATP synthase subunit epsilon [Escherichia coli IAI1]
 gi|218560806|ref|YP_002393719.1| F0F1 ATP synthase subunit epsilon [Escherichia coli S88]
 gi|218692019|ref|YP_002400231.1| F0F1 ATP synthase subunit epsilon [Escherichia coli ED1a]
 gi|218697457|ref|YP_002405124.1| F0F1 ATP synthase subunit epsilon [Escherichia coli 55989]
 gi|218702581|ref|YP_002410210.1| F0F1 ATP synthase subunit epsilon [Escherichia coli IAI39]
 gi|218707377|ref|YP_002414896.1| F0F1 ATP synthase subunit epsilon [Escherichia coli UMN026]
 gi|227883953|ref|ZP_04001758.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli 83972]
 gi|237703532|ref|ZP_04534013.1| predicted protein [Escherichia sp. 3_2_53FAA]
 gi|238902822|ref|YP_002928618.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli BW2952]
 gi|253775634|ref|YP_003038465.1| F0F1 ATP synthase subunit epsilon [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254038950|ref|ZP_04873002.1| predicted protein [Escherichia sp. 1_1_43]
 gi|254163683|ref|YP_003046791.1| F0F1 ATP synthase subunit epsilon [Escherichia coli B str. REL606]
 gi|254795737|ref|YP_003080574.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O157:H7 str.
           TW14359]
 gi|256025538|ref|ZP_05439403.1| F0F1 ATP synthase subunit epsilon [Escherichia sp. 4_1_40B]
 gi|260846484|ref|YP_003224262.1| F1 sector of membrane-bound ATP synthase, epsilon subunit AtpC
           [Escherichia coli O103:H2 str. 12009]
 gi|260857854|ref|YP_003231745.1| F1 sector of membrane-bound ATP synthase, epsilon subunit AtpC
           [Escherichia coli O26:H11 str. 11368]
 gi|260870465|ref|YP_003236867.1| F1 sector of membrane-bound ATP synthase, epsilon subunit AtpC
           [Escherichia coli O111:H- str. 11128]
 gi|261225888|ref|ZP_05940169.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258933|ref|ZP_05951466.1| F1 sector of membrane-bound ATP synthase, epsilon subunit AtpC
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291285155|ref|YP_003501973.1| ATP synthase subunit epsilon [Escherichia coli O55:H7 str. CB9615]
 gi|293407368|ref|ZP_06651290.1| atpC [Escherichia coli FVEC1412]
 gi|293413181|ref|ZP_06655847.1| ATP synthase F1 [Escherichia coli B354]
 gi|293417204|ref|ZP_06659831.1| ATP synthase F1 [Escherichia coli B185]
 gi|293464057|ref|ZP_06664471.1| ATP synthase F1 [Escherichia coli B088]
 gi|298383110|ref|ZP_06992705.1| ATP synthase subunit epsilon [Escherichia coli FVEC1302]
 gi|300815014|ref|ZP_07095239.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 107-1]
 gi|300824559|ref|ZP_07104669.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 119-7]
 gi|300896060|ref|ZP_07114619.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 198-1]
 gi|300902987|ref|ZP_07120930.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 84-1]
 gi|300916400|ref|ZP_07133140.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 115-1]
 gi|300925561|ref|ZP_07141434.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 182-1]
 gi|300940917|ref|ZP_07155443.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 21-1]
 gi|300950647|ref|ZP_07164542.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 116-1]
 gi|300958739|ref|ZP_07170856.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 175-1]
 gi|300983827|ref|ZP_07176769.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 200-1]
 gi|300984355|ref|ZP_07176961.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 45-1]
 gi|301019811|ref|ZP_07183954.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 196-1]
 gi|301020869|ref|ZP_07184928.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 69-1]
 gi|301047554|ref|ZP_07194626.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 185-1]
 gi|301305620|ref|ZP_07211710.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 124-1]
 gi|301324968|ref|ZP_07218523.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 78-1]
 gi|301644407|ref|ZP_07244406.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 146-1]
 gi|307313197|ref|ZP_07592822.1| ATP synthase F1, epsilon subunit [Escherichia coli W]
 gi|309795712|ref|ZP_07690127.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 145-7]
 gi|312967859|ref|ZP_07782071.1| ATP synthase F1, epsilon subunit [Escherichia coli 2362-75]
 gi|312971977|ref|ZP_07786151.1| ATP synthase F1, epsilon subunit [Escherichia coli 1827-70]
 gi|331644458|ref|ZP_08345587.1| ATP synthase F1, epsilon subunit [Escherichia coli H736]
 gi|331649557|ref|ZP_08350643.1| ATP synthase F1, epsilon subunit [Escherichia coli M605]
 gi|331655393|ref|ZP_08356392.1| ATP synthase F1, epsilon subunit [Escherichia coli M718]
 gi|331660075|ref|ZP_08361013.1| ATP synthase F1, epsilon subunit [Escherichia coli TA206]
 gi|331665385|ref|ZP_08366286.1| ATP synthase F1, epsilon subunit [Escherichia coli TA143]
 gi|331670581|ref|ZP_08371420.1| ATP synthase F1, epsilon subunit [Escherichia coli TA271]
 gi|331679835|ref|ZP_08380505.1| ATP synthase F1, epsilon subunit [Escherichia coli H591]
 gi|331685458|ref|ZP_08386044.1| ATP synthase F1, epsilon subunit [Escherichia coli H299]
 gi|332282474|ref|ZP_08394887.1| predicted protein [Shigella sp. D9]
 gi|67462174|sp|P0A6E6|ATPE_ECOLI RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|67462175|sp|P0A6E7|ATPE_ECOL6 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|67462176|sp|P0A6E8|ATPE_SHIFL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119361430|sp|Q0TAX8|ATPE_ECOL5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119361431|sp|Q1R4K3|ATPE_ECOUT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119367785|sp|Q329S0|ATPE_SHIDS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119367786|sp|Q3YVN5|ATPE_SHISS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|123342309|sp|Q0SYU5|ATPE_SHIF8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166990381|sp|A7ZTU3|ATPE_ECO24 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166990382|sp|A8A6J4|ATPE_ECOHS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|189081363|sp|B1IX07|ATPE_ECOLC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740247|sp|B7MGF1|ATPE_ECO45 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740248|sp|B5YXD5|ATPE_ECO5E RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740249|sp|B7NR33|ATPE_ECO7I RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740250|sp|B7M587|ATPE_ECO8A RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740251|sp|B1X9V9|ATPE_ECODH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740252|sp|B7NF47|ATPE_ECOLU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740253|sp|B6I3W8|ATPE_ECOSE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740254|sp|B1LL58|ATPE_ECOSM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740256|sp|B7LK76|ATPE_ESCF3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|254809363|sp|B7UMJ6|ATPE_ECO27 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|254809364|sp|B7L881|ATPE_ECO55 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|254809365|sp|B7N2H0|ATPE_ECO81 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|259585482|sp|C4ZZ09|ATPE_ECOBW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|26110905|gb|AAN83089.1|AE016769_204 ATP synthase epsilon chain [Escherichia coli CFT073]
 gi|42278|emb|CAA23595.1| unnamed protein product [Escherichia coli]
 gi|43266|emb|CAA25783.1| unnamed protein product [Escherichia coli]
 gi|146326|gb|AAA83876.1| H+ ATPase F1 epsilon subunit [Escherichia coli]
 gi|148140|gb|AAA24738.1| ATP synthase epsilon subunit [Escherichia coli]
 gi|290580|gb|AAA62083.1| ATP synthase F1 epsilon subunit [Escherichia coli]
 gi|1790169|gb|AAC76754.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli str. K-12 substr. MG1655]
 gi|73857720|gb|AAZ90427.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Shigella
           sonnei Ss046]
 gi|81243225|gb|ABB63935.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Shigella
           dysenteriae Sd197]
 gi|85676307|dbj|BAE77557.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli str. K12 substr. W3110]
 gi|91074830|gb|ABE09711.1| membrane-bound ATP synthase F1 sector epsilon-subunit [Escherichia
           coli UTI89]
 gi|110345664|gb|ABG71901.1| ATP synthase epsilon chain [Escherichia coli 536]
 gi|110617103|gb|ABF05770.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Shigella
           flexneri 5 str. 8401]
 gi|157068893|gb|ABV08148.1| ATP synthase F1, epsilon subunit [Escherichia coli HS]
 gi|157079186|gb|ABV18894.1| ATP synthase F1, epsilon subunit [Escherichia coli E24377A]
 gi|169757160|gb|ACA79859.1| ATP synthase F1, epsilon subunit [Escherichia coli ATCC 8739]
 gi|169891067|gb|ACB04774.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170520625|gb|ACB18803.1| ATP synthase F1, epsilon subunit [Escherichia coli SMS-3-5]
 gi|187771798|gb|EDU35642.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188016885|gb|EDU55007.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|188491044|gb|EDU66147.1| ATP synthase F1, epsilon subunit [Escherichia coli 53638]
 gi|189002606|gb|EDU71592.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189359102|gb|EDU77521.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189364771|gb|EDU83190.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189373387|gb|EDU91803.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|189378847|gb|EDU97263.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|190904127|gb|EDV63838.1| ATP synthase F1, epsilon subunit [Escherichia coli B7A]
 gi|190909321|gb|EDV68907.1| ATP synthase F1, epsilon subunit [Escherichia coli F11]
 gi|192930570|gb|EDV83177.1| ATP synthase F1, epsilon subunit [Escherichia coli E22]
 gi|192957519|gb|EDV87965.1| ATP synthase F1, epsilon subunit [Escherichia coli E110019]
 gi|194413868|gb|EDX30146.1| ATP synthase F1, epsilon subunit [Escherichia coli B171]
 gi|194420806|gb|EDX36882.1| ATP synthase F1, epsilon subunit [Shigella dysenteriae 1012]
 gi|194425243|gb|EDX41227.1| ATP synthase F1, epsilon subunit [Escherichia coli 101-1]
 gi|208727241|gb|EDZ76842.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733560|gb|EDZ82247.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740874|gb|EDZ88556.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161030|gb|ACI38463.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209753898|gb|ACI75256.1| membrane-bound ATP synthase beta-subunit AtpD [Escherichia coli]
 gi|209753902|gb|ACI75258.1| membrane-bound ATP synthase beta-subunit AtpD [Escherichia coli]
 gi|209753904|gb|ACI75259.1| membrane-bound ATP synthase beta-subunit AtpD [Escherichia coli]
 gi|209753906|gb|ACI75260.1| membrane-bound ATP synthase beta-subunit AtpD [Escherichia coli]
 gi|209914471|dbj|BAG79545.1| ATP synthase epsilon subunit [Escherichia coli SE11]
 gi|215267141|emb|CAS11589.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218354189|emb|CAV00816.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli 55989]
 gi|218358807|emb|CAQ91464.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia fergusonii ATCC 35469]
 gi|218363071|emb|CAR00709.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli IAI1]
 gi|218367575|emb|CAR05359.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli S88]
 gi|218372567|emb|CAR20441.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli IAI39]
 gi|218429583|emb|CAR10541.2| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli ED1a]
 gi|218434474|emb|CAR15401.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli UMN026]
 gi|222035444|emb|CAP78189.1| ATP synthase epsilon chain [Escherichia coli LF82]
 gi|226838915|gb|EEH70942.1| predicted protein [Escherichia sp. 1_1_43]
 gi|226902796|gb|EEH89055.1| predicted protein [Escherichia sp. 3_2_53FAA]
 gi|227839231|gb|EEJ49697.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli 83972]
 gi|238861070|gb|ACR63068.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli BW2952]
 gi|242379269|emb|CAQ34076.1| ATP synthase, F1 complex, epsilon subunit, subunit of ATP synthase,
           F1 complex and ATP synthase [Escherichia coli BL21(DE3)]
 gi|253326678|gb|ACT31280.1| ATP synthase F1, epsilon subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975584|gb|ACT41255.1| F0F1 ATP synthase subunit epsilon [Escherichia coli B str. REL606]
 gi|253979740|gb|ACT45410.1| F0F1 ATP synthase subunit epsilon [Escherichia coli BL21(DE3)]
 gi|254595137|gb|ACT74498.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli O157:H7 str. TW14359]
 gi|257756503|dbj|BAI28005.1| F1 sector of membrane-bound ATP synthase, epsilon subunit AtpC
           [Escherichia coli O26:H11 str. 11368]
 gi|257761631|dbj|BAI33128.1| F1 sector of membrane-bound ATP synthase, epsilon subunit AtpC
           [Escherichia coli O103:H2 str. 12009]
 gi|257766821|dbj|BAI38316.1| F1 sector of membrane-bound ATP synthase, epsilon subunit AtpC
           [Escherichia coli O111:H- str. 11128]
 gi|260451412|gb|ACX41834.1| ATP synthase F1, epsilon subunit [Escherichia coli DH1]
 gi|281180789|dbj|BAI57119.1| ATP synthase epsilon subunit [Escherichia coli SE15]
 gi|281603129|gb|ADA76113.1| ATP synthase epsilon chain [Shigella flexneri 2002017]
 gi|284923845|emb|CBG36944.1| ATP synthase epsilon subunit [Escherichia coli 042]
 gi|290765028|gb|ADD58989.1| ATP synthase epsilon chain [Escherichia coli O55:H7 str. CB9615]
 gi|291321689|gb|EFE61125.1| ATP synthase F1 [Escherichia coli B088]
 gi|291425659|gb|EFE98695.1| atpC [Escherichia coli FVEC1412]
 gi|291431235|gb|EFF04228.1| ATP synthase F1 [Escherichia coli B185]
 gi|291468314|gb|EFF10809.1| ATP synthase F1 [Escherichia coli B354]
 gi|294492355|gb|ADE91111.1| ATP synthase F1, epsilon subunit [Escherichia coli IHE3034]
 gi|298276946|gb|EFI18464.1| ATP synthase subunit epsilon [Escherichia coli FVEC1302]
 gi|299882070|gb|EFI90281.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 196-1]
 gi|300300540|gb|EFJ56925.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 185-1]
 gi|300306856|gb|EFJ61376.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 200-1]
 gi|300314620|gb|EFJ64404.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 175-1]
 gi|300360046|gb|EFJ75916.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 198-1]
 gi|300398394|gb|EFJ81932.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 69-1]
 gi|300404982|gb|EFJ88520.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 84-1]
 gi|300408391|gb|EFJ91929.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 45-1]
 gi|300416304|gb|EFJ99614.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 115-1]
 gi|300418335|gb|EFK01646.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 182-1]
 gi|300450048|gb|EFK13668.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 116-1]
 gi|300454347|gb|EFK17840.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 21-1]
 gi|300522960|gb|EFK44029.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 119-7]
 gi|300531906|gb|EFK52968.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 107-1]
 gi|300839128|gb|EFK66888.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 124-1]
 gi|300848139|gb|EFK75899.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 78-1]
 gi|301077246|gb|EFK92052.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 146-1]
 gi|306906880|gb|EFN37389.1| ATP synthase F1, epsilon subunit [Escherichia coli W]
 gi|308120591|gb|EFO57853.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 145-7]
 gi|309704179|emb|CBJ03526.1| ATP synthase epsilon subunit [Escherichia coli ETEC H10407]
 gi|310334354|gb|EFQ00559.1| ATP synthase F1, epsilon subunit [Escherichia coli 1827-70]
 gi|312287420|gb|EFR15328.1| ATP synthase F1, epsilon subunit [Escherichia coli 2362-75]
 gi|312948297|gb|ADR29124.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315063041|gb|ADT77368.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia coli W]
 gi|315138316|dbj|BAJ45475.1| ATP synthase subunit epsilon [Escherichia coli DH1]
 gi|315254576|gb|EFU34544.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 85-1]
 gi|315285515|gb|EFU44957.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 110-3]
 gi|315292847|gb|EFU52199.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 153-1]
 gi|315296875|gb|EFU56164.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 16-3]
 gi|315618561|gb|EFU99147.1| ATP synthase F1, epsilon subunit [Escherichia coli 3431]
 gi|320201237|gb|EFW75818.1| ATP synthase epsilon chain [Escherichia coli EC4100B]
 gi|320650165|gb|EFX18661.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O157:H- str. H
           2687]
 gi|320666266|gb|EFX33272.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323155412|gb|EFZ41595.1| ATP synthase F1, epsilon subunit [Escherichia coli EPECa14]
 gi|323161017|gb|EFZ46936.1| ATP synthase F1, epsilon subunit [Escherichia coli E128010]
 gi|323167005|gb|EFZ52744.1| ATP synthase F1, epsilon subunit [Shigella sonnei 53G]
 gi|323177751|gb|EFZ63335.1| ATP synthase F1, epsilon subunit [Escherichia coli 1180]
 gi|323189536|gb|EFZ74816.1| ATP synthase F1, epsilon subunit [Escherichia coli RN587/1]
 gi|323380897|gb|ADX53165.1| ATP synthase F1, epsilon subunit [Escherichia coli KO11]
 gi|323934918|gb|EGB31296.1| ATP synthase F1 [Escherichia coli E1520]
 gi|323939206|gb|EGB35419.1| ATP synthase F1 [Escherichia coli E482]
 gi|323944207|gb|EGB40287.1| ATP synthase F1 [Escherichia coli H120]
 gi|323959797|gb|EGB55447.1| ATP synthase F1 [Escherichia coli H489]
 gi|323971210|gb|EGB66456.1| ATP synthase F1 [Escherichia coli TA007]
 gi|324008031|gb|EGB77250.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 57-2]
 gi|324012763|gb|EGB81982.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 60-1]
 gi|324018471|gb|EGB87690.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 117-3]
 gi|324111630|gb|EGC05611.1| ATP synthase F1 [Escherichia fergusonii B253]
 gi|325499537|gb|EGC97396.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Escherichia fergusonii ECD227]
 gi|326341587|gb|EGD65376.1| ATP synthase epsilon chain [Escherichia coli O157:H7 str. 1125]
 gi|327250883|gb|EGE62585.1| ATP synthase F1, epsilon subunit [Escherichia coli STEC_7v]
 gi|330908044|gb|EGH36563.1| ATP synthase epsilon chain [Escherichia coli AA86]
 gi|331036752|gb|EGI08978.1| ATP synthase F1, epsilon subunit [Escherichia coli H736]
 gi|331042055|gb|EGI14199.1| ATP synthase F1, epsilon subunit [Escherichia coli M605]
 gi|331047408|gb|EGI19486.1| ATP synthase F1, epsilon subunit [Escherichia coli M718]
 gi|331053290|gb|EGI25323.1| ATP synthase F1, epsilon subunit [Escherichia coli TA206]
 gi|331057895|gb|EGI29881.1| ATP synthase F1, epsilon subunit [Escherichia coli TA143]
 gi|331062643|gb|EGI34563.1| ATP synthase F1, epsilon subunit [Escherichia coli TA271]
 gi|331073007|gb|EGI44332.1| ATP synthase F1, epsilon subunit [Escherichia coli H591]
 gi|331077829|gb|EGI49041.1| ATP synthase F1, epsilon subunit [Escherichia coli H299]
 gi|332084731|gb|EGI89917.1| ATP synthase F1, epsilon subunit [Shigella dysenteriae 155-74]
 gi|332104826|gb|EGJ08172.1| predicted protein [Shigella sp. D9]
 gi|332750740|gb|EGJ81148.1| ATP synthase F1, epsilon subunit [Shigella flexneri 4343-70]
 gi|332750906|gb|EGJ81312.1| ATP synthase F1, epsilon subunit [Shigella flexneri K-671]
 gi|332751778|gb|EGJ82176.1| ATP synthase F1, epsilon subunit [Shigella flexneri 2747-71]
 gi|332764012|gb|EGJ94249.1| ATP synthase F1, epsilon subunit [Shigella flexneri 2930-71]
 gi|332995978|gb|EGK15605.1| ATP synthase F1, epsilon subunit [Shigella flexneri VA-6]
 gi|332997504|gb|EGK17120.1| ATP synthase F1, epsilon subunit [Shigella flexneri K-218]
 gi|332998045|gb|EGK17650.1| ATP synthase F1, epsilon subunit [Shigella flexneri K-272]
 gi|333013472|gb|EGK32843.1| ATP synthase F1, epsilon subunit [Shigella flexneri K-304]
 gi|333013705|gb|EGK33070.1| ATP synthase F1, epsilon subunit [Shigella flexneri K-227]
          Length = 139

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P + TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 66  SGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHG--DVDYAQASAELA 123

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 124 KAIAQLR 130


>gi|41039|emb|CAA23528.1| unnamed protein product [Escherichia coli]
          Length = 133

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P + TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 66  SGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHG--DVDYAQASAELA 123

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 124 KAIAQLR 130


>gi|251793676|ref|YP_003008406.1| F0F1 ATP synthase subunit epsilon [Aggregatibacter aphrophilus
           NJ8700]
 gi|247535073|gb|ACS98319.1| ATP synthase F1, epsilon subunit [Aggregatibacter aphrophilus
           NJ8700]
          Length = 142

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +FSG+V+S+      G++ VL GH P+LT IK GIV ++L  +      
Sbjct: 4   FNLTVVSAEEKIFSGDVKSIQATGIEGELGVLPGHTPLLTAIKPGIVKLTLEDDNEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKR----IDEVCSDLN 109
           V GG  ++ P+  TVL++  +    +D+  + A +KR    I E  SD N
Sbjct: 64  VSGGFLEVQPTIVTVLADVAIRGNELDSERILAAKKRAEDNIREHHSDAN 113


>gi|54310641|ref|YP_131661.1| F0F1 ATP synthase subunit epsilon [Photobacterium profundum SS9]
 gi|81697255|sp|Q6LLG9|ATPE1_PHOPR RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
           synthase F1 sector epsilon subunit 1; AltName:
           Full=F-ATPase epsilon subunit 1
 gi|46915084|emb|CAG21859.1| Putative AtpC, ATP synthase F1, epsilon subunit [Photobacterium
           profundum SS9]
          Length = 140

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG  +SV +    G++ +  GH P+LT I  G+V I     E     
Sbjct: 6   FHLDVVSAEKKLFSGRAESVQVSGSEGELGIHAGHTPLLTAITPGMVRIIKQHGEEEIIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           + GG+ ++ PS  TVL++T +    +D A     +++ +E   + +   D  Q
Sbjct: 66  LSGGMLEVQPSTVTVLTDTAIRGEDLDAAKAAEAKRQAEEQIRNQHGDIDFAQ 118


>gi|315128168|ref|YP_004070171.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Pseudoalteromonas sp. SM9913]
 gi|315016681|gb|ADT70019.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Pseudoalteromonas sp. SM9913]
          Length = 140

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 2/127 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG V+S+ +    G++ V  GHAP+LT +K G+V +     E     
Sbjct: 6   VHLDVVSAEEKLFSGLVESIQVSGSEGELGVNAGHAPLLTALKPGMVRLVKQFGEEELIY 65

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALE--KRIDEVCSDLNNICDVDQRFQMEQLL 124
           + GG  ++ P+  TVL++T +  ++   +A E  KR  E         ++D      QL 
Sbjct: 66  IAGGTLEVQPNIVTVLADTAVRGEDLDEKAAEQAKRDAEAQMAKGASAELDYNQAAMQLA 125

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 126 EAIAQLR 132


>gi|167036416|ref|YP_001671647.1| F0F1 ATP synthase subunit epsilon [Pseudomonas putida GB-1]
 gi|189081373|sp|B0KRA7|ATPE_PSEPG RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166862904|gb|ABZ01312.1| ATP synthase F1, epsilon subunit [Pseudomonas putida GB-1]
          Length = 139

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 60/110 (54%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ VV    LGD+ +  GHAP++T +K G +T++        + 
Sbjct: 5   VHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGTQEVFY 64

Query: 67  VIGGICDIVPSHCTVLSETI---LPMDNA----CLQALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A     L+A E  ++   +D +
Sbjct: 65  ISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAAENALNLKGADFD 114


>gi|6573687|pdb|1QO1|J Chain J, Molecular Architecture Of The Rotary Motor In Atp Synthase
           From Yeast Mitochondria
 gi|157830030|pdb|1AQT|A Chain A, Epsilon Subunit Of F1f0-Atp Synthase From Escherichia Coli
          Length = 138

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 5   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 64

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P + TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 65  SGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHG--DVDYAQASAELA 122

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 123 KAIAQLR 129


>gi|110835586|ref|YP_694445.1| ATP synthase subunit epsilon [Alcanivorax borkumensis SK2]
 gi|119361408|sp|Q0VKX5|ATPE_ALCBS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|110648697|emb|CAL18173.1| ATP synthase, epsilon subunit [Alcanivorax borkumensis SK2]
          Length = 139

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (57%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+ VV     GD+ ++ GHAP+LT +K G V +     E   + 
Sbjct: 5  VHCDIVSAERQLFSGLVEIVVASGVEGDLGIMPGHAPLLTRLKPGPVRVKKQNGEEEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          V GG  ++ P   TVL++T    +N
Sbjct: 65 VSGGFLEVQPKLVTVLADTAERAEN 89


>gi|28198343|ref|NP_778657.1| F0F1 ATP synthase subunit epsilon [Xylella fastidiosa Temecula1]
 gi|71276028|ref|ZP_00652309.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Xylella
           fastidiosa Dixon]
 gi|71899449|ref|ZP_00681607.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Xylella
           fastidiosa Ann-1]
 gi|170729690|ref|YP_001775123.1| F0F1 ATP synthase subunit epsilon [Xylella fastidiosa M12]
 gi|182680984|ref|YP_001829144.1| F0F1 ATP synthase subunit epsilon [Xylella fastidiosa M23]
 gi|28056413|gb|AAO28306.1| ATP synthase epsilon chain [Xylella fastidiosa Temecula1]
 gi|71163111|gb|EAO12832.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Xylella
           fastidiosa Dixon]
 gi|71730762|gb|EAO32835.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Xylella
           fastidiosa Ann-1]
 gi|167964483|gb|ACA11493.1| ATP synthase epsilon chain [Xylella fastidiosa M12]
 gi|182631094|gb|ACB91870.1| ATP synthase F1, epsilon subunit [Xylella fastidiosa M23]
 gi|307579452|gb|ADN63421.1| F0F1 ATP synthase subunit epsilon [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 143

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 72/142 (50%), Gaps = 7/142 (4%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           M+ ++ +  ++VS E+ +F GE   VV   ELG++ +   HAP++T +K G V I+    
Sbjct: 1   MASMSTIRCDIVSAEQEIFHGEATFVVATGELGELGIAPKHAPLITRLKPGKVVITTVNG 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120
           E   + + GGI ++ P   T+L+++ +  D     A+ K  +E    L N  +     + 
Sbjct: 61  EQLDFAISGGILEVQPQVVTILADSAIRADTIDEVAVRKAKEEAERILANRGETIDVAKA 120

Query: 121 EQLLVD-------LSCLRRRIQ 135
           +Q LV+       L  LRR ++
Sbjct: 121 QQQLVEAVVQMQALERLRRTVK 142


>gi|261250660|ref|ZP_05943235.1| ATP synthase epsilon chain [Vibrio orientalis CIP 102891]
 gi|260939229|gb|EEX95216.1| ATP synthase epsilon chain [Vibrio orientalis CIP 102891]
          Length = 140

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG V++  +    G++ +  GH P+LT I  G+V +           
Sbjct: 6   FHLDVVSAEKKIFSGLVETFQVTGSEGELGIYHGHTPLLTAITPGMVRLVKQHGHEEFIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           V GG+ ++ P   TVL++T +    +D A  +  ++R  E   + +   D  Q
Sbjct: 66  VSGGMVEVQPGTATVLADTAIRGDELDAAKAEEAKRRAQEAIQNQHGDMDFAQ 118


>gi|254429070|ref|ZP_05042777.1| ATP synthase F1, epsilon subunit [Alcanivorax sp. DG881]
 gi|196195239|gb|EDX90198.1| ATP synthase F1, epsilon subunit [Alcanivorax sp. DG881]
          Length = 140

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (57%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+ VV     GD+ ++ GHAP+LT +K G V +     E   + 
Sbjct: 5  VHCDIVSAERQLFSGLVEIVVASGVEGDLGIMPGHAPLLTRLKPGPVRVKKQNGEEEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          V GG  ++ P   TVL++T    +N
Sbjct: 65 VSGGFLEVQPKLVTVLADTAERAEN 89


>gi|126176546|ref|YP_001052695.1| F0F1 ATP synthase subunit epsilon [Shewanella baltica OS155]
 gi|166222493|sp|A3DAR3|ATPE_SHEB5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|125999751|gb|ABN63826.1| ATP synthase F1, epsilon subunit [Shewanella baltica OS155]
          Length = 142

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
           +H ++VS E  +FSG V S+ +    G++ ++ GHAP+L+ IK G+  I      EE+  
Sbjct: 6   VHLDIVSAESKIFSGRVVSLQVTGSEGELGIMHGHAPLLSYIKPGMARIVKQDGSEEV-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQ-ALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           + + GGI ++ PS  +VL++ ++   +   Q ALE +        N   D +    M +L
Sbjct: 64  FYLSGGILEVQPSTVSVLADVVMRAKDIDEQAALEAKRRAEAHMANAGADFNYDAAMVEL 123

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 124 AKAMAQLR 131


>gi|327482890|gb|AEA86200.1| F0F1 ATP synthase subunit epsilon [Pseudomonas stutzeri DSM 4166]
          Length = 140

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+ V+    LGDI VL GHAP+LT +K G V +     E   + 
Sbjct: 3  VHCDIVSAEEELFSGLVEMVIAHGNLGDIGVLPGHAPLLTDLKPGPVRVIKQGGEEEIFY 62

Query: 67 VIGGICDIVPSHCTVLSET 85
          + GG  ++ P+   VL++T
Sbjct: 63 ISGGFIEVQPNMVKVLADT 81


>gi|15837744|ref|NP_298432.1| F0F1 ATP synthase subunit epsilon [Xylella fastidiosa 9a5c]
 gi|9106106|gb|AAF83952.1|AE003950_2 ATP synthase, epsilon chain [Xylella fastidiosa 9a5c]
          Length = 143

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 74/136 (54%), Gaps = 4/136 (2%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           M+ ++ +  ++VS E+ +F GE   VV   ELG++ ++  HAP++T +K G V I+    
Sbjct: 1   MASMSTIRCDIVSAEQEIFHGEATLVVATGELGELGIVPKHAPLITRLKPGKVIITTVNG 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ- 116
           E   + + GGI ++ P   T+L+++ +    +D   ++  ++  + + ++     DV + 
Sbjct: 61  EQLDFAISGGILEVQPQVVTILADSAIRADTIDEVAVRKAKEEAERILANRGETIDVAKA 120

Query: 117 RFQMEQLLVDLSCLRR 132
           + Q+ + +V +  L R
Sbjct: 121 QQQLVEAVVQMQALER 136


>gi|26992087|ref|NP_747512.1| F0F1 ATP synthase subunit epsilon [Pseudomonas putida KT2440]
 gi|38257477|sp|Q88BX5|ATPE_PSEPK RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|24987229|gb|AAN70976.1|AE016742_5 ATP synthase F1, epsilon subunit [Pseudomonas putida KT2440]
          Length = 139

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 60/110 (54%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ VV    LGD+ +  GHAP++T +K G +T++        + 
Sbjct: 5   VHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGAHEVFY 64

Query: 67  VIGGICDIVPSHCTVLSETI---LPMDNA----CLQALEKRIDEVCSDLN 109
           + GG  ++ P+   VL++T+     +D A     L+A E  ++   +D +
Sbjct: 65  ISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAAENALNLKGADFD 114


>gi|307250940|ref|ZP_07532866.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306856968|gb|EFM89098.1| ATP synthase epsilon chain [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
          Length = 139

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 5/108 (4%)

Query: 8   HFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            FEL  VS EK +F+G V SV +    G++ V  GH P+LT+IK G+V  +L   +    
Sbjct: 4   QFELSVVSAEKEIFNGNVVSVRVTGIDGELGVYAGHMPLLTSIKPGMVKYTLEDGKEEFI 63

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNN 110
            V GG  ++ P+  TVL++  +    +D   + A +++ ++  S  NN
Sbjct: 64  YVSGGFLEVQPTIVTVLADVAIRGEELDQQRILAAKRKAEDTLSKSNN 111


>gi|71901249|ref|ZP_00683349.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Xylella
           fastidiosa Ann-1]
 gi|71728982|gb|EAO31113.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Xylella
           fastidiosa Ann-1]
          Length = 143

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 72/142 (50%), Gaps = 7/142 (4%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           M+ ++ +  ++VS E+ +F GE   VV   ELG++ +   HAP++T +K G V I+    
Sbjct: 1   MASMSTIRCDIVSAEQEIFHGEATFVVATGELGELGIAPKHAPLITRLKPGKVVITTVNG 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120
           E   + + GGI ++ P   T+L+++ +  D     A+ K  +E    L N  +     + 
Sbjct: 61  EQLDFAISGGILEVQPQVITILADSAIRADTIDEVAVRKAKEEAERILANRGETIDVAKA 120

Query: 121 EQLLVD-------LSCLRRRIQ 135
           +Q LV+       L  LRR ++
Sbjct: 121 QQQLVEAVVQMQALERLRRTVK 142


>gi|54295819|ref|YP_128234.1| F0F1 ATP synthase subunit epsilon [Legionella pneumophila str.
          Lens]
 gi|81679107|sp|Q5WSG9|ATPE_LEGPL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|53755651|emb|CAH17153.1| hypothetical protein lpl2909 [Legionella pneumophila str. Lens]
          Length = 140

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%)

Query: 8  HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
          H ++VS E  +FSG V+ VV   ELG+I +  GHAP+LT ++ G V I+L       Y V
Sbjct: 6  HLDIVSAEHEIFSGVVELVVATGELGEIGITPGHAPLLTVLRPGEVRITLQGGTQDIYYV 65

Query: 68 IGGICDIVPSHCTVLSE 84
           GG+ ++ P   T+L++
Sbjct: 66 QGGMLEVQPHCVTILAD 82


>gi|29829422|ref|NP_824056.1| F0F1 ATP synthase subunit epsilon [Streptomyces avermitilis
           MA-4680]
 gi|60389761|sp|Q82J85|ATPE_STRAW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|29606529|dbj|BAC70591.1| putative F-type proton-transporting ATPase epsilon chain
           [Streptomyces avermitilis MA-4680]
          Length = 124

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S  E 
Sbjct: 1   MAAELHVELVAADRQVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGET 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
               V GG      +  ++L+E     D    Q  E+ ++   ++ +   +
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEIAELADEIDAQRAERELERAKAEGDATAE 111


>gi|188535582|ref|YP_001909379.1| ATP synthase, F1 complex, epsilon subunit [Erwinia tasmaniensis
           Et1/99]
 gi|226740255|sp|B2VCA3|ATPE_ERWT9 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|188030624|emb|CAO98520.1| ATP synthase, F1 complex, epsilon subunit [Erwinia tasmaniensis
           Et1/99]
          Length = 139

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ +FSG VQS+ +    G++ +   HAP+LT IK G++ I     E     
Sbjct: 5   FHLDVVSAEEQMFSGTVQSIQVSGSEGELGIRPNHAPLLTAIKPGMIRIVKQHGEEEVIY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           + GG+ ++ P   TVL++T +    +D A  +ALE +        ++  DVD      +L
Sbjct: 65  LSGGVLEVQPGAVTVLADTAIRGSDLDEA--RALEAKRKAEAHMNSSHGDVDFAVASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|148978360|ref|ZP_01814865.1| F0F1 ATP synthase subunit epsilon [Vibrionales bacterium SWAT-3]
 gi|145962519|gb|EDK27797.1| F0F1 ATP synthase subunit epsilon [Vibrionales bacterium SWAT-3]
          Length = 140

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS EK +FSG V++  +    G++ +  GH P+LT IK G+V I      EEI  
Sbjct: 6   FHLDVVSAEKKLFSGLVETFQVTGSEGELGIFHGHTPLLTAIKPGMVRIVKQHGHEEI-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDN-ACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
             V GG+ ++ P   TVL++T +  +     +A E +   V +  N   D+D      +L
Sbjct: 64  IYVSGGMVEVQPGTATVLADTAIRGEELDAAKAEEAKRKAVENIQNQHGDIDFAQAAGEL 123

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 124 AKAIAQLR 131


>gi|213517406|gb|ACJ50112.1| ATP synthase CF1 epsilon subunit [Chlamydomonas reinhardtii]
 gi|217315591|gb|ACK37280.1| ATP synthase CF1 epsilon subunit [Chlamydomonas reinhardtii]
 gi|217315593|gb|ACK37281.1| ATP synthase CF1 epsilon subunit [Chlamydomonas reinhardtii]
          Length = 141

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-----SLSCEE 61
           L   +++PE+  ++G+   ++LP+E G++ VL  HAP++T +  G + I     S S +E
Sbjct: 3   LQISILTPERPFWNGQADEIILPTETGEMGVLKNHAPIITGLDVGAMLIRGGQASGSKDE 62

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
            + Y ++GG   +  +  T+L+   +  +N   +  +   +   ++L     V ++
Sbjct: 63  WNSYAIMGGFALVKQNQVTILANEAVSAENINPEEAKDAFETAKANLEKAEGVKEK 118


>gi|237809866|ref|YP_002894306.1| F0F1 ATP synthase subunit epsilon [Tolumonas auensis DSM 9187]
 gi|237502127|gb|ACQ94720.1| ATP synthase F1, epsilon subunit [Tolumonas auensis DSM 9187]
          Length = 140

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEEIHRY 65
           H ++VS E  +FSG V+SV +    G++ +  GHAP+LT+IK G+V  + L   E   Y
Sbjct: 6  FHLDVVSAEGMLFSGRVESVQVSGAEGELGIRHGHAPLLTSIKPGLVRLVKLHGAEEVMY 65

Query: 66 VVIGGICDIVPSHCTVLSETIL 87
          +  GG+ ++ P   TVL++T++
Sbjct: 66 IS-GGMLEVQPEAATVLADTVI 86


>gi|254498169|ref|ZP_05110919.1| F0F1 ATP synthase subunit epsilon [Legionella drancourtii LLAP12]
 gi|254352608|gb|EET11393.1| F0F1 ATP synthase subunit epsilon [Legionella drancourtii LLAP12]
          Length = 102

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (62%)

Query: 9  FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           ++VS E  +FSG V+ VV   ELG++ +  GHAP+LT +K G V ++L   E   Y V 
Sbjct: 1  MDIVSAEHEIFSGLVELVVATGELGEVGIGAGHAPLLTVLKPGEVRLTLPGGEQDIYYVQ 60

Query: 69 GGICDIVPSHCTVLSETI 86
          GG+ ++ P+  T+L++ +
Sbjct: 61 GGMLEVQPNCVTILADVV 78


>gi|329847479|ref|ZP_08262507.1| ATP synthase epsilon chain [Asticcacaulis biprosthecum C19]
 gi|328842542|gb|EGF92111.1| ATP synthase epsilon chain [Asticcacaulis biprosthecum C19]
          Length = 91

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   LH  LV+PE  +F GEV  VV P   G+  VL  H+P +TT+  G V I L     
Sbjct: 1  MAEKLHVSLVTPEAKLFEGEVDQVVAPGSEGEFGVLANHSPFMTTLAEGPVVI-LDGTSK 59

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
            + V GG  D+     T+L+E+
Sbjct: 60 RVFQVRGGFADVSEDGMTILAES 82


>gi|282878922|ref|ZP_06287686.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella buccalis ATCC 35310]
 gi|281298921|gb|EFA91326.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella buccalis ATCC 35310]
          Length = 79

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 44/68 (64%), Gaps = 1/68 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LH  +VSPEK VF GEV+SV++P  LG   +L  HAP++++++ G+V    + ++  +  
Sbjct: 2  LHLRIVSPEKVVFDGEVESVLVPGTLGSFEILTDHAPIISSLEEGVVEYK-THQQKQKID 60

Query: 67 VIGGICDI 74
          ++GG   +
Sbjct: 61 ILGGFVQV 68


>gi|319940676|ref|ZP_08015018.1| ATP synthase subunit epsilon [Sutterella wadsworthensis 3_1_45B]
 gi|319805827|gb|EFW02594.1| ATP synthase subunit epsilon [Sutterella wadsworthensis 3_1_45B]
          Length = 139

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE-EIHRY 65
          +  ++VS E+ +FSGE + V LP   G++ ++ GH P++T I+ G V + +  E E  + 
Sbjct: 4  IKVDVVSAEEHIFSGEAELVSLPGTSGELGIMPGHLPLITLIRPGFVRVHVPGEQEPEQI 63

Query: 66 VVIGGICDIVPSHCTVLSET 85
           V GG+ ++ P   TVLS+T
Sbjct: 64 FVAGGVLEVQPEQVTVLSDT 83


>gi|300719161|ref|YP_003743964.1| ATP synthase, F1 complex, epsilon subunit [Erwinia billingiae
           Eb661]
 gi|299064997|emb|CAX62117.1| ATP synthase, F1 complex, epsilon subunit [Erwinia billingiae
           Eb661]
          Length = 139

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E+ +FSG VQS+ +    G++ +   HAP+LT IK G+V I     E     
Sbjct: 5   FHLDVVSAEQQMFSGLVQSIQVSGTEGELGIRPNHAPLLTAIKPGMVHIVKQQGEEEYIY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           + GG+ ++ P   TVL++T +    +D A     +++ +E  +  +   DVD      +L
Sbjct: 65  LSGGVLEVQPGAVTVLADTAIRGTDLDEARAMEAKRKAEEHMNSSHG--DVDFATASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|195953461|ref|YP_002121751.1| ATP synthase F1, epsilon subunit [Hydrogenobaculum sp. Y04AAS1]
 gi|226740264|sp|B4U9G2|ATPE_HYDS0 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|195933073|gb|ACG57773.1| ATP synthase F1, epsilon subunit [Hydrogenobaculum sp. Y04AAS1]
          Length = 136

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 69/128 (53%), Gaps = 8/128 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++V+P+  V++ EV+SV +P+  G++ +L  H  +LT IK G+V    + ++ +   
Sbjct: 2   LKVDIVTPKGIVYTEEVESVNIPAYDGEMGILENHMLLLTQIKPGLV--YFNKDDKNGIA 59

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN------ICDVDQRFQM 120
           V  G  DI P    +L+E  +P+ N  L+  +K  +E    L++      I +  ++ +M
Sbjct: 60  VGYGFADITPDKVIILTEEAVPVGNIDLEEYKKVFEEATRKLSDARTAEEISEWQKKREM 119

Query: 121 EQLLVDLS 128
            +  ++++
Sbjct: 120 AETFINIA 127


>gi|315608093|ref|ZP_07883086.1| ATP synthase F1 sector epsilon subunit [Prevotella buccae ATCC
          33574]
 gi|315250562|gb|EFU30558.1| ATP synthase F1 sector epsilon subunit [Prevotella buccae ATCC
          33574]
          Length = 84

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 44/68 (64%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  +++SPEK +F+GEV+SV +P  LG+  +L  HAP++++++ G VT S+  E      
Sbjct: 2  LKLKIISPEKILFNGEVESVTVPGTLGEFEILTSHAPIISSLEKGTVTYSIPREGKVELD 61

Query: 67 VIGGICDI 74
          + GG  ++
Sbjct: 62 ISGGFVEV 69


>gi|170077373|ref|YP_001734011.1| ATP synthase F1, epsilon subunit [Synechococcus sp. PCC 7002]
 gi|226740298|sp|B1XI04|ATPE_SYNP2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|169885042|gb|ACA98755.1| ATP synthase F1, epsilon subunit [Synechococcus sp. PCC 7002]
          Length = 134

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 55/111 (49%), Gaps = 2/111 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P++ V    V+ V+LPS  G I +L GHAP+LT ++SG++ +  S  E     
Sbjct: 3   LKVRVITPDRTVLDDSVEEVILPSSSGQIGILSGHAPLLTALESGVIRVRTSGWE--NIA 60

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
           +  G  ++  +   VL  T     +  L+   K  +   + L+ +   D++
Sbjct: 61  ITDGFAEVEANEVKVLVNTAAKGQDIDLEEARKAFESAKAQLDQVNAADRK 111


>gi|319785939|ref|YP_004145414.1| ATP synthase F1 subunit epsilon [Pseudoxanthomonas suwonensis 11-1]
 gi|317464451|gb|ADV26183.1| ATP synthase F1, epsilon subunit [Pseudoxanthomonas suwonensis
           11-1]
          Length = 140

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +F GE   VV   ELG++ +   HAP++T +K G V ++L       + + G
Sbjct: 7   DIVSAEQEIFRGEATLVVATGELGELGIAPRHAPLITRLKPGKVVVTLPDGSSLDFAISG 66

Query: 70  GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQRFQ-MEQLLV 125
           GI ++ P   TVL++T +    +D A ++  ++  +   +  +   DV +  Q + ++  
Sbjct: 67  GILEVQPQVVTVLADTAIRAEDIDEASVRKAKEEAERALAGRSEAMDVAEAQQRLAEVTA 126

Query: 126 DLSCLRR 132
            L  L R
Sbjct: 127 QLQALER 133


>gi|218441979|ref|YP_002380308.1| F0F1 ATP synthase subunit epsilon [Cyanothece sp. PCC 7424]
 gi|226740242|sp|B7KGV3|ATPE_CYAP7 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|218174707|gb|ACK73440.1| ATP synthase F1, epsilon subunit [Cyanothece sp. PCC 7424]
          Length = 138

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 15/136 (11%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+  E + ++LPS  G + +L GHAP+LT +  G+V +    ++     
Sbjct: 3   LSVRIITPDKIVWDDEAEEIILPSTTGQLGILSGHAPLLTALNIGVVRVR-PGKDWQTIA 61

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNACLQA----LEKRIDEVCSDLNNICDVDQRFQ 119
           V+GG  ++  +   +L   +E    +D    Q      +KR+DE         D  ++ Q
Sbjct: 62  VMGGFAEVENNEVKILVNGAEAGAKIDKDTAQQEWNEAQKRLDEASKS----GDRQKQIQ 117

Query: 120 MEQLLVDLSCLRRRIQ 135
            EQ        R R Q
Sbjct: 118 AEQA---WKRARARFQ 130


>gi|59713170|ref|YP_205946.1| F0F1 ATP synthase subunit epsilon [Vibrio fischeri ES114]
 gi|197334114|ref|YP_002157350.1| ATP synthase F1, epsilon subunit [Vibrio fischeri MJ11]
 gi|75506883|sp|Q5E1N8|ATPE_VIBF1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|59481271|gb|AAW87058.1| ATP synthase F1, epsilon subunit [Vibrio fischeri ES114]
 gi|197315604|gb|ACH65051.1| ATP synthase F1, epsilon subunit [Vibrio fischeri MJ11]
          Length = 140

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
            H ++VS EK +FSG V+++ +    G++ +  GH P+LT I  G+V I      EEI  
Sbjct: 6   FHLDVVSAEKKLFSGLVETIQVTGSEGELGIFHGHTPLLTAITPGMVRIVKQHGHEEI-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDE 103
             V GGI ++ P   TVL++T +    +D A  +  +++ +E
Sbjct: 64  IYVSGGIVEVQPGSATVLADTAIRGEDLDAAKAEEAKRKAEE 105


>gi|145301171|ref|YP_001144012.1| F0F1 ATP synthase subunit epsilon [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853943|gb|ABO92264.1| F0F1 ATP synthase subunit epsilon [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 142

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 62/118 (52%), Gaps = 11/118 (9%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLS 58
           M+ +   H ++VS E  +FSG VQS  +    G++ +  GHAP+LT IK G+V +     
Sbjct: 1   MAEMISFHLDVVSAEGKLFSGRVQSAQVSGLEGELGLRHGHAPLLTAIKPGLVRLVKQNG 60

Query: 59  CEEIHRYVVIGGICDIVPSHCTVLSETIL---PMDNA----CLQALEKRIDEVCSDLN 109
            EE+    + GG+ ++ P   TVL++T +    +D A      +A E RI     D++
Sbjct: 61  AEEV--LYISGGMLEVQPESVTVLADTAIRAKDLDEAKALEAKRAAEARIHSSHGDID 116


>gi|196232467|ref|ZP_03131320.1| ATP synthase F1, epsilon subunit [Chthoniobacter flavus Ellin428]
 gi|196223539|gb|EDY18056.1| ATP synthase F1, epsilon subunit [Chthoniobacter flavus Ellin428]
          Length = 137

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 60/111 (54%), Gaps = 3/111 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+V+P+K  F G+V+SVV+P   G++ VL  H P++T IK G V I+ + ++   Y+
Sbjct: 4   LRLEIVTPDKLAFEGDVESVVIPGSEGELGVLPMHIPLMTQIKPGEVVITQNGKK--DYL 61

Query: 67  VIG-GICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQ 116
            +G G   +  ++  +L++  +   +    A E  I+   S L    D+ +
Sbjct: 62  AVGEGFATVTQTNVNILTDMAIEWQHIDETAAEAAIERAKSTLAGRHDLSE 112


>gi|270296892|ref|ZP_06203091.1| predicted protein [Bacteroides sp. D20]
 gi|270272879|gb|EFA18742.1| predicted protein [Bacteroides sp. D20]
          Length = 115

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
          ++  LH  +VSPEK +F+GEV+SV LP  +G  ++L  HAP+++++ +G +  +   EE
Sbjct: 33 MMKKLHLNIVSPEKELFNGEVESVTLPGTMGSFSILPQHAPIVSSLGTGKLIYATDGEE 91


>gi|149278596|ref|ZP_01884732.1| H+-transporting two-sector ATPase, epsilon subunit [Pedobacter
          sp. BAL39]
 gi|149230591|gb|EDM35974.1| H+-transporting two-sector ATPase, epsilon subunit [Pedobacter
          sp. BAL39]
          Length = 80

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+++P+K VF GEV +V +P  +G   +L  HAP+++T++ G V I     E   ++
Sbjct: 1  MTLEILTPDKKVFEGEVTAVTVPGTMGSFQILKDHAPIISTLEDGPVIIKSKANE-ETFI 59

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG+ +++ +   VL+E +
Sbjct: 60 IKGGVVEVLKNKIIVLAEGV 79


>gi|294085412|ref|YP_003552172.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664987|gb|ADE40088.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 117

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (51%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ELV+P K +     + VV P   G    +  HAP+L  +  G+V +    + I+RY++
Sbjct: 6   HLELVTPAKIMVQMAAEMVVAPGSEGLFGAMPRHAPMLANLDRGVVEVHEGGKIINRYMI 65

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKR 100
            GG+ D+     T+L+E    +D A    L++R
Sbjct: 66  DGGLADVSGESVTILAERAEDLDTADAARLKER 98


>gi|300932366|ref|ZP_07147631.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 187-1]
 gi|300459871|gb|EFK23364.1| ATP synthase F1, epsilon subunit [Escherichia coli MS 187-1]
          Length = 139

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGISPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P + TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 66  SGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHG--DVDYAQASAELA 123

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 124 KAIAQLR 130


>gi|32129413|sp|Q87E91|ATPE_XYLFT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
          Length = 140

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +F GE   VV   ELG++ +   HAP++T +K G V I+    E   + + G
Sbjct: 7   DIVSAEQEIFHGEATFVVATGELGELGIAPKHAPLITRLKPGKVVITTVNGEQLDFAISG 66

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQLLV 125
           GI ++ P   T+L+++ +    +D   ++  ++  + + ++     DV + + Q+ + +V
Sbjct: 67  GILEVQPQVVTILADSAIRADTIDEVAVRKAKEEAERILANRGETIDVAKAQQQLVEAVV 126

Query: 126 DLSCLRR 132
            +  L R
Sbjct: 127 QMQALER 133


>gi|322421874|ref|YP_004201097.1| ATP synthase F1, subunit epsilon [Geobacter sp. M18]
 gi|320128261|gb|ADW15821.1| ATP synthase F1, epsilon subunit [Geobacter sp. M18]
          Length = 138

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  ELV+P K V S EV  +     LG+  VL GHAP LT++K G +        +
Sbjct: 1   MAEKLKVELVTPYKKVLSEEVDEITATGALGEFGVLPGHAPFLTSLKIGELAYKKDG-VL 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           H   +  G  ++     TVL ET    D   L+  +  +    ++L ++   D+ F++ +
Sbjct: 60  HHLALNWGYFEVENDQVTVLVETAERADEIDLERAKAAMGRAETELKSVTPEDKNFRIYE 119

Query: 123 LLVDLSCLR 131
             ++ + +R
Sbjct: 120 AALERAIIR 128


>gi|171060195|ref|YP_001792544.1| ATP synthase F1 subunit epsilon [Leptothrix cholodnii SP-6]
 gi|170777640|gb|ACB35779.1| ATP synthase F1, epsilon subunit [Leptothrix cholodnii SP-6]
          Length = 125

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 57/103 (55%), Gaps = 8/103 (7%)

Query: 18  VFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV-VIGGICDIVP 76
           +FSGE + V LP E G++ +L  H P++T I+ G V I  +      +V V GGI ++ P
Sbjct: 2   IFSGEAKFVALPGESGELGILPKHTPLITRIRPGAVRIERADNGEEEFVFVAGGILEVQP 61

Query: 77  SHCTVLSETIL---PMDNACLQALE-KRIDEVCSDLNNICDVD 115
              TVL++T +    +D A  +A+E KR+ E     N   D+D
Sbjct: 62  DRVTVLADTAIRGHDLDEA--KAIEAKRLAEEAMK-NAASDLD 101


>gi|119715999|ref|YP_922964.1| F0F1 ATP synthase subunit epsilon [Nocardioides sp. JS614]
 gi|119536660|gb|ABL81277.1| ATP synthase F1 subcomplex epsilon subunit [Nocardioides sp. JS614]
          Length = 133

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (55%), Gaps = 5/99 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH ELV+ ++ V+SGE + V+  +  GD+ VL GHAP+L+ +   +V IS S   +    
Sbjct: 8   LHVELVAADRTVWSGEAEMVIARTTEGDVGVLRGHAPLLSLLSDAVVEISSSDGGVVIAA 67

Query: 67  VIGGICDIVPSHCTVLSE-TILP----MDNACLQALEKR 100
           V GG   +     +VLS+  +LP    +D A ++  E R
Sbjct: 68  VDGGFLSVANDRVSVLSQRALLPEEIDVDEARVELEEAR 106


>gi|299146012|ref|ZP_07039080.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides sp. 3_1_23]
 gi|298516503|gb|EFI40384.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides sp. 3_1_23]
          Length = 82

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 45/72 (62%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          ++ +LH  +VSPEK +F G V+ V LP  +G  ++L  HAP+++++K+G ++ +    E 
Sbjct: 1  MMKELHLSIVSPEKSIFDGNVKIVTLPGMIGSFSILPRHAPIVSSLKAGTLSYTTMDGEE 60

Query: 63 HRYVVIGGICDI 74
          H   + GG  ++
Sbjct: 61 HTMDIQGGFVEM 72


>gi|37524071|ref|NP_927415.1| F0F1 ATP synthase subunit epsilon [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|60389713|sp|Q7NA95|ATPE_PHOLL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|36783494|emb|CAE12334.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 140

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (49%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H  +VS E  +F G VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 7   HLNVVSAESRMFEGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQFGEEEVIYL 66

Query: 68  IGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ PS   VL++T +    +D A  +ALE +        N+  DVD      +L 
Sbjct: 67  SGGILEVQPSGVIVLADTAIRGKDLDEA--KALESKRKAEEHIRNSHGDVDYAQASAELS 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|170729215|ref|YP_001763241.1| F0F1 ATP synthase subunit epsilon [Shewanella woodyi ATCC 51908]
 gi|226740287|sp|B1KQ33|ATPE_SHEWM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|169814562|gb|ACA89146.1| ATP synthase F1, epsilon subunit [Shewanella woodyi ATCC 51908]
          Length = 142

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 55/104 (52%), Gaps = 3/104 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E  +FSG V  + +    GD+ V+ GHAP+LT IK G+  I     +   + 
Sbjct: 6   VQLDIVSAENSIFSGLVAHLQVTGSEGDLGVMPGHAPLLTNIKPGMARIVKQDGKEEVFY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSD 107
           + GGI ++ PS  +VL++ +     +D    +  ++R +   +D
Sbjct: 66  LSGGILEVQPSSVSVLADVVKRADEIDEKAAEEAKRRAESAMAD 109


>gi|20137536|sp|Q9PE86|ATPE_XYLFA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
          Length = 140

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 69/127 (54%), Gaps = 4/127 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           ++VS E+ +F GE   VV   ELG++ ++  HAP++T +K G V I+    E   + + G
Sbjct: 7   DIVSAEQEIFHGEATLVVATGELGELGIVPKHAPLITRLKPGKVIITTVNGEQLDFAISG 66

Query: 70  GICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQLLV 125
           GI ++ P   T+L+++ +    +D   ++  ++  + + ++     DV + + Q+ + +V
Sbjct: 67  GILEVQPQVVTILADSAIRADTIDEVAVRKAKEEAERILANRGETIDVAKAQQQLVEAVV 126

Query: 126 DLSCLRR 132
            +  L R
Sbjct: 127 QMQALER 133


>gi|170766875|ref|ZP_02901328.1| ATP synthase F1, epsilon subunit [Escherichia albertii TW07627]
 gi|170124313|gb|EDS93244.1| ATP synthase F1, epsilon subunit [Escherichia albertii TW07627]
          Length = 139

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 59/112 (52%), Gaps = 3/112 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
            GGI ++ P + TVL++T +    +D A     +++ +E  +  +   D  Q
Sbjct: 66  SGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHINSSHGDVDYAQ 117


>gi|326799696|ref|YP_004317515.1| ATPase, F1 complex, delta/subunit epsilon [Sphingobacterium sp.
          21]
 gi|326550460|gb|ADZ78845.1| ATPase, F1 complex, delta/epsilon subunit [Sphingobacterium sp.
          21]
          Length = 97

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 53/85 (62%), Gaps = 1/85 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +   +++P++ +FSG+  SV +P   G   +L  HAP+++T++ G V I  + ++I   +
Sbjct: 14 MELNIITPDQSIFSGQAHSVTVPGSAGSFEILKDHAPIISTLEDGKVIIR-NNKDIEVII 72

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          + GG+ +++ +  TVL+E ++  +N
Sbjct: 73 IKGGVVEVLDNKITVLAEGVVTEEN 97


>gi|146313763|ref|YP_001178837.1| F0F1 ATP synthase subunit epsilon [Enterobacter sp. 638]
 gi|237729042|ref|ZP_04559523.1| predicted protein [Citrobacter sp. 30_2]
 gi|291086474|ref|ZP_06355896.2| hypothetical protein CIT292_10580 [Citrobacter youngae ATCC 29220]
 gi|166990383|sp|A4WGF6|ATPE_ENT38 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|145320639|gb|ABP62786.1| ATP synthase F1 subcomplex epsilon subunit [Enterobacter sp. 638]
 gi|226909664|gb|EEH95582.1| predicted protein [Citrobacter sp. 30_2]
 gi|291068348|gb|EFE06457.1| ATP synthase F1, epsilon subunit [Citrobacter youngae ATCC 29220]
          Length = 139

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ P   TVL++T +    +D A  L+A  K  + + S      DVD      +L
Sbjct: 66  SGGILEVQPGSVTVLADTAIRGQDLDEARALEAKRKAEEHIKSSHG---DVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|288925054|ref|ZP_06418990.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella buccae D17]
 gi|288338244|gb|EFC76594.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella buccae D17]
          Length = 83

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 44/68 (64%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  +++SPEK +F+GEV+SV +P  LG+  +L  HAP++++++ G VT S+  E      
Sbjct: 1  MKLKIISPEKILFNGEVESVTVPGTLGEFEILTSHAPIISSLEKGTVTYSIPREGKVELD 60

Query: 67 VIGGICDI 74
          + GG  ++
Sbjct: 61 ISGGFVEV 68


>gi|261341612|ref|ZP_05969470.1| hypothetical protein ENTCAN_08075 [Enterobacter cancerogenus ATCC
           35316]
 gi|296105475|ref|YP_003615621.1| F0F1 ATP synthase subunit epsilon [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|288315964|gb|EFC54902.1| ATP synthase F1, epsilon subunit [Enterobacter cancerogenus ATCC
           35316]
 gi|295059934|gb|ADF64672.1| F0F1 ATP synthase subunit epsilon [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295095358|emb|CBK84448.1| ATP synthase F1 subcomplex epsilon subunit [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 139

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P   TVL++T +    +D A     +++ +E  S  +   DVD      +L 
Sbjct: 66  SGGILEVQPGSVTVLADTAIRGQDLDEARALESKRKAEEHISSSHG--DVDYAQASAELA 123

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 124 KAIAKLR 130


>gi|302880124|ref|YP_003848688.1| ATP synthase F1, epsilon subunit [Gallionella capsiferriformans
           ES-2]
 gi|302582913|gb|ADL56924.1| ATP synthase F1, epsilon subunit [Gallionella capsiferriformans
           ES-2]
          Length = 142

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 10/112 (8%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHR 64
           +H ++VS E+ +FSG  + V++P E+G++ +   H P+LT IK G V I      EE   
Sbjct: 5   VHVDVVSAEELIFSGLAEIVIVPGEMGELGIYPRHTPLLTRIKPGSVRIRRPDQAEEELI 64

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNA----CLQALEKRIDEVCSDLN 109
           YV  GG+ ++ P   T+LS+T +    +D +      QA E+ +    SDL+
Sbjct: 65  YVS-GGMLEVQPDVVTILSDTAIRGKDLDESRALEAKQAAEETMKNRTSDLD 115


>gi|253987518|ref|YP_003038874.1| F0F1 ATP synthase subunit epsilon [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253778968|emb|CAQ82128.1| ATP synthase epsilon chain [Photorhabdus asymbiotica]
          Length = 140

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H  +VS E  +F G VQ + +    G++ +  GHAP+LT IK G+V I     E     +
Sbjct: 7   HLNVVSAESRMFDGLVQKIQVTGSEGELGIYPGHAPLLTAIKPGMVRIVKQFGEEEVIYL 66

Query: 68  IGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
            GGI ++ PS   VL++T I   D    +ALE +        N+  DVD      +L   
Sbjct: 67  SGGILEVQPSGVIVLADTAIRGKDLDEAKALESKRKAEEHIRNSHGDVDYAQASAELSKA 126

Query: 127 LSCLR 131
           ++ LR
Sbjct: 127 IAKLR 131


>gi|49076830|gb|AAT49605.1| PA5553 [synthetic construct]
          Length = 142

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGD+ +  GHAP++T +K G + +     E   Y 
Sbjct: 5  VHCDIVSAEAEIFSGLVEMVIAHGALGDLGIAPGHAPLITDLKPGPIRLVKQGGEQEVYY 64

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          + GG  ++ P+   VL++T++
Sbjct: 65 ISGGFLEVQPNMAKVLADTVV 85


>gi|78189968|ref|YP_380306.1| ATP synthase F1, epsilon subunit [Chlorobium chlorochromatii
          CaD3]
 gi|78172167|gb|ABB29263.1| ATP synthase F1 subcomplex epsilon subunit [Chlorobium
          chlorochromatii CaD3]
          Length = 88

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 44/77 (57%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+V+P+   FSGE+ SV+ P   G   VL  HAP+L  +K+G V +SL+      + V  
Sbjct: 11 EIVTPQSLYFSGEITSVIAPGIEGQFQVLKNHAPLLAALKTGKVKLSLANRGEQSFTVAD 70

Query: 70 GICDIVPSHCTVLSETI 86
          G  ++  +   +L+E++
Sbjct: 71 GFLEVSNNKAILLTESV 87


>gi|74318814|ref|YP_316554.1| F0F1 ATP synthase subunit epsilon [Thiobacillus denitrificans ATCC
           25259]
 gi|119361406|sp|Q3SF67|ATPE2_THIDA RecName: Full=ATP synthase epsilon chain 2; AltName: Full=ATP
           synthase F1 sector epsilon subunit 2; AltName:
           Full=F-ATPase epsilon subunit 2
 gi|74058309|gb|AAZ98749.1| F-type H+-transporting ATP synthase, delta/epsilon subunit
           [Thiobacillus denitrificans ATCC 25259]
          Length = 140

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 58/111 (52%), Gaps = 4/111 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS EK ++SG  + V+ P + G++ +   H P+LTT++ G V I    ++    V
Sbjct: 5   IHVDIVSAEKSLYSGTAEMVIAPGQRGELGIYPRHTPLLTTLRPGSVRIKAPNQDEEELV 64

Query: 67  VI-GGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICD 113
            + GGI ++ P   T+LS++ +    +D A     ++  +E   D     D
Sbjct: 65  YVSGGILEVQPHLITILSDSAVRGADLDEAKALEAKRAAEEAMKDKAATLD 115


>gi|77461946|ref|YP_351453.1| F0F1 ATP synthase subunit epsilon [Pseudomonas fluorescens Pf0-1]
 gi|119367762|sp|Q3K442|ATPE_PSEPF RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|77385949|gb|ABA77462.1| ATP synthase F1 subcomplex epsilon subunit [Pseudomonas
          fluorescens Pf0-1]
          Length = 141

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 48/80 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGD+ + +GHAP++T +K G + +     E   + 
Sbjct: 5  VHCDIVSAEGEIFSGLVEMVIAHGALGDLGIALGHAPLITNLKPGPIRLIKQGGEAEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 65 ISGGFLEVQPNMVKVLADTV 84


>gi|283853226|ref|ZP_06370478.1| ATP synthase F1, epsilon subunit [Desulfovibrio sp. FW1012B]
 gi|283571399|gb|EFC19407.1| ATP synthase F1, epsilon subunit [Desulfovibrio sp. FW1012B]
          Length = 148

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   L  E+V+P++ V S +V+SV      GD T+L GH P L+ ++ G +   L    +
Sbjct: 1  MAKTLLLEIVTPDRLVMSRDVESVTGAGFAGDFTILPGHVPFLSALRVGTLAYRLGG-TL 59

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
          H   V GG+ D+ P    VL+E 
Sbjct: 60 HEAFVGGGVADVGPGRVLVLAEA 82


>gi|319898004|ref|YP_004136201.1| f1 sector of membrane-bound ATP synthase, epsilon subunit
           [Haemophilus influenzae F3031]
 gi|317433510|emb|CBY81893.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Haemophilus influenzae F3031]
          Length = 142

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +F GEV+ + +    G++ +L GH P+LT IK GIV  +L         
Sbjct: 4   FNLTIVSAEQKIFEGEVKQIQVTGVEGELGILPGHTPLLTAIKPGIVKFTLKDGNEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P+  TVL++  +    +D   +Q  +++ +E    ++   D D    + +L
Sbjct: 64  VSGGFLEVQPNIVTVLADIAIRGSELDADRIQEAKRKAEENI--VSRGSDADHDLLVAKL 121

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 122 SKELAKLR 129


>gi|1703741|sp|P50010|ATPE_PRODI RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|150559|gb|AAA25557.1| ATP synthase epsilon subunit [Prochloron didemni]
          Length = 136

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 59/129 (45%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+   V+ +VLPS  G + VL GHAP+LT + +G++ +    ++     
Sbjct: 3   LTLRVITPDKTVWDDSVEEIVLPSTTGQVGVLTGHAPLLTALDTGVMRVR-PGKDWQAIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  ++  +   VL       D+   +       +   +L      D R ++ Q   +
Sbjct: 62  LMGGFAEVENNEVKVLVNGAEVGDSIDKETARTEFQQAEQNLARANQGDNRQELIQATQE 121

Query: 127 LSCLRRRIQ 135
               R R Q
Sbjct: 122 FKKARARFQ 130


>gi|157144365|ref|YP_001451684.1| F0F1 ATP synthase subunit epsilon [Citrobacter koseri ATCC BAA-895]
 gi|166222448|sp|A8ACN5|ATPE_CITK8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|157081570|gb|ABV11248.1| hypothetical protein CKO_00069 [Citrobacter koseri ATCC BAA-895]
          Length = 139

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQFGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ P   TVL++T +    +D A  L+A  K  + + S      DVD      +L
Sbjct: 66  SGGILEVQPGSVTVLADTAIRGQDLDEARALEAKRKAEERIKSSHG---DVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|331007717|ref|ZP_08330847.1| ATP synthase epsilon chain [gamma proteobacterium IMCC1989]
 gi|330418476|gb|EGG93012.1| ATP synthase epsilon chain [gamma proteobacterium IMCC1989]
          Length = 141

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (57%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LH ++VS EK +FSG V+ VV     GD+ +  GHAP+L+ ++ G + +     E   + 
Sbjct: 5  LHCDIVSAEKQIFSGLVEMVVAAGTEGDLGIGYGHAPLLSGLQPGPIRVITQSGEEEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          + GG  ++ P   TVL++T L  ++
Sbjct: 65 ISGGYVEVQPHVVTVLADTALRAED 89


>gi|213968460|ref|ZP_03396603.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          tomato T1]
 gi|213926748|gb|EEB60300.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          tomato T1]
          Length = 141

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGDI +  GHAP++T +K G + +     E   + 
Sbjct: 5  VHCDIVSAEGEIFSGLVEMVIAHGNLGDIGIAPGHAPLITDLKPGPIRLIKQGGEAEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 65 ISGGFLEVQPNMVKVLADTV 84


>gi|66048344|ref|YP_238185.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          syringae B728a]
 gi|81307754|sp|Q4ZL25|ATPE_PSEU2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|63259051|gb|AAY40147.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Pseudomonas syringae pv. syringae B728a]
          Length = 141

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGDI +  GHAP++T +K G + +     E   + 
Sbjct: 5  VHCDIVSAEGEIFSGLVEMVIAHGNLGDIGIAPGHAPLITDLKPGPIRLIKQGGEAEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 65 ISGGFLEVQPNMVKVLADTV 84


>gi|39995225|ref|NP_951176.1| F0F1 ATP synthase subunit epsilon [Geobacter sulfurreducens PCA]
 gi|60389698|sp|Q74GX9|ATPE_GEOSL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|39981987|gb|AAR33449.1| ATP synthase F1, epsilon subunit [Geobacter sulfurreducens PCA]
 gi|298504229|gb|ADI82952.1| ATP synthase F1, epsilon subunit [Geobacter sulfurreducens KN400]
          Length = 138

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 65/132 (49%), Gaps = 1/132 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  +LV+P K + S EV  +     LG+ +VL GHAP LT++K G +T   S + +
Sbjct: 1   MAEKLKVDLVTPYKKILSEEVDEITATGALGEFSVLPGHAPFLTSLKIGELTYKKSGQIV 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           H   +  G  ++     TVL ET    D   L+  +  +    + L  +   D+ +++ +
Sbjct: 61  H-LALNWGYFEVEDDKVTVLVETAERADEIDLERAKAALGRAEAALKKLSPEDKDYRVME 119

Query: 123 LLVDLSCLRRRI 134
             ++ + +R ++
Sbjct: 120 AALERALIRMQV 131


>gi|296134372|ref|YP_003641619.1| ATP synthase F1, epsilon subunit [Thermincola sp. JR]
 gi|296032950|gb|ADG83718.1| ATP synthase F1, epsilon subunit [Thermincola potens JR]
          Length = 136

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+V+PE+ VFS +V+ VV+P E G + +L  HAP++  +K G++ +  + +EI +  + G
Sbjct: 9  EIVTPERIVFSEDVEFVVVPGEEGYLGILANHAPIVAALKIGVMKVIQNQKEI-KLAISG 67

Query: 70 GICDIVPSHCTVLSET 85
          G  ++  +   VL++T
Sbjct: 68 GFMEVSKNKLVVLADT 83


>gi|289209745|ref|YP_003461811.1| ATP synthase F1 subunit epsilon [Thioalkalivibrio sp. K90mix]
 gi|288945376|gb|ADC73075.1| ATP synthase F1, epsilon subunit [Thioalkalivibrio sp. K90mix]
          Length = 139

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 6/113 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-SLSCEEIHRY 65
           +H ++VS E+ ++SG    +  P+E G++ V  GH  +L  +  G + I      E    
Sbjct: 5   MHVDVVSAEESIYSGTALMIAAPAEGGEVGVYAGHTQMLARLNPGELRILEKEGAEPQPV 64

Query: 66  VVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
            V GGI ++ P H TVL++T +    +D A     +KR +E     N+  D D
Sbjct: 65  FVSGGILEVQPYHVTVLADTAVRAKDLDEAEALEAKKRAEEALE--NSKADFD 115


>gi|193214199|ref|YP_001995398.1| H+transporting two-sector ATPase aubunit delta/epsilon
          [Chloroherpeton thalassium ATCC 35110]
 gi|193087676|gb|ACF12951.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Chloroherpeton thalassium ATCC 35110]
          Length = 86

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
          N    +LV+PE+ VFSG+V SV  P + G   V+  HAP+L ++ +G V + L  +    
Sbjct: 4  NSFELDLVTPEESVFSGKVVSVTAPGDYGSFQVMRDHAPMLASLGTGEVKLVLPNKSEQT 63

Query: 65 YVVIGGICDIVPSHCTVLSETI 86
          Y +  G  ++  +   +L+E I
Sbjct: 64 YSLSDGFFEVSDNKAILLAEKI 85


>gi|237801682|ref|ZP_04590143.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          oryzae str. 1_6]
 gi|289677528|ref|ZP_06498418.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          syringae FF5]
 gi|302185822|ref|ZP_07262495.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          syringae 642]
 gi|330937326|gb|EGH41328.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv. pisi
          str. 1704B]
 gi|330952353|gb|EGH52613.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae Cit 7]
 gi|330961485|gb|EGH61745.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          maculicola str. ES4326]
 gi|330970306|gb|EGH70372.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          aceris str. M302273PT]
 gi|331024541|gb|EGI04597.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          oryzae str. 1_6]
          Length = 139

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGDI +  GHAP++T +K G + +     E   + 
Sbjct: 3  VHCDIVSAEGEIFSGLVEMVIAHGNLGDIGIAPGHAPLITDLKPGPIRLIKQGGEAEVFY 62

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 63 ISGGFLEVQPNMVKVLADTV 82


>gi|28872697|ref|NP_795316.1| ATP synthase F1 subunit epsilon [Pseudomonas syringae pv. tomato
          str. DC3000]
 gi|301384253|ref|ZP_07232671.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          tomato Max13]
 gi|302063896|ref|ZP_07255437.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          tomato K40]
 gi|302131980|ref|ZP_07257970.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          tomato NCPPB 1108]
 gi|38257458|sp|Q87TT5|ATPE_PSESM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|28855953|gb|AAO59011.1| ATP synthase F1, epsilon subunit [Pseudomonas syringae pv. tomato
          str. DC3000]
 gi|330964199|gb|EGH64459.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          actinidiae str. M302091]
 gi|331017745|gb|EGH97801.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          lachrymans str. M302278PT]
          Length = 139

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGDI +  GHAP++T +K G + +     E   + 
Sbjct: 3  VHCDIVSAEGEIFSGLVEMVIAHGNLGDIGIAPGHAPLITDLKPGPIRLIKQGGEAEVFY 62

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 63 ISGGFLEVQPNMVKVLADTV 82


>gi|309790651|ref|ZP_07685204.1| ATP synthase F1, epsilon subunit [Oscillochloris trichoides DG6]
 gi|308227317|gb|EFO80992.1| ATP synthase F1, epsilon subunit [Oscillochloris trichoides DG6]
          Length = 135

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H E+V+ EK V S EV  +  P+  G I VL  H P++T +K G +TI  + E I  + 
Sbjct: 1  MHLEIVTAEKVVLSEEVDQINAPTRDGRIGVLPRHEPLMTILKPGEMTIIKNGERIP-FA 59

Query: 67 VIGGICDIVPSHCTVLSETI 86
          V GG  +I+ +   +L++T+
Sbjct: 60 VSGGFMEILSNRVVILADTV 79


>gi|194332902|ref|YP_002014762.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Prosthecochloris aestuarii DSM 271]
 gi|194310720|gb|ACF45115.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Prosthecochloris aestuarii DSM 271]
          Length = 88

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+V+P+K  FSGEV SV+ P + G   ++  HAP+L  +K+G V +S+       +V+  
Sbjct: 11 EIVTPQKQFFSGEVTSVIAPGQDGLFQIMKNHAPLLAALKTGKVRVSIPGGGEKSFVIAD 70

Query: 70 GICDIVPSHCTVLSETI 86
          G  ++  +   +L+E I
Sbjct: 71 GFFEVSNNKAILLTEDI 87


>gi|330976385|gb|EGH76442.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          aptata str. DSM 50252]
          Length = 131

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGDI +  GHAP++T +K G + +     E   + 
Sbjct: 3  VHCDIVSAEGEIFSGLVEMVIAHGNLGDIGIAPGHAPLITDLKPGPIRLIKQGGEAEVFY 62

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 63 ISGGFLEVQPNMVKVLADTV 82


>gi|330876335|gb|EGH10484.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          morsprunorum str. M302280PT]
          Length = 133

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGDI +  GHAP++T +K G + +     E   + 
Sbjct: 3  VHCDIVSAEGEIFSGLVEMVIAHGNLGDIGIAPGHAPLITDLKPGPIRLIKQGGEAEVFY 62

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 63 ISGGFLEVQPNMVKVLADTV 82


>gi|259910315|ref|YP_002650671.1| F0F1 ATP synthase subunit epsilon [Erwinia pyrifoliae Ep1/96]
 gi|224965937|emb|CAX57470.1| ATP synthase, F1 complex, epsilon subunit [Erwinia pyrifoliae
           Ep1/96]
 gi|283480438|emb|CAY76354.1| membrane-bound ATP synthase, F1 sector,epsilon-subunit [Erwinia
           pyrifoliae DSM 12163]
 gi|310765895|gb|ADP10845.1| F0F1 ATP synthase subunit epsilon [Erwinia sp. Ejp617]
          Length = 139

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E  +FSG VQS+ +    G++ +   HAP+LT IK G++ I     E     
Sbjct: 5   FHLDVVSAELQMFSGTVQSIQVSGSEGELGIRPNHAPLLTAIKPGMIRIVKQHGEEEVIY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           + GG+ ++ P   TVL++T +    +D A  +ALE +        ++  DVD      +L
Sbjct: 65  LSGGVLEVQPGAVTVLADTAIRGSDLDEA--RALEAKRKAEAHMNSSHGDVDFAVASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|15600746|ref|NP_254240.1| F0F1 ATP synthase subunit epsilon [Pseudomonas aeruginosa PAO1]
 gi|107104655|ref|ZP_01368573.1| hypothetical protein PaerPA_01005734 [Pseudomonas aeruginosa
          PACS2]
 gi|116053704|ref|YP_794031.1| F0F1 ATP synthase subunit epsilon [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|152988157|ref|YP_001351666.1| F0F1 ATP synthase subunit epsilon [Pseudomonas aeruginosa PA7]
 gi|218894656|ref|YP_002443526.1| F0F1 ATP synthase subunit epsilon [Pseudomonas aeruginosa LESB58]
 gi|254237771|ref|ZP_04931094.1| ATP synthase epsilon chain [Pseudomonas aeruginosa C3719]
 gi|254243100|ref|ZP_04936422.1| ATP synthase epsilon chain [Pseudomonas aeruginosa 2192]
 gi|296392420|ref|ZP_06881895.1| F0F1 ATP synthase subunit epsilon [Pseudomonas aeruginosa PAb1]
 gi|313111496|ref|ZP_07797297.1| ATP synthase epsilon chain [Pseudomonas aeruginosa 39016]
 gi|20137485|sp|Q9HT21|ATPE_PSEAE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|122256276|sp|Q02DF5|ATPE_PSEAB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|166990385|sp|A6VF31|ATPE_PSEA7 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226740275|sp|B7V790|ATPE_PSEA8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|9951893|gb|AAG08938.1|AE004967_9 ATP synthase epsilon chain [Pseudomonas aeruginosa PAO1]
 gi|115588925|gb|ABJ14940.1| ATP synthase epsilon chain [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169702|gb|EAZ55213.1| ATP synthase epsilon chain [Pseudomonas aeruginosa C3719]
 gi|126196478|gb|EAZ60541.1| ATP synthase epsilon chain [Pseudomonas aeruginosa 2192]
 gi|150963315|gb|ABR85340.1| ATP synthase F1, epsilon subunit [Pseudomonas aeruginosa PA7]
 gi|218774885|emb|CAW30703.1| ATP synthase epsilon chain [Pseudomonas aeruginosa LESB58]
 gi|310883799|gb|EFQ42393.1| ATP synthase epsilon chain [Pseudomonas aeruginosa 39016]
          Length = 141

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGD+ +  GHAP++T +K G + +     E   Y 
Sbjct: 5  VHCDIVSAEAEIFSGLVEMVIAHGALGDLGIAPGHAPLITDLKPGPIRLVKQGGEQEVYY 64

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          + GG  ++ P+   VL++T++
Sbjct: 65 ISGGFLEVQPNMVKVLADTVV 85


>gi|120600834|ref|YP_965408.1| F0F1 ATP synthase subunit epsilon [Shewanella sp. W3-18-1]
 gi|146295035|ref|YP_001185459.1| F0F1 ATP synthase subunit epsilon [Shewanella putrefaciens CN-32]
 gi|166222495|sp|A4YCH7|ATPE_SHEPC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222497|sp|A1RQA9|ATPE_SHESW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|120560927|gb|ABM26854.1| ATP synthase F1, epsilon subunit [Shewanella sp. W3-18-1]
 gi|145566725|gb|ABP77660.1| ATP synthase F1, epsilon subunit [Shewanella putrefaciens CN-32]
 gi|319428553|gb|ADV56627.1| ATP synthase F1, epsilon subunit [Shewanella putrefaciens 200]
          Length = 142

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 11/131 (8%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
           +H ++VS E  +F G V  + +    G++ +L GHAP+LTTIK G+  I      EE+  
Sbjct: 6   VHLDIVSAENSIFKGRVACLQVTGVEGELGILPGHAPLLTTIKPGMARIIKQDGSEEV-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETILPMD----NACLQALEKRIDEVCSDLNNICDVDQRFQM 120
             + GG  ++ P+   VL++ ++  D     A L+A ++R +   +D     D D    M
Sbjct: 64  IYLSGGFLEVQPNSIAVLADVVMRADEIDEQAALEA-KRRAEAHMADAG--ADFDYDAAM 120

Query: 121 EQLLVDLSCLR 131
            +L   ++ LR
Sbjct: 121 VELAKAMAQLR 131


>gi|167995200|ref|ZP_02576290.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|194449632|ref|YP_002047893.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469127|ref|ZP_03075111.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194734799|ref|YP_002116805.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195873813|ref|ZP_02698693.2| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197263984|ref|ZP_03164058.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197301260|ref|ZP_02664829.2| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|198242576|ref|YP_002217810.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200386580|ref|ZP_03213192.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204928544|ref|ZP_03219743.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205358835|ref|ZP_02659511.2| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205359460|ref|ZP_02670176.2| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205360195|ref|ZP_02835201.2| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205360625|ref|ZP_02685213.2| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|213021437|ref|ZP_03335884.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213420921|ref|ZP_03353987.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213586048|ref|ZP_03367874.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213646873|ref|ZP_03376926.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|238913117|ref|ZP_04656954.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289826258|ref|ZP_06545370.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|194407936|gb|ACF68155.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194455491|gb|EDX44330.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194710301|gb|ACF89522.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195632458|gb|EDX50942.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197242239|gb|EDY24859.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197287571|gb|EDY26963.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197937092|gb|ACH74425.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603678|gb|EDZ02223.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204321977|gb|EDZ07175.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205327080|gb|EDZ13844.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331631|gb|EDZ18395.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336001|gb|EDZ22765.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205340518|gb|EDZ27282.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205348143|gb|EDZ34774.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|312914995|dbj|BAJ38969.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321222160|gb|EFX47233.1| ATP synthase epsilon chain [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322619089|gb|EFY15975.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625156|gb|EFY21984.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630207|gb|EFY26978.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634368|gb|EFY31102.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635252|gb|EFY31967.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642871|gb|EFY39456.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322645075|gb|EFY41605.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650424|gb|EFY46836.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653616|gb|EFY49943.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661638|gb|EFY57857.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669800|gb|EFY65942.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671993|gb|EFY68112.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322674996|gb|EFY71082.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683686|gb|EFY79699.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686073|gb|EFY82058.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192010|gb|EFZ77247.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200504|gb|EFZ85582.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202733|gb|EFZ87770.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208310|gb|EFZ93251.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323224779|gb|EGA09044.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323232513|gb|EGA16615.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235288|gb|EGA19373.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323241076|gb|EGA25113.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323241375|gb|EGA25407.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323258600|gb|EGA42263.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262368|gb|EGA45926.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323268205|gb|EGA51681.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
          Length = 137

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 4   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 63

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ P   TVL++T +    +D A  L+A  K  + + S      DVD      +L
Sbjct: 64  SGGILEVQPGSVTVLADTAIRGQDLDEARALEAKRKAEEHIKSSHG---DVDYAQASAEL 120

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 121 AKAIAKLR 128


>gi|16762462|ref|NP_458079.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16767148|ref|NP_462763.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29143950|ref|NP_807292.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415732|ref|YP_152807.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62182346|ref|YP_218763.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|152972640|ref|YP_001337786.1| F0F1 ATP synthase subunit epsilon [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|194444185|ref|YP_002043110.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|197249617|ref|YP_002148799.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197364660|ref|YP_002144297.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|205354553|ref|YP_002228354.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205357463|ref|ZP_02347905.2| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|207859087|ref|YP_002245738.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213052671|ref|ZP_03345549.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213427471|ref|ZP_03360221.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213613218|ref|ZP_03371044.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|224585659|ref|YP_002639458.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238897238|ref|YP_002921986.1| F0F1 ATP synthase subunit epsilon [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262040364|ref|ZP_06013610.1| ATP synthase F1 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|283787580|ref|YP_003367445.1| ATP synthase epsilon subunit [Citrobacter rodentium ICC168]
 gi|330005182|ref|ZP_08305144.1| ATP synthase F1, epsilon subunit [Klebsiella sp. MS 92-3]
 gi|60391813|sp|P0A1B7|ATPE_SALTY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|60391814|sp|P0A1B8|ATPE_SALTI RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|75505464|sp|Q57HY0|ATPE_SALCH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|81678060|sp|Q5PKX3|ATPE_SALPA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222467|sp|A6TG35|ATPE_KLEP7 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740281|sp|B5EYZ5|ATPE_SALA4 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740282|sp|B5QUS3|ATPE_SALEP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740283|sp|B5RFW4|ATPE_SALG2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740284|sp|B4SYD0|ATPE_SALNS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740285|sp|B5BIN5|ATPE_SALPK RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|254809381|sp|C0Q2N1|ATPE_SALPC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|25290501|pir||AG0954 ATP synthase epsilon chain [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16422438|gb|AAL22722.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16504767|emb|CAD03131.1| ATP synthase epsilon subunit [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139586|gb|AAO71152.1| ATP synthase epsilon subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129989|gb|AAV79495.1| ATP synthase epsilon subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62129979|gb|AAX67682.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|150957489|gb|ABR79519.1| ATP synthase subunit epsilon [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|194402848|gb|ACF63070.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|197096137|emb|CAR61733.1| ATP synthase epsilon subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197213320|gb|ACH50717.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|205274334|emb|CAR39358.1| ATP synthase epsilon subunit [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205321579|gb|EDZ09418.1| ATP synthase F1, epsilon subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|206710890|emb|CAR35254.1| ATP synthase epsilon subunit [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224470187|gb|ACN48017.1| ATP synthase subunit epsilon [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238549568|dbj|BAH65919.1| ATP synthase subunit epsilon [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042305|gb|EEW43330.1| ATP synthase F1 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|261249004|emb|CBG26862.1| ATP synthase epsilon subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267996151|gb|ACY91036.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|282951034|emb|CBG90712.1| ATP synthase epsilon subunit [Citrobacter rodentium ICC168]
 gi|301160396|emb|CBW19922.1| ATP synthase epsilon subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|320088289|emb|CBY98050.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|322617223|gb|EFY14128.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322661556|gb|EFY57779.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322716838|gb|EFZ08409.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323132226|gb|ADX19656.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323211745|gb|EFZ96578.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323218607|gb|EGA03314.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220008|gb|EGA04478.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323248605|gb|EGA32535.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252096|gb|EGA35956.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323270619|gb|EGA54064.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625596|gb|EGE31941.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629688|gb|EGE36031.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|328536388|gb|EGF62747.1| ATP synthase F1, epsilon subunit [Klebsiella sp. MS 92-3]
 gi|332990713|gb|AEF09696.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 139

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ P   TVL++T +    +D A  L+A  K  + + S      DVD      +L
Sbjct: 66  SGGILEVQPGSVTVLADTAIRGQDLDEARALEAKRKAEEHIKSSHG---DVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|294815104|ref|ZP_06773747.1| ATP synthase epsilon chain [Streptomyces clavuligerus ATCC 27064]
 gi|326443466|ref|ZP_08218200.1| F0F1 ATP synthase subunit epsilon [Streptomyces clavuligerus ATCC
           27064]
 gi|294327703|gb|EFG09346.1| ATP synthase epsilon chain [Streptomyces clavuligerus ATCC 27064]
          Length = 127

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 3/114 (2%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  +  E 
Sbjct: 1   MAAELHVELVAADRQVWSGEATLVVARTASGDIGVMPGHQPLLGVLESGPVTIRTTSPEG 60

Query: 63  HRYVVI---GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
              VV    GG      +  ++L+E     D    Q  E+ ++   S+ +   +
Sbjct: 61  AGTVVAAVHGGFISFADNKLSLLAEIAELADEIDAQRAERALERARSESDAAAE 114


>gi|149186097|ref|ZP_01864411.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Erythrobacter sp. SD-21]
 gi|148830128|gb|EDL48565.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Erythrobacter sp. SD-21]
          Length = 85

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 47/84 (55%), Gaps = 7/84 (8%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV----TISLSCEEI 62
          LHFELV+P K V S +V  VV+P   G+  VL GHAP ++TI+ G V    T   + E I
Sbjct: 3  LHFELVTPAKLVRSEDVHMVVVPGAEGEFGVLEGHAPFMSTIRDGAVQVYKTEGAAPETI 62

Query: 63 HRYVVIGGICDIVPSHCTVLSETI 86
              V GG  ++     TVL+E +
Sbjct: 63 E---VRGGFAEVGEKGLTVLAEHV 83


>gi|292490159|ref|YP_003533054.1| membrane-bound ATP synthase, F1 sector subunit epsilon [Erwinia
           amylovora CFBP1430]
 gi|292901161|ref|YP_003540530.1| ATP synthase subunit epsilon [Erwinia amylovora ATCC 49946]
 gi|291201009|emb|CBJ48148.1| ATP synthase epsilon subunit [Erwinia amylovora ATCC 49946]
 gi|291555601|emb|CBA24218.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Erwinia
           amylovora CFBP1430]
 gi|312174352|emb|CBX82605.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Erwinia
           amylovora ATCC BAA-2158]
          Length = 139

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 65/129 (50%), Gaps = 7/129 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS E  +FSG VQS+ +    G++ +   HAP+LT IK G++ I     E     
Sbjct: 5   FHLDVVSAELQMFSGTVQSIQVSGSEGELGIRPNHAPLLTAIKPGMIRIVKQYGEEEVIY 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           + GG+ ++ P   TVL++T +    +D A  L+A  K  + + S      DVD      +
Sbjct: 65  LSGGVLEVQPGAVTVLADTAIRGSDLDEARALEAKRKAEEHMNSSHG---DVDFAVASAE 121

Query: 123 LLVDLSCLR 131
           L   ++ LR
Sbjct: 122 LAKAIAKLR 130


>gi|295836484|ref|ZP_06823417.1| ATP synthase F1, epsilon subunit [Streptomyces sp. SPB74]
 gi|295826053|gb|EFG64645.1| ATP synthase F1, epsilon subunit [Streptomyces sp. SPB74]
          Length = 124

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 55/107 (51%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH PVL  ++SG VTI  +    
Sbjct: 1   MAAELHVELVAADRSVWSGEATLVVARTTSGDIGVMPGHQPVLGVLESGPVTIRTTDGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLN 109
               V GG      +  ++L+E     +   +Q  E+ ++   SD +
Sbjct: 61  VVVAVHGGFLSFADNKLSLLAEIAELSEEIDVQRAERALERAKSDAD 107


>gi|269103802|ref|ZP_06156499.1| ATP synthase epsilon chain [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163700|gb|EEZ42196.1| ATP synthase epsilon chain [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 140

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 1/126 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG V+++ +    G++ +  GH P+LT +  G++ I+    E     
Sbjct: 6   FHLDVVSAEKRLFSGRVENIQVTGSEGELGIHAGHTPLLTALIPGMIRITKQHGEEEVIY 65

Query: 67  VIGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLV 125
           + GG+ ++ PS  TVL++T I  +D    +A E +   +    N   D+D       L  
Sbjct: 66  LSGGMLEVQPSTVTVLADTAIRGVDLDAAKAEEAKRQAMEHIHNPHGDIDYAQAASDLAK 125

Query: 126 DLSCLR 131
            ++ LR
Sbjct: 126 AIAQLR 131


>gi|160890322|ref|ZP_02071325.1| hypothetical protein BACUNI_02763 [Bacteroides uniformis ATCC
          8492]
 gi|317479132|ref|ZP_07938272.1| ATP synthase [Bacteroides sp. 4_1_36]
 gi|156860054|gb|EDO53485.1| hypothetical protein BACUNI_02763 [Bacteroides uniformis ATCC
          8492]
 gi|316904704|gb|EFV26518.1| ATP synthase [Bacteroides sp. 4_1_36]
          Length = 83

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
          ++  LH  +VSPEK +F+GEV+SV LP  +G  ++L  HAP+++++ +G +  +   EE
Sbjct: 1  MMKKLHLNIVSPEKELFNGEVESVTLPGTMGSFSILPQHAPIVSSLGTGKLIYATDGEE 59


>gi|212637832|ref|YP_002314357.1| F0F1 ATP synthase subunit epsilon [Shewanella piezotolerans WP3]
 gi|226740286|sp|B8CVU4|ATPE_SHEPW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|212559316|gb|ACJ31770.1| ATP synthase F1, epsilon subunit [Shewanella piezotolerans WP3]
          Length = 142

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 49/85 (57%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  ++VS E  +FSG V  + +    GD+ V+ GHAP+LT IK G+  I     +   + 
Sbjct: 6  VQLDIVSAESSIFSGLVAHLQVTGSEGDLGVMPGHAPLLTHIKPGMARIVKQDGKEEVFY 65

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          + GGI ++ PS  +VL++ ++  D+
Sbjct: 66 LSGGILEVQPSSVSVLADVVMRADD 90


>gi|53713461|ref|YP_099453.1| ATP synthase subunit epsilon [Bacteroides fragilis YCH46]
 gi|60681707|ref|YP_211851.1| ATP synthase subunit epsilon [Bacteroides fragilis NCTC 9343]
 gi|253565449|ref|ZP_04842904.1| predicted protein [Bacteroides sp. 3_2_5]
 gi|265763728|ref|ZP_06092296.1| ATP synthase, Delta/Epsilon chain, beta-sandwich
          domain-containing protein [Bacteroides sp. 2_1_16]
 gi|52216326|dbj|BAD48919.1| ATP synthase epsilon chain [Bacteroides fragilis YCH46]
 gi|60493141|emb|CAH07922.1| ATP synthase epsilon chain [Bacteroides fragilis NCTC 9343]
 gi|251945728|gb|EES86135.1| predicted protein [Bacteroides sp. 3_2_5]
 gi|263256336|gb|EEZ27682.1| ATP synthase, Delta/Epsilon chain, beta-sandwich
          domain-containing protein [Bacteroides sp. 2_1_16]
 gi|301163250|emb|CBW22800.1| ATP synthase epsilon chain [Bacteroides fragilis 638R]
          Length = 81

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 47/78 (60%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          + +LH  +VSPEK VF+GEV+SV LP   G  ++L  HAP++++++ G V+ + +  E H
Sbjct: 1  MKELHLNIVSPEKEVFNGEVKSVTLPGTSGVFSILPQHAPIVSSLQEGTVSYTTTDGEEH 60

Query: 64 RYVVIGGICDIVPSHCTV 81
             +  G  ++     +V
Sbjct: 61 TLDIHSGFVELSNGEASV 78


>gi|152978009|ref|YP_001343638.1| F0F1 ATP synthase subunit epsilon [Actinobacillus succinogenes
           130Z]
 gi|171472935|sp|A6VL56|ATPE_ACTSZ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|150839732|gb|ABR73703.1| ATP synthase F1, epsilon subunit [Actinobacillus succinogenes 130Z]
          Length = 142

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 7/129 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +F G V+S+      G++ +L GH P+LT IK GIV I+          
Sbjct: 4   FNLTVVSAEEKIFEGAVKSIQATGSEGELGILAGHIPLLTGIKPGIVKITREDNSEEVLY 63

Query: 67  VIGGICDIVPSHCTVLSETI---LPMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           V GG  ++ P+  TVL++     + +D    L A  K  D + +      DVD    + +
Sbjct: 64  VSGGFLEVQPNIVTVLADVAIRGIELDQERILNAKRKAEDNIVAKH---ADVDHNLLVAK 120

Query: 123 LLVDLSCLR 131
           L  +L+ LR
Sbjct: 121 LSKELAKLR 129


>gi|121999207|ref|YP_001003994.1| F0F1 ATP synthase subunit epsilon [Halorhodospira halophila SL1]
 gi|166222464|sp|A1WZT0|ATPE_HALHL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|121590612|gb|ABM63192.1| ATP synthase F1 subcomplex epsilon subunit [Halorhodospira
           halophila SL1]
          Length = 141

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSC-EEI 62
           ++ L  ++VS E+ +++G+   V+ P+  GD+ +   HAP+LT ++ G + I+    EE 
Sbjct: 1   MSTLQVDIVSAEEQLYAGQASMVIAPAAEGDVGIAPRHAPLLTRLRPGELRITPEGDEEE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICD 113
             +   GG+ ++ P   TVL++T +    +D A     ++R +E   +  +  D
Sbjct: 61  FFFYASGGLLEVQPHKVTVLADTAVRARDIDEAAALEAKRRAEEKLREQKDEVD 114


>gi|255009221|ref|ZP_05281347.1| ATP synthase epsilon chain [Bacteroides fragilis 3_1_12]
 gi|313146969|ref|ZP_07809162.1| predicted protein [Bacteroides fragilis 3_1_12]
 gi|313135736|gb|EFR53096.1| predicted protein [Bacteroides fragilis 3_1_12]
          Length = 81

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +  LH  +VSPEK VF GEV+SV LP   G  ++L  HAP++++++ G V+ + +  E H
Sbjct: 1  MKKLHLNIVSPEKEVFDGEVKSVTLPGTSGVFSILAQHAPIVSSLQEGTVSYTTTDGEEH 60

Query: 64 RYVVIGGICDIVPSHCTV 81
             +  G  ++     +V
Sbjct: 61 TLDIHSGFVELSNGEASV 78


>gi|145596140|ref|YP_001160437.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Salinispora tropica CNB-440]
 gi|145305477|gb|ABP56059.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Salinispora tropica CNB-440]
          Length = 94

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTI-KSGIVTISLSCEE 61
          +   LH ELV+ E+ V+SGE + V+  +  G++ V+ GHAP+L  + + G V I ++  E
Sbjct: 1  MAQQLHVELVAVEETVWSGEAEMVMARTTEGELGVMPGHAPLLGQLAEPGQVRIKVAGGE 60

Query: 62 IHRYVVIGGICDIVPSHCTVLSETILPMDNA 92
             Y V GG   +     TVL+E+  P+  A
Sbjct: 61 QLSYEVAGGFLSVSNQGVTVLAESASPVPAA 91


>gi|325105063|ref|YP_004274717.1| ATP synthase F1 subcomplex epsilon subunit [Pedobacter saltans
          DSM 12145]
 gi|324973911|gb|ADY52895.1| ATP synthase F1 subcomplex epsilon subunit [Pedobacter saltans
          DSM 12145]
          Length = 82

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 9  FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           E+++P+K VF G + SV +P   G   VL  HAP+++T++ G V +     E  ++++ 
Sbjct: 3  LEILTPDKKVFDGNITSVTVPGTQGSFEVLNNHAPIISTLEKGKVIVRNGSNE-QKFLIT 61

Query: 69 GGICDIVPSHCTVLSET 85
          GG+ +++ +   +L+E+
Sbjct: 62 GGVIEVINNKIILLAES 78


>gi|226941913|ref|YP_002796987.1| F0F1 ATP synthase subunit epsilon [Laribacter hongkongensis
          HLHK9]
 gi|254809370|sp|C1D5G1|ATPE_LARHH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226716840|gb|ACO75978.1| AtpE [Laribacter hongkongensis HLHK9]
          Length = 140

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          ++ +H E+VS E  ++SGE + +V P E+G++ V   H P+LT IK G + I +  +   
Sbjct: 1  MSTMHVEVVSAEAQIYSGEAEFLVAPGEMGELGVYPRHVPLLTRIKPGPLRIRVPGQAEE 60

Query: 64 RYVVI-GGICDIVPSHCTVLSETILPMDN 91
            V + GG+ ++ P   TVL++  +  D 
Sbjct: 61 VIVAVSGGLMEVQPDAITVLADVAVRGDE 89


>gi|325528837|gb|EGD05885.1| ATP synthase F1, epsilon subunit [Burkholderia sp. TJI49]
          Length = 157

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEE 61
          +V+ +  +++S E  +++GE   V +P E G++ +   HAP+LT +K G+VT +     E
Sbjct: 1  MVSAMKLDILSAEGALYAGEAHFVAVPGESGELGIYPHHAPLLTRLKPGVVTLVDARSGE 60

Query: 62 IHRYVVIGGICDIVPSHCTVLSETIL 87
            R +V GG+ ++     T++++  L
Sbjct: 61 RRRLLVAGGVLEVSREGVTLIADHAL 86


>gi|301169198|emb|CBW28795.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Haemophilus influenzae 10810]
          Length = 142

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +F GEV+ + +    G++ +L GH P+LT IK GIV  +L         
Sbjct: 4   FNLTIVSAEQKIFEGEVKQIQVTGVEGELGILPGHTPLLTAIKPGIVKFTLKDGNEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P+  TVL++  +    +D   +   +++ +E    +++  DVD    + +L
Sbjct: 64  VSGGFLEVQPNIVTVLADIAIRGSELDADRIHEAKRKAEENI--VSHGSDVDHDLLVAKL 121

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 122 SKELAKLR 129


>gi|193211719|ref|YP_001997672.1| H+transporting two-sector ATPase delta/subunit epsilon
          [Chlorobaculum parvum NCIB 8327]
 gi|193085196|gb|ACF10472.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Chlorobaculum parvum NCIB 8327]
          Length = 87

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%)

Query: 1  MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
          M+   +   ++V+P+K  FSGEV SV+ P   G   VL GHAP++  +K+G V +SL   
Sbjct: 1  MASSENFTLDIVTPQKLFFSGEVNSVIAPGLDGLFQVLKGHAPLVAALKNGKVRLSLPDR 60

Query: 61 EIHRYVVIGGICDIVPSHCTVLSETI 86
            + + +  G  ++  +   +L+E +
Sbjct: 61 SENTFQISDGFFEVSNNKAILLTEDV 86


>gi|332971778|gb|EGK10726.1| ATP synthase F1 sector epsilon subunit [Desmospora sp. 8437]
          Length = 134

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 71/131 (54%), Gaps = 7/131 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++V+PE+ V+S +V+ V+  +E GDI +L  HAP ++ +K   V +    EE     
Sbjct: 4   MQLDIVTPERKVYSEQVEMVIARAEEGDIGILPNHAPYVSPLKVTAVKVKKDGEEFF-VA 62

Query: 67  VIGGICDIVPSHCTVLSETI-LP--MDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++  +  T+L+ET  +P  +D    ++ ++R +E  +D     D+D  F+  ++
Sbjct: 63  VSGGFIEVRENTVTILAETAEMPGEIDIERAESAKERAEERLADRKR-EDID--FKRAEI 119

Query: 124 LVDLSCLRRRI 134
            +  +  R R+
Sbjct: 120 ALQKALTRLRV 130


>gi|85709195|ref|ZP_01040261.1| ATP synthase epsilon subunit [Erythrobacter sp. NAP1]
 gi|85690729|gb|EAQ30732.1| ATP synthase epsilon subunit [Erythrobacter sp. NAP1]
          Length = 85

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 7/84 (8%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV----TISLSCEEI 62
          LHFELV+P K V S +V  VV+P   G+  VL GHAP ++TI+ G V    T   + E I
Sbjct: 3  LHFELVTPAKLVRSEDVHMVVVPGTEGEFGVLEGHAPFMSTIRDGAVQVYKTEGAAPETI 62

Query: 63 HRYVVIGGICDIVPSHCTVLSETI 86
              V GG  ++  +  TVL+E +
Sbjct: 63 E---VRGGFAEVGDTGLTVLAEHV 83


>gi|308051486|ref|YP_003915052.1| ATP synthase F1 subcomplex epsilon subunit [Ferrimonas balearica
          DSM 9799]
 gi|307633676|gb|ADN77978.1| ATP synthase F1 subcomplex epsilon subunit [Ferrimonas balearica
          DSM 9799]
          Length = 141

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 54/90 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS EK +FSG V+++ +    G++ +L GH P+LT IK G+V I     E+    
Sbjct: 5  VHLDVVSAEKRLFSGLVETLQVTGTEGELGILPGHVPLLTAIKPGMVRIVKQHGEVEVIY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDNACLQA 96
          + GGI ++ P   TVL++  +  ++  ++A
Sbjct: 65 LSGGILEVQPDCVTVLADVAVRAEDIDVEA 94


>gi|282881592|ref|ZP_06290261.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella timonensis CRIS 5C-B1]
 gi|281304578|gb|EFA96669.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella timonensis CRIS 5C-B1]
          Length = 80

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 44/68 (64%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  +++SPEK +F G+V  V +P  LG+  +LV HAP++++++SG V+  ++  E+ +  
Sbjct: 2  LRLKIISPEKRIFDGDVNRVTVPGTLGEFEILVNHAPIISSLESGKVSYEIATGELKQLE 61

Query: 67 VIGGICDI 74
          +  G  ++
Sbjct: 62 IESGFVEV 69


>gi|254788503|ref|YP_003075932.1| F0F1 ATP synthase subunit epsilon [Teredinibacter turnerae T7901]
 gi|259585493|sp|C5BKJ4|ATPE_TERTT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|237684352|gb|ACR11616.1| ATP synthase F1, epsilon subunit [Teredinibacter turnerae T7901]
          Length = 141

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H  +VS E+ +FSG V+ +V  +  GD+ +  GHAP L+ +K G V +     +   + 
Sbjct: 5  IHCNIVSAEQEIFSGLVELLVAAATEGDVGIGYGHAPFLSALKPGPVRVKKQSGDEEIFY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          V GG  ++ P    VL++T L  D+
Sbjct: 65 VSGGYLEVQPESINVLADTALRADD 89


>gi|42525217|ref|NP_970597.1| ATP synthase epsilon subunit [Bdellovibrio bacteriovorus HD100]
 gi|60389657|sp|Q6MGM8|ATPE_BDEBA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|39577428|emb|CAE81251.1| ATP synthase epsilon subunit [Bdellovibrio bacteriovorus HD100]
          Length = 140

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 6  DLHFELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
          ++   +V+PEK +  G EV  V +P+  G++ +L GHAP++TT+++G++   L  +E   
Sbjct: 2  NMKLTIVTPEKRILVGQEVDEVTVPAFKGELNILPGHAPLITTLETGVMKWKLKGKEKQD 61

Query: 65 YVVIG-GICDIVPSHCTVLS 83
            VI  G C + P    +L+
Sbjct: 62 LAVISWGYCQVSPEGVNILA 81


>gi|113461831|ref|YP_719900.1| F0F1 ATP synthase subunit epsilon [Haemophilus somnus 129PT]
 gi|119367734|sp|Q0I5X4|ATPE_HAES1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|112823874|gb|ABI25963.1| ATP synthase F1 subcomplex epsilon subunit [Haemophilus somnus
          129PT]
          Length = 142

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +VS E+ +F+GEV+ +      G++ +L GH P+LT IK GI+ I+L  +      + GG
Sbjct: 8  VVSAEQHIFNGEVKGIQATGSEGELGILAGHLPLLTAIKPGIIKITLEDDTEEVIYISGG 67

Query: 71 ICDIVPSHCTVLSE 84
            ++ P+  TVL++
Sbjct: 68 FLEVQPTIVTVLAD 81


>gi|134300980|ref|YP_001114476.1| F0F1 ATP synthase subunit epsilon [Desulfotomaculum reducens MI-1]
 gi|189081362|sp|A4J998|ATPE_DESRM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|134053680|gb|ABO51651.1| ATP synthase F1 subcomplex epsilon subunit [Desulfotomaculum
           reducens MI-1]
          Length = 132

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 8/109 (7%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
             ++V+PEK VFS E+  VV P   G++ +L  HAP++T +K G + +     +  +  V
Sbjct: 6   RLDIVTPEKVVFSEEIDFVVAPGADGELGILPEHAPLVTALKVGTLRVQQGG-KFFKVAV 64

Query: 68  IGGICDIVPSHCTVLSETILPMD-------NACLQALEKRIDEVCSDLN 109
            GG  ++  S   VL++T    D        A  Q  E+R++   S+++
Sbjct: 65  SGGFMEVKNSRIVVLADTAERADQIDVERAKAAKQRAEQRLNSKGSEID 113


>gi|284928845|ref|YP_003421367.1| ATP synthase F1 subcomplex subunit epsilon [cyanobacterium
          UCYN-A]
 gi|284809304|gb|ADB95009.1| ATP synthase F1 subcomplex epsilon subunit [cyanobacterium
          UCYN-A]
          Length = 136

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++P+K V+   VQ VVLPS  G + +L GHAP+LT + +G++ I  + +E     
Sbjct: 3  LTVRVITPDKTVWDNTVQEVVLPSISGQLGILSGHAPLLTALDTGVMRIR-TDKEWQNVA 61

Query: 67 VIGGICDIVPSHCTVL 82
          V+GG  ++      VL
Sbjct: 62 VMGGFAEVEQDEVKVL 77


>gi|11467697|ref|NP_050749.1| ATP synthase CF1 epsilon subunit [Guillardia theta]
 gi|5915728|sp|O78492|ATPE_GUITH RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|3603022|gb|AAC35683.1| ATP synthase CF1 subunit e [Guillardia theta]
          Length = 131

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 61/129 (47%), Gaps = 4/129 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H  +++P++ V+    + V+LPS  G + +L GHAP+LT +  G++ + +   +    V
Sbjct: 3   IHISIIAPDRTVWDANAEEVILPSSTGQLGILKGHAPLLTALDIGVMRVRVD-RDWTPIV 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  +I     T+L               ++ ++E+    N      +R +  Q   +
Sbjct: 62  LLGGFAEIENDELTILVNGAEEASQIDRDQAQRDLEEMTVKFNEATTNKERIEATQ---N 118

Query: 127 LSCLRRRIQ 135
           L   R R+Q
Sbjct: 119 LRKARARLQ 127


>gi|239928880|ref|ZP_04685833.1| F0F1 ATP synthase subunit epsilon [Streptomyces ghanaensis ATCC
           14672]
 gi|291437207|ref|ZP_06576597.1| F-type proton-transporting ATPase epsilon chain protein
           [Streptomyces ghanaensis ATCC 14672]
 gi|291340102|gb|EFE67058.1| F-type proton-transporting ATPase epsilon chain protein
           [Streptomyces ghanaensis ATCC 14672]
          Length = 123

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH  LV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S  E 
Sbjct: 1   MAAELHVALVAADREVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGET 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
               V GG      +  ++L+E     D   +Q  E+ ++   S+ +   +
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEIAELSDEIDVQRAERALERAKSEADASAE 111


>gi|161505611|ref|YP_001572724.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189081375|sp|A9MJS1|ATPE_SALAR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|160866958|gb|ABX23581.1| hypothetical protein SARI_03787 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 139

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ P   TVL++T +    +D A  L+A  K  + + S      DVD      +L
Sbjct: 66  SGGILEVQPGTVTVLADTAIRGQDLDEARALEAKRKAEEHIKSSHG---DVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|159039538|ref|YP_001538791.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Salinispora arenicola CNS-205]
 gi|157918373|gb|ABV99800.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Salinispora arenicola CNS-205]
          Length = 94

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTI-KSGIVTISLSCEE 61
          +   LH ELV+ E+ V+SGE + VV  +  G++ VL GHAP+L  + + G V I  +  E
Sbjct: 1  MAQQLHVELVAVEEKVWSGEAEMVVARTTEGELGVLPGHAPLLGQLAEPGRVRIKAAGGE 60

Query: 62 IHRYVVIGGICDIVPSHCTVLSETILPMDNA 92
             Y V GG   +     TVL+E+  P+  A
Sbjct: 61 QVTYDVAGGFLSVSNEGVTVLAESASPVSPA 91


>gi|255533300|ref|YP_003093672.1| H+transporting two-sector ATPase delta/subunit epsilon
          [Pedobacter heparinus DSM 2366]
 gi|255346284|gb|ACU05610.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Pedobacter heparinus DSM 2366]
          Length = 80

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+++P+K VF GEV +V +P  +G   +L  HAP+++T++ G V I     E   ++
Sbjct: 1  MTLEILTPDKKVFEGEVTAVTVPGTMGSFQILKDHAPIISTLEDGPVIIKSKTGE-DTFI 59

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG+ +++ +   VL+E +
Sbjct: 60 IKGGVVEVLKNKIIVLAEGV 79


>gi|170718137|ref|YP_001785167.1| F0F1 ATP synthase subunit epsilon [Haemophilus somnus 2336]
 gi|226740260|sp|B0UWG4|ATPE_HAES2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|168826266|gb|ACA31637.1| ATP synthase F1, epsilon subunit [Haemophilus somnus 2336]
          Length = 142

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +VS E+ +F+GEV+ +      G++ +L GH P+LT IK GI+ I+L  +      + GG
Sbjct: 8  VVSAEQHIFNGEVKGIQATGSEGELGILAGHLPLLTAIKPGIIKITLEDDTEEVIYISGG 67

Query: 71 ICDIVPSHCTVLSE 84
            ++ P+  TVL++
Sbjct: 68 FLEVQPTIVTVLAD 81


>gi|182412696|ref|YP_001817762.1| ATP synthase F1, epsilon subunit [Opitutus terrae PB90-1]
 gi|177839910|gb|ACB74162.1| ATP synthase F1, epsilon subunit [Opitutus terrae PB90-1]
          Length = 135

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 6/132 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+V+PE  V+S  + SVV+P+  G++ +L GH P+LT ++ G + ++ +  +    V
Sbjct: 3   LTLEIVTPEARVYSDTIDSVVIPTADGEVGILPGHIPLLTQVEDGELRVTKNG-QTEWLV 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD-QRFQMEQLLV 125
           V GG  ++      VL+E  +       +A+E  +      + +   +D   FQ  Q +V
Sbjct: 62  VGGGFAEVEGDRVRVLAEHAVTESTIDEKAVEDALRRAQDQMKDAAKMDPNEFQNLQSMV 121

Query: 126 DLS----CLRRR 133
             +     L+RR
Sbjct: 122 RFAGVQLALKRR 133


>gi|71734270|ref|YP_277279.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|298489520|ref|ZP_07007529.1| ATP synthase epsilon chain [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|119367758|sp|Q48BG6|ATPE_PSE14 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|71554823|gb|AAZ34034.1| ATP synthase F1, epsilon subunit [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|298155947|gb|EFH97058.1| ATP synthase epsilon chain [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
          Length = 141

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGD+ +  GHAP++T +K G + +     E   + 
Sbjct: 5  VHCDIVSAEGEIFSGLVEMVIAHGNLGDLGIAPGHAPLITDLKPGPIRLIKQGGEAEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 65 ISGGFLEVQPNMVKVLADTV 84


>gi|304413050|ref|ZP_07394523.1| membrane-bound ATP synthase, F1 complex, epsilon subunit
           [Candidatus Regiella insecticola LSR1]
 gi|304283893|gb|EFL92286.1| membrane-bound ATP synthase, F1 complex, epsilon subunit
           [Candidatus Regiella insecticola LSR1]
          Length = 142

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           V     ++VS EK +FSG VQ + +    G++ +  GHAP+LT IK G+V I   C +  
Sbjct: 3   VTTYRLDVVSAEKRMFSGVVQKIQVTGSEGELGIFPGHAPLLTAIKPGMVRIVKQCGDEA 62

Query: 64  RYVVIGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
              + GG+ ++ P+   VL++T I   D    +ALE +        ++  DVD      +
Sbjct: 63  FIYLSGGLLEVQPNVVIVLADTAIRGEDLDETKALEAKQKAETHIGHSHSDVDYAQVSAE 122

Query: 123 LLVDLSCLR 131
           L   ++ LR
Sbjct: 123 LAKAIAKLR 131


>gi|257485617|ref|ZP_05639658.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          tabaci ATCC 11528]
 gi|289628232|ref|ZP_06461186.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          aesculi str. NCPPB3681]
 gi|289649122|ref|ZP_06480465.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          aesculi str. 2250]
 gi|320321669|gb|EFW77768.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          glycinea str. B076]
 gi|320331128|gb|EFW87099.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          glycinea str. race 4]
 gi|330870057|gb|EGH04766.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          aesculi str. 0893_23]
 gi|330881926|gb|EGH16075.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          glycinea str. race 4]
 gi|330890269|gb|EGH22930.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv. mori
          str. 301020]
 gi|330987001|gb|EGH85104.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          lachrymans str. M301315]
 gi|331011906|gb|EGH91962.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          tabaci ATCC 11528]
          Length = 139

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGD+ +  GHAP++T +K G + +     E   + 
Sbjct: 3  VHCDIVSAEGEIFSGLVEMVIAHGNLGDLGIAPGHAPLITDLKPGPIRLIKQGGEAEVFY 62

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 63 ISGGFLEVQPNMVKVLADTV 82


>gi|302521949|ref|ZP_07274291.1| ATP synthase F1, epsilon subunit [Streptomyces sp. SPB78]
 gi|318060705|ref|ZP_07979428.1| F0F1 ATP synthase subunit epsilon [Streptomyces sp. SA3_actG]
 gi|333024391|ref|ZP_08452455.1| putative F0F1 ATP synthase subunit epsilon [Streptomyces sp.
           Tu6071]
 gi|302430844|gb|EFL02660.1| ATP synthase F1, epsilon subunit [Streptomyces sp. SPB78]
 gi|332744243|gb|EGJ74684.1| putative F0F1 ATP synthase subunit epsilon [Streptomyces sp.
           Tu6071]
          Length = 124

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  +    
Sbjct: 1   MAAELHVELVAADRSVWSGEATLVVARTTSGDIGVMPGHQPILGVLESGPVTIRTTEGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLN 109
               V GG      +  ++L+E     +   +Q  E+ ++   SD +
Sbjct: 61  VVVAVHGGFLSFADNKLSLLAEIAELSEEIDVQRAERALERAKSDAD 107


>gi|254491069|ref|ZP_05104250.1| ATP synthase F1, epsilon subunit [Methylophaga thiooxidans
          DMS010]
 gi|224463582|gb|EEF79850.1| ATP synthase F1, epsilon subunit [Methylophaga thiooxydans
          DMS010]
          Length = 142

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +F+G+ ++V   +  G+I +   H P+LT +K G V +  S  E  ++ 
Sbjct: 5  IHVDIVSAENEIFTGQAEAVFASAVEGEIGIYPRHTPLLTRLKPGEVRVLKSSGEEEQFY 64

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GGI ++ P   TVL++T
Sbjct: 65 VSGGILEVQPHLVTVLADT 83


>gi|120610481|ref|YP_970159.1| ATP synthase F1 subunit epsilon [Acidovorax citrulli AAC00-1]
 gi|120588945|gb|ABM32385.1| ATP synthase F1 subcomplex epsilon subunit [Acidovorax citrulli
           AAC00-1]
          Length = 162

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (51%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
             L  E+   E  V+SG V+ V LP   G   VL GH P+LT +++G V I     E   
Sbjct: 26  GALQLEIAHMEGLVWSGPVRVVGLPGAEGAFGVLHGHTPLLTRLRAGFVHIETPAGERIE 85

Query: 65  YVVIGGICDIVPSHCTVLSET 85
             V GG  +I P+  TVL++T
Sbjct: 86  VYVSGGYVEIQPARVTVLADT 106


>gi|84515111|ref|ZP_01002474.1| ATP synthase F1, epsilon subunit [Loktanella vestfoldensis SKA53]
 gi|84511270|gb|EAQ07724.1| ATP synthase F1, epsilon subunit [Loktanella vestfoldensis SKA53]
          Length = 141

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 6  DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
          ++ F+LVSPE+ + S     V +P+  GD+T +  H P +TT++ G++ + +       Y
Sbjct: 3  NVQFDLVSPERRLASVAASEVRIPATEGDMTAMANHLPTITTLRPGVLVV-VHDGGADEY 61

Query: 66 VVIGGICDIVPSHCTVLSETILP 88
          VV GG  +I     +VL+E  LP
Sbjct: 62 VVSGGFAEISAESVSVLAEQALP 84


>gi|29655230|ref|NP_820922.1| ATP synthase epsilon chain [Coxiella burnetii RSA 493]
 gi|153206155|ref|ZP_01945418.1| ATP synthase F1, epsilon subunit [Coxiella burnetii 'MSU Goat
          Q177']
 gi|154706031|ref|YP_001423600.1| F0F1 ATP synthase subunit epsilon [Coxiella burnetii Dugway
          5J108-111]
 gi|161831029|ref|YP_001597763.1| F0F1 ATP synthase subunit epsilon [Coxiella burnetii RSA 331]
 gi|165918748|ref|ZP_02218834.1| ATP synthase F1, epsilon subunit [Coxiella burnetii RSA 334]
 gi|212211724|ref|YP_002302660.1| F0F1 ATP synthase subunit epsilon [Coxiella burnetii CbuG_Q212]
 gi|212217739|ref|YP_002304526.1| F0F1 ATP synthase subunit epsilon [Coxiella burnetii CbuK_Q154]
 gi|60389767|sp|Q83AF4|ATPE_COXBU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|189081359|sp|A9KBF5|ATPE_COXBN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|189081360|sp|A9NBD2|ATPE_COXBR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226740240|sp|B6J964|ATPE_COXB1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226740241|sp|B6J2E1|ATPE_COXB2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|29542502|gb|AAO91436.1| ATP synthase epsilon chain [Coxiella burnetii RSA 493]
 gi|120577285|gb|EAX33909.1| ATP synthase F1, epsilon subunit [Coxiella burnetii 'MSU Goat
          Q177']
 gi|154355317|gb|ABS76779.1| ATP synthase epsilon chain [Coxiella burnetii Dugway 5J108-111]
 gi|161762896|gb|ABX78538.1| ATP synthase F1, epsilon subunit [Coxiella burnetii RSA 331]
 gi|165917576|gb|EDR36180.1| ATP synthase F1, epsilon subunit [Coxiella burnetii RSA 334]
 gi|212010134|gb|ACJ17515.1| ATP synthase epsilon chain [Coxiella burnetii CbuG_Q212]
 gi|212012001|gb|ACJ19381.1| ATP synthase epsilon chain [Coxiella burnetii CbuK_Q154]
          Length = 142

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 49/85 (57%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   +  E+VS E  +FSG+V+ +V+   +G++ +  GH  +LT++K G +   L   + 
Sbjct: 1  MAKTMQLEIVSAEAAIFSGKVEMIVVTGGMGELGIYPGHRQLLTSLKPGQIKAILEGGKE 60

Query: 63 HRYVVIGGICDIVPSHCTVLSETIL 87
            + + GG+ ++ P   T+L++T L
Sbjct: 61 EVFYMSGGMLEVQPEIVTILADTAL 85


>gi|294631414|ref|ZP_06709974.1| ATP synthase F1, epsilon subunit [Streptomyces sp. e14]
 gi|292834747|gb|EFF93096.1| ATP synthase F1, epsilon subunit [Streptomyces sp. e14]
          Length = 125

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVELVAADRQVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGAT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSD 107
               V GG         ++L+E     D   +Q +E+ ++   ++
Sbjct: 61  VVAAVHGGFISFADDKLSLLAEVAELSDEIDVQRVERELERAKAE 105


>gi|254382329|ref|ZP_04997689.1| ATP synthase epsilon chain [Streptomyces sp. Mg1]
 gi|194341234|gb|EDX22200.1| ATP synthase epsilon chain [Streptomyces sp. Mg1]
          Length = 124

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 53/104 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVELVAADRNVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGNT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCS 106
               V GG      +  ++L+E     D   +Q  E+ ++   S
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEIAELADEIDVQRAERALERAKS 104


>gi|113476899|ref|YP_722960.1| F0F1 ATP synthase subunit epsilon [Trichodesmium erythraeum
          IMS101]
 gi|119367808|sp|Q10Z37|ATPE_TRIEI RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|110167947|gb|ABG52487.1| ATP synthase F1, epsilon subunit [Trichodesmium erythraeum
          IMS101]
          Length = 137

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++P+K ++  E Q V+LPS  G + +L GHAP+LT + +G++ +    + I    
Sbjct: 3  LTVRVIAPDKTIWDKEAQEVILPSTTGQLGILGGHAPLLTALDTGVMRVRAENDWIA-IA 61

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          ++GG  +I     ++L       DN
Sbjct: 62 LMGGFAEIEADEVSILVNGAERGDN 86


>gi|90023605|ref|YP_529432.1| F0F1 ATP synthase subunit epsilon [Saccharophagus degradans 2-40]
 gi|119367778|sp|Q21DK9|ATPE_SACD2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|89953205|gb|ABD83220.1| ATP synthase F1, epsilon subunit [Saccharophagus degradans 2-40]
          Length = 140

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG ++ +V  S  GD+ +  GHAP+LT +K G V +     E   + 
Sbjct: 5  VHCDIVSAEQEIFSGAIELLVAASVEGDVGINYGHAPLLTALKPGPVRVKKLDGEEEIFY 64

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG  ++ P   TVL++T L
Sbjct: 65 VSGGYLEVQPHVVTVLADTAL 85


>gi|90415395|ref|ZP_01223329.1| ATP synthase epsilon chain [marine gamma proteobacterium
          HTCC2207]
 gi|90332718|gb|EAS47888.1| ATP synthase epsilon chain [marine gamma proteobacterium
          HTCC2207]
          Length = 141

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS ++ +FSG V+ VV    LG++ V  GHAP+L+ +K G V +     E   Y 
Sbjct: 5  VHCDIVSADESLFSGLVEMVVATGSLGELGVTAGHAPLLSDLKPGPVRLVKQNGEEEVYY 64

Query: 67 VIGGICDIVPSHCTVLSET 85
          + GG  ++ P++ ++L++T
Sbjct: 65 LSGGYLEVQPNNISILADT 83


>gi|148266274|ref|YP_001232980.1| F0F1 ATP synthase subunit epsilon [Geobacter uraniireducens Rf4]
 gi|189081365|sp|A5G9D9|ATPE_GEOUR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|146399774|gb|ABQ28407.1| ATP synthase F1 subcomplex epsilon subunit [Geobacter
           uraniireducens Rf4]
          Length = 138

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 64/133 (48%), Gaps = 3/133 (2%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  ELV+P K V S EV  +     LG+  VL GHAP LT++K G   ++   + +
Sbjct: 1   MAEKLKVELVTPYKRVLSEEVDEITATGALGEFGVLPGHAPFLTSLKIG--ELAYKKDGV 58

Query: 63  HRYVVIG-GICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            +++ +  G  ++     TVL ET    D   L+  +  +      L  +   D+ F++ 
Sbjct: 59  QQHMALNWGYFEVEGDKVTVLVETAERADEIDLERAKAALGRAEEALKKLSPEDKSFRIY 118

Query: 122 QLLVDLSCLRRRI 134
           +  ++ + +R ++
Sbjct: 119 EAALERAAIRMQV 131


>gi|329939840|ref|ZP_08289141.1| F0F1 ATP synthase subunit epsilon [Streptomyces griseoaurantiacus
           M045]
 gi|329301410|gb|EGG45305.1| F0F1 ATP synthase subunit epsilon [Streptomyces griseoaurantiacus
           M045]
          Length = 124

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 55/111 (49%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVELVAADRQVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
               V GG         ++L+E     D   +Q  E+ ++   S+ +   +
Sbjct: 61  VVAAVHGGFLSFADDKLSLLAEIAELSDEIDVQRAERALERAKSEADASAE 111


>gi|311281704|ref|YP_003943935.1| ATP synthase F1, epsilon subunit [Enterobacter cloacae SCF1]
 gi|308750899|gb|ADO50651.1| ATP synthase F1, epsilon subunit [Enterobacter cloacae SCF1]
          Length = 139

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQFGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
            GGI ++ P   TVL++T I   D    +ALE +        ++  DVD      +L   
Sbjct: 66  SGGIIEVQPGTVTVLADTAIRGQDLDEARALESKRKAEEHIKSSHGDVDYAQASAELAKA 125

Query: 127 LSCLR 131
           ++ LR
Sbjct: 126 IAKLR 130


>gi|282600456|ref|ZP_05974352.2| ATP synthase F1, epsilon subunit [Providencia rustigianii DSM 4541]
 gi|282565108|gb|EFB70643.1| ATP synthase F1, epsilon subunit [Providencia rustigianii DSM 4541]
          Length = 141

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H  +VS EK +F G VQ V +    G++ +   H P+LT IK G+V I+    E     
Sbjct: 7   FHLTVVSAEKQMFDGRVQKVQVTGSEGELGIYPQHTPLLTAIKPGMVRITKQFGEEELIY 66

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ 116
           + GGI ++ P+   VL++T +    +D A     +++ +E     +   D  Q
Sbjct: 67  LSGGILEVQPTGVIVLADTAIRGKDLDEARAVEAKRKAEEHIRKAHGDVDYAQ 119


>gi|319902314|ref|YP_004162042.1| ATP synthase F1 subcomplex epsilon subunit [Bacteroides
          helcogenes P 36-108]
 gi|319417345|gb|ADV44456.1| ATP synthase F1 subcomplex epsilon subunit [Bacteroides
          helcogenes P 36-108]
          Length = 90

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +  LH  +VSPEK +F+GEV+SV LP  +G  ++L  HAP++++++ G +      EE H
Sbjct: 1  MKKLHLNIVSPEKELFNGEVESVTLPGAMGSFSILPQHAPIVSSLRMGTLIYVTDGEE-H 59

Query: 64 RYVVIGGICDI 74
          +  +  G  ++
Sbjct: 60 KLDIQSGFVEM 70


>gi|149193990|ref|ZP_01871088.1| F0F1 ATP synthase subunit epsilon [Caminibacter mediatlanticus
           TB-2]
 gi|149135943|gb|EDM24421.1| F0F1 ATP synthase subunit epsilon [Caminibacter mediatlanticus
           TB-2]
          Length = 126

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 51/109 (46%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++V+P   +F GE++    P   G+  VL GH P++T +K G++T+           
Sbjct: 1   MKIDIVTPLGRIFQGEIKEATFPGIDGEFGVLDGHLPLVTNLKPGVITLKKDNGNEEVIA 60

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD 115
           +  G  ++ P H  VL+E  +P+  +    + + I+     +    D D
Sbjct: 61  INWGYVEVTPEHINVLAEGAVPVTGSSESEIAEAIERAKKLIQEAADSD 109


>gi|78185912|ref|YP_373955.1| ATP synthase F1, epsilon subunit [Chlorobium luteolum DSM 273]
 gi|78165814|gb|ABB22912.1| ATP synthase F1 subcomplex epsilon subunit [Chlorobium luteolum
          DSM 273]
          Length = 88

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 47/77 (61%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          ++V+P+K  FSGEV SV+ P + G   V+  HAP+L+ +K G V +SL+ +    + +  
Sbjct: 11 DIVTPQKLHFSGEVVSVIAPGQDGLFQVMKNHAPLLSALKGGKVRLSLADKTEKTFTISD 70

Query: 70 GICDIVPSHCTVLSETI 86
          G  ++  +   +L+E++
Sbjct: 71 GFFEVSANKAILLTESV 87


>gi|255692506|ref|ZP_05416181.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides finegoldii DSM 17565]
 gi|260621781|gb|EEX44652.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides finegoldii DSM 17565]
          Length = 85

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 45/71 (63%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          + +LH  +VSPEK +F G+V+ V LP  +G  ++L GHAP+++++++G ++ +    E  
Sbjct: 1  MKELHLSIVSPEKSIFDGDVKIVTLPGTVGSFSILPGHAPIVSSLQAGTLSYTTMEGEER 60

Query: 64 RYVVIGGICDI 74
             + GG  ++
Sbjct: 61 TIDIQGGFVEL 71


>gi|90409080|ref|ZP_01217204.1| ATP synthase subunit epsilon [Psychromonas sp. CNPT3]
 gi|90309807|gb|EAS37968.1| ATP synthase subunit epsilon [Psychromonas sp. CNPT3]
          Length = 139

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 52/93 (55%), Gaps = 4/93 (4%)

Query: 1  MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLS 58
          M+     H ++VS E  +FSG V  + +  + G++ ++ GH P+LT IK G++ +     
Sbjct: 1  MTKAMTTHLDVVSAEGSLFSGRVSHLSVSGQEGELGIMPGHTPLLTAIKPGVIKLVKQGG 60

Query: 59 CEEIHRYVVIGGICDIVPSHCTVLSETILPMDN 91
           EE+    + GG  ++ PS  T+L++T +  ++
Sbjct: 61 AEEV--IYISGGFLEVQPSSVTILADTAIRAED 91


>gi|254423814|ref|ZP_05037532.1| ATP synthase F1, epsilon subunit [Synechococcus sp. PCC 7335]
 gi|196191303|gb|EDX86267.1| ATP synthase F1, epsilon subunit [Synechococcus sp. PCC 7335]
          Length = 157

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 8/85 (9%)

Query: 1  MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
          MSLV      +V+P+K V+  E + V+LPS  G + +L GHAP+LT + +G++ +  S E
Sbjct: 20 MSLV----VRVVAPDKTVWDDEAEEVILPSTTGQLGILGGHAPLLTALDTGVLRVR-SAE 74

Query: 61 EIHRYVVI---GGICDIVPSHCTVL 82
              +  I   GG  ++     T+L
Sbjct: 75 GAKEWTAIALMGGFAEVDEDEVTIL 99


>gi|329894811|ref|ZP_08270611.1| ATP synthase epsilon chain [gamma proteobacterium IMCC3088]
 gi|328922705|gb|EGG30039.1| ATP synthase epsilon chain [gamma proteobacterium IMCC3088]
          Length = 140

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+ +V    LG++ V  GHAP+LT++  G V +     E   + 
Sbjct: 5  IHCDIVSAEQEIFSGLVEMLVATGTLGELGVGYGHAPLLTSLVPGPVRVVKQGGEEDIFY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          V GG  ++ P   ++L++T L  D+
Sbjct: 65 VSGGFLEVQPGVVSILADTALRADD 89


>gi|197120310|ref|YP_002140737.1| F0F1 ATP synthase subunit epsilon [Geobacter bemidjiensis Bem]
 gi|226740258|sp|B5EFI6|ATPE_GEOBB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|197089670|gb|ACH40941.1| ATP synthase F1, epsilon subunit [Geobacter bemidjiensis Bem]
          Length = 138

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 1/129 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  ELV+P K V S EV  +     LG+  VL GHAP LT++K G +         
Sbjct: 1   MAEKLKVELVTPYKKVLSEEVDEITATGALGEFGVLPGHAPFLTSLKIGELAYRKDGVS- 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           H   +  G  ++     TVL ET    D   L+  +  +    ++L  +   D+ F++ +
Sbjct: 60  HHMALNWGYFEVENDTVTVLVETAEKADEIDLERAKAALGRAETELKGLTPEDKNFRIYE 119

Query: 123 LLVDLSCLR 131
             ++ + +R
Sbjct: 120 AALERALIR 128


>gi|296282404|ref|ZP_06860402.1| F0F1 ATP synthase subunit epsilon [Citromicrobium bathyomarinum
          JL354]
          Length = 85

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 7/84 (8%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV----TISLSCEEI 62
          LHFELV+P + V S +V  VV+P   G+  VL GHAP ++TI+ G +    T   S E I
Sbjct: 3  LHFELVTPARHVRSDDVHMVVVPGTEGEFGVLEGHAPFMSTIRDGALQIFKTAGASPETI 62

Query: 63 HRYVVIGGICDIVPSHCTVLSETI 86
              V GG  ++  +  T+L+E +
Sbjct: 63 E---VRGGFAEVGENGLTILAEHV 83


>gi|302846841|ref|XP_002954956.1| hypothetical protein VOLCADRAFT_95875 [Volvox carteri f.
          nagariensis]
 gi|208751253|gb|ACI31232.1| ATP synthase CF1 epsilon subunit [Volvox carteri]
 gi|261888180|gb|ACY06035.1| ATP synthase CF1 epsilon subunit [Volvox carteri f. nagariensis]
 gi|300259719|gb|EFJ43944.1| hypothetical protein VOLCADRAFT_95875 [Volvox carteri f.
          nagariensis]
          Length = 141

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 51/90 (56%), Gaps = 5/90 (5%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-----SLSCEE 61
          L   +++PE+  ++G+   ++LP+E G++ VL  HAP++T +  G + I     + S ++
Sbjct: 3  LQISILTPERPFWNGQADEIILPTETGEMGVLKNHAPIITGLDVGAMLIRGGQATGSKDD 62

Query: 62 IHRYVVIGGICDIVPSHCTVLSETILPMDN 91
           + Y ++GG   +  +  T+L+   +  +N
Sbjct: 63 WNSYAIMGGFALVKQNQVTILANEAVSAEN 92


>gi|145630341|ref|ZP_01786122.1| ATP synthase subunit epsilon [Haemophilus influenzae R3021]
 gi|260582256|ref|ZP_05850049.1| ATP synthase F1, epsilon subunit [Haemophilus influenzae NT127]
 gi|144984076|gb|EDJ91513.1| ATP synthase subunit epsilon [Haemophilus influenzae R3021]
 gi|260094624|gb|EEW78519.1| ATP synthase F1, epsilon subunit [Haemophilus influenzae NT127]
          Length = 142

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 65/128 (50%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +F GEV+ +      G++ +L GH P+LT IK GIV  +L         
Sbjct: 4   FNLTIVSAEQKIFEGEVKQIQATGVEGELGILPGHTPLLTAIKPGIVKFTLKDGNEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P+  TVL++  +    +D   +   +++ +E    +++  D D    + +L
Sbjct: 64  VSGGFLEVQPNIVTVLADVAIRGSELDADRIHEAKRKAEENI--VSHGSDADHDLLVAKL 121

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 122 AKELAKLR 129


>gi|294143105|ref|YP_003559083.1| ATP synthase F1 subunit epsilon [Shewanella violacea DSS12]
 gi|293329574|dbj|BAJ04305.1| ATP synthase F1, epsilon subunit [Shewanella violacea DSS12]
          Length = 142

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (55%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  ++VS E  ++SG V  + +    GD+ ++ GHAP+LT IK G+  I     +   + 
Sbjct: 6  VQLDIVSAESSIYSGLVAHLQVTGGEGDLGIMPGHAPLLTNIKPGMARIVKQDGKEEVFY 65

Query: 67 VIGGICDIVPSHCTVLSETILPMDNACLQA 96
          + GGI ++ PS  +VL++ ++  D    QA
Sbjct: 66 LSGGILEVQPSSVSVLADVVMRADEIDEQA 95


>gi|313681888|ref|YP_004059626.1| ATP synthase f1 subcomplex epsilon subunit [Sulfuricurvum kujiense
           DSM 16994]
 gi|313154748|gb|ADR33426.1| ATP synthase F1 subcomplex epsilon subunit [Sulfuricurvum kujiense
           DSM 16994]
          Length = 129

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 53/107 (49%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+++P   +F+G  +SV LP E G+  VL  H  + T +++G+V I     +    V
Sbjct: 4   LQLEVLTPSGSIFNGPAKSVTLPGEEGEFGVLPEHVALTTLLQAGVVDIQKENGKTESIV 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
           V  G+  I  +   VL +  + +       + K +DE  S +N+I D
Sbjct: 64  VNWGVVQITQNKVVVLVDGAVAIRGESEGEIAKALDEAKSLINSIAD 110


>gi|82546108|ref|YP_410055.1| F0F1 ATP synthase subunit epsilon [Shigella boydii Sb227]
 gi|187732621|ref|YP_001882432.1| F0F1 ATP synthase subunit epsilon [Shigella boydii CDC 3083-94]
 gi|119367784|sp|Q31UN1|ATPE_SHIBS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|226740288|sp|B2TUP4|ATPE_SHIB3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|81247519|gb|ABB68227.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit [Shigella
           boydii Sb227]
 gi|187429613|gb|ACD08887.1| ATP synthase F1, epsilon subunit [Shigella boydii CDC 3083-94]
 gi|320186286|gb|EFW61022.1| ATP synthase epsilon chain [Shigella flexneri CDC 796-83]
 gi|332089494|gb|EGI94598.1| ATP synthase F1, epsilon subunit [Shigella boydii 3594-74]
          Length = 139

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
            GGI ++   + TVL++T +    +D A     +++ +E  S  +   D  Q
Sbjct: 66  SGGILEVQSGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQ 117


>gi|103487770|ref|YP_617331.1| F0F1 ATP synthase subunit epsilon [Sphingopyxis alaskensis
          RB2256]
 gi|98977847|gb|ABF53998.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Sphingopyxis alaskensis RB2256]
          Length = 88

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L FELV+P +   S +V  V +P   GD +VL GHAP + T+++G +TI  +       +
Sbjct: 6  LKFELVTPARLERSADVHMVTVPGTEGDFSVLEGHAPFMATLRNGPLTIYAAAGAAPEVI 65

Query: 67 -VIGGICDIVPSHCTVLSETI 86
           V GG  ++  +  TVL+E I
Sbjct: 66 EVEGGFAEVNEAGLTVLAEHI 86


>gi|254509076|ref|ZP_05121179.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus 16]
 gi|219548009|gb|EED25031.1| ATP synthase F1, epsilon subunit [Vibrio parahaemolyticus 16]
          Length = 140

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 3/113 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK +FSG V++  +    G++ +  GH P+LT I  G+V +           
Sbjct: 6   FHLDVVSAEKKIFSGRVETFQVTGSEGELGIFHGHTPLLTAITPGMVRLVKQHGHEEFIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           V GG+ ++ P   TVL++T +    +D A  +  ++   E   + +   D  Q
Sbjct: 66  VSGGMVEVQPGTATVLADTAIRGEELDAAKAEEAKRCAQEAIQNQHGDMDFAQ 118


>gi|320174621|gb|EFW49757.1| ATP synthase epsilon chain [Shigella dysenteriae CDC 74-1112]
          Length = 137

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 4   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 63

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
            GGI ++   + TVL++T +    +D A     +++ +E  S  +   D  Q
Sbjct: 64  SGGILEVQSGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQ 115


>gi|224372374|ref|YP_002606746.1| F0F1 ATP synthase subunit epsilon [Nautilia profundicola AmH]
 gi|223589146|gb|ACM92882.1| ATP synthase F1, epsilon subunit [Nautilia profundicola AmH]
          Length = 126

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHR 64
           +  ++V+P   ++ GEV+    P   G+  VL GHAP++TT++ GI+TI      EEI  
Sbjct: 1   MKLDIVTPLGRIYEGEVKEAYFPGIEGEFGVLEGHAPLMTTLQPGIITIKKEDGSEEI-- 58

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD 115
             +  G  ++ P H  VL +   P+       + + I++    + +  + D
Sbjct: 59  IAINSGYVEVTPDHVNVLVDGAQPVSGEKAGDIAEAIEKAKKLIRDAANSD 109


>gi|268315650|ref|YP_003289369.1| ATP synthase F1, epsilon subunit [Rhodothermus marinus DSM 4252]
 gi|262333184|gb|ACY46981.1| ATP synthase F1, epsilon subunit [Rhodothermus marinus DSM 4252]
          Length = 142

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  E+V+P++ VF GE  SV  P   G   VL  HAP++  I  G + ++    E 
Sbjct: 1   MARTLFVEIVAPDRRVFRGEALSVRAPGVEGSFEVLYNHAPMVAAITVGPIFVTTPSGER 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILP---MDNACLQALEKR 100
             +   GG  +++ +  T+L+ET  P   +D    +A E+R
Sbjct: 61  ITFATSGGFVEVLGNTVTILAETAEPASEIDVERARAAEQR 101


>gi|189485466|ref|YP_001956407.1| F0F1-type ATP synthase epsilon subunit [uncultured Termite group 1
           bacterium phylotype Rs-D17]
 gi|254809438|sp|B1H0B4|ATPE_UNCTG RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|170287425|dbj|BAG13946.1| F0F1-type ATP synthase epsilon subunit [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 138

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +N    E++SPE  VF G   SV  P+  G ITVL GH  ++T + SG + I  + +   
Sbjct: 1   MNKFEVEILSPEGIVFKGATPSVSFPTTRGIITVLSGHINLITKLNSGEIIIE-ATDGTK 59

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
           + +V GG  +IV ++  V++E     D    Q +++ ID    D+ N
Sbjct: 60  KIIVSGGFIEIVNNNVNVVAEFAAHSDEISRQKIKQAIDH-AKDMKN 105


>gi|302536957|ref|ZP_07289299.1| ATP synthase F1, epsilon subunit [Streptomyces sp. C]
 gi|302445852|gb|EFL17668.1| ATP synthase F1, epsilon subunit [Streptomyces sp. C]
          Length = 124

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 53/104 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVELVAADRNVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCS 106
               V GG      +  ++L+E     D   +Q  E+ ++   S
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEIAELADEIDVQRAERALERAKS 104


>gi|284925401|gb|ADC27753.1| F0F1 ATP synthase subunit epsilon [Campylobacter jejuni subsp.
          jejuni IA3902]
          Length = 129

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%), Gaps = 1/53 (1%)

Query: 4  VNDL-HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          +NDL +FE+V+P   ++ GEV+SV LP   G+  VL GHA +++++KSG++ I
Sbjct: 1  MNDLINFEIVTPLGVIYQGEVKSVTLPGSEGEFGVLKGHAALVSSLKSGVIDI 53


>gi|57237115|ref|YP_178127.1| F0F1 ATP synthase subunit epsilon [Campylobacter jejuni RM1221]
 gi|86149599|ref|ZP_01067829.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni CF93-6]
 gi|86151519|ref|ZP_01069734.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 260.94]
 gi|86154074|ref|ZP_01072275.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni HB93-13]
 gi|88597623|ref|ZP_01100856.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 84-25]
 gi|121613437|ref|YP_999832.1| F0F1 ATP synthase subunit epsilon [Campylobacter jejuni subsp.
          jejuni 81-176]
 gi|148926908|ref|ZP_01810586.1| ATP synthase F1 sector epsilon subunit [Campylobacter jejuni
          subsp. jejuni CG8486]
 gi|167004803|ref|ZP_02270561.1| F0F1 ATP synthase subunit epsilon [Campylobacter jejuni subsp.
          jejuni 81-176]
 gi|205356483|ref|ZP_03223247.1| ATP synthase F1 sector epsilon subunit [Campylobacter jejuni
          subsp. jejuni CG8421]
 gi|218561789|ref|YP_002343568.1| F0F1 ATP synthase subunit epsilon [Campylobacter jejuni subsp.
          jejuni NCTC 11168]
 gi|283955552|ref|ZP_06373047.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 1336]
 gi|315123710|ref|YP_004065714.1| ATP synthase subunit epsilon [Campylobacter jejuni subsp. jejuni
          ICDCCJ07001]
 gi|20137539|sp|Q9PJ18|ATPE_CAMJE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|81675656|sp|Q5HX58|ATPE_CAMJR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|166222447|sp|A1VXJ1|ATPE_CAMJJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|57165919|gb|AAW34698.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni RM1221]
 gi|85839867|gb|EAQ57126.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni CF93-6]
 gi|85841866|gb|EAQ59113.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 260.94]
 gi|85842488|gb|EAQ59702.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni HB93-13]
 gi|87249011|gb|EAQ71973.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 81-176]
 gi|88189927|gb|EAQ93903.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 84-25]
 gi|112359495|emb|CAL34279.1| ATP synthase F1 sector epsilon subunit [Campylobacter jejuni
          subsp. jejuni NCTC 11168]
 gi|145844485|gb|EDK21593.1| ATP synthase F1 sector epsilon subunit [Campylobacter jejuni
          subsp. jejuni CG8486]
 gi|205345670|gb|EDZ32309.1| ATP synthase F1 sector epsilon subunit [Campylobacter jejuni
          subsp. jejuni CG8421]
 gi|283793013|gb|EFC31787.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 1336]
 gi|315017432|gb|ADT65525.1| ATP synthase subunit epsilon [Campylobacter jejuni subsp. jejuni
          ICDCCJ07001]
 gi|315057548|gb|ADT71877.1| ATP synthase epsilon chain [Campylobacter jejuni subsp. jejuni
          S3]
 gi|315926954|gb|EFV06316.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni DFVF1099]
 gi|315929751|gb|EFV08922.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 305]
          Length = 129

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%), Gaps = 1/53 (1%)

Query: 4  VNDL-HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          +NDL +FE+V+P   ++ GEV+SV LP   G+  VL GHA +++++KSG++ I
Sbjct: 1  MNDLINFEIVTPLGVIYQGEVKSVTLPGSEGEFGVLKGHAALVSSLKSGVIDI 53


>gi|113972251|ref|YP_736044.1| F0F1 ATP synthase subunit epsilon [Shewanella sp. MR-4]
 gi|114049500|ref|YP_740050.1| F0F1 ATP synthase subunit epsilon [Shewanella sp. MR-7]
 gi|117922560|ref|YP_871752.1| F0F1 ATP synthase subunit epsilon [Shewanella sp. ANA-3]
 gi|119367782|sp|Q0HD80|ATPE_SHESM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|119367783|sp|Q0HPG2|ATPE_SHESR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222496|sp|A0L2S7|ATPE_SHESA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|113886935|gb|ABI40987.1| ATP synthase F1, epsilon subunit [Shewanella sp. MR-4]
 gi|113890942|gb|ABI44993.1| ATP synthase F1, epsilon subunit [Shewanella sp. MR-7]
 gi|117614892|gb|ABK50346.1| ATP synthase F1, epsilon subunit [Shewanella sp. ANA-3]
          Length = 142

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 60/112 (53%), Gaps = 11/112 (9%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
           +  ++VS E  +FSG V S+ +    G++ ++ GHAP+L+ IK G+  I      EE+  
Sbjct: 6   VQLDIVSAESSIFSGRVASLQVTGSEGELGIMHGHAPLLSYIKPGMARIVKQDGSEEV-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETILPM----DNACLQA---LEKRIDEVCSDLN 109
           + + GG+ ++ PS  +VL++ ++      + A L+A    E  +    +D N
Sbjct: 64  FYLSGGLLEVQPSSVSVLADVVMRAKDIDEQAALEAKRRAEAHMATAGADFN 115


>gi|67924175|ref|ZP_00517618.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Crocosphaera watsonii WH 8501]
 gi|67853991|gb|EAM49307.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Crocosphaera watsonii WH 8501]
          Length = 136

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 55/105 (52%), Gaps = 8/105 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+ G+V+ ++LPS  G + +L GHAP+LT + +G++ +    ++     
Sbjct: 3   LTVRVITPDKTVWDGDVEEIILPSTSGQLGILGGHAPLLTALDTGVIRVRPD-KDWKSIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDEV 104
           V+GG  ++      VL  +    D+       A   A + R++E 
Sbjct: 62  VMGGFAEVEQDEIKVLVNSAEAGDDIDKETAKADYSAAQSRLEEA 106


>gi|145640452|ref|ZP_01796036.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae R3021]
 gi|319775595|ref|YP_004138083.1| F1 sector of membrane-bound ATP synthase subunit epsilon
           [Haemophilus influenzae F3047]
 gi|329122359|ref|ZP_08250946.1| ATP synthase F1 sector epsilon subunit [Haemophilus aegyptius ATCC
           11116]
 gi|145275038|gb|EDK14900.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 22.4-21]
 gi|317450186|emb|CBY86402.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Haemophilus influenzae F3047]
 gi|327473641|gb|EGF19060.1| ATP synthase F1 sector epsilon subunit [Haemophilus aegyptius ATCC
           11116]
          Length = 142

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +F GEV+ + +    G++ +L GH P+LT IK GIV  +L         
Sbjct: 4   FNLTIVSAEQKIFEGEVKQIQVTGVEGELGILPGHTPLLTAIKPGIVKFTLKDGNEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P+  TVL++  +    +D   +   +++ +E    +++  D D    + +L
Sbjct: 64  VSGGFLEVQPNIVTVLADIAIRGSELDADRIHEAKRKAEENI--VSHGSDADHDLLVAKL 121

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 122 SKELAKLR 129


>gi|226947192|ref|YP_002802265.1| F0F1 ATP synthase subunit epsilon [Azotobacter vinelandii DJ]
 gi|226722119|gb|ACO81290.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
          [Azotobacter vinelandii DJ]
          Length = 140

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 48/79 (60%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+ V+  + +GD+ +L GH P+LT +K G V +     +   + 
Sbjct: 3  VHCDIVSAEEELFSGLVEMVIAHANMGDVGILPGHMPLLTDLKPGPVRVIKQGGDEEIFY 62

Query: 67 VIGGICDIVPSHCTVLSET 85
          + GG  ++ PS   VL++T
Sbjct: 63 ISGGFLEVQPSMVKVLADT 81


>gi|88811292|ref|ZP_01126548.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Nitrococcus mobilis Nb-231]
 gi|88791831|gb|EAR22942.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Nitrococcus mobilis Nb-231]
          Length = 141

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 47/81 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG    V  P+ +G++ +   H+P++T ++ G V +  +  +   + 
Sbjct: 5  IHVDIVSSESAIFSGPALMVFAPASMGEVGITPRHSPLITALRPGEVRVQPAEGDEEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GGI ++ P   TVLS+T L
Sbjct: 65 VSGGILEVQPHVVTVLSDTAL 85


>gi|57504648|ref|ZP_00370726.1| ATP synthase F1, epsilon subunit [Campylobacter coli RM2228]
 gi|305432649|ref|ZP_07401810.1| ATP synthase F1 sector epsilon subunit [Campylobacter coli JV20]
 gi|57019417|gb|EAL56112.1| ATP synthase F1, epsilon subunit [Campylobacter coli RM2228]
 gi|304444360|gb|EFM37012.1| ATP synthase F1 sector epsilon subunit [Campylobacter coli JV20]
          Length = 129

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 55/99 (55%), Gaps = 2/99 (2%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
           N + FE+V+P   ++ GEV+SV LP   G+  VL GHA +++++KSG++ I    +  H 
Sbjct: 3   NLISFEIVTPMGVIYQGEVKSVTLPGSEGEFGVLKGHAALVSSLKSGVIDIE-KADLNHE 61

Query: 65  YVVI-GGICDIVPSHCTVLSETILPMDNACLQALEKRID 102
            + I  G   +     +VL++  + +  +    +EK ++
Sbjct: 62  LIAIDAGHAKVDEDKISVLAKGAVWISGSSESEIEKNLE 100


>gi|330505855|ref|YP_004382724.1| F0F1 ATP synthase subunit epsilon [Pseudomonas mendocina NK-01]
 gi|328920141|gb|AEB60972.1| F0F1 ATP synthase subunit epsilon [Pseudomonas mendocina NK-01]
          Length = 141

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 47/80 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGD+ +  GHAP++T +K G + +     E   + 
Sbjct: 5  VHCDIVSAEAEIFSGLVEMVIAHGNLGDLGIAPGHAPLITDLKPGPIRLIKQGGEDEVFY 64

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 65 ISGGFLEVQPNMVKVLADTV 84


>gi|313676738|ref|YP_004054734.1| ATP synthase f1 subcomplex epsilon subunit [Marivirga tractuosa
          DSM 4126]
 gi|312943436|gb|ADR22626.1| ATP synthase F1 subcomplex epsilon subunit [Marivirga tractuosa
          DSM 4126]
          Length = 82

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+++PEK VF G V S   P   G   VL  HAP+++++  G +  S   +     VV G
Sbjct: 4  EIITPEKNVFKGNVDSATFPGSNGSFQVLNNHAPLISSLDKGDLKFS-DGKNNTTIVVDG 62

Query: 70 GICDIVPSHCTVLSETIL 87
          G+ +++ ++ TVL+E ++
Sbjct: 63 GVVEVLNNNITVLAEKVI 80


>gi|16272425|ref|NP_438638.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae Rd KW20]
 gi|68249080|ref|YP_248192.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 86-028NP]
 gi|145628858|ref|ZP_01784658.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 22.1-21]
 gi|145636254|ref|ZP_01791923.1| ATP synthase subunit epsilon [Haemophilus influenzae PittHH]
 gi|145638606|ref|ZP_01794215.1| ATP synthase subunit epsilon [Haemophilus influenzae PittII]
 gi|148825243|ref|YP_001289996.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae PittEE]
 gi|148827674|ref|YP_001292427.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae PittGG]
 gi|229844361|ref|ZP_04464501.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 6P18H1]
 gi|229846565|ref|ZP_04466673.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 7P49H1]
 gi|260580458|ref|ZP_05848286.1| ATP synthase F1, epsilon subunit [Haemophilus influenzae RdAW]
 gi|1168590|sp|P43718|ATPE_HAEIN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|81336514|sp|Q4QN65|ATPE_HAEI8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222462|sp|A5UA12|ATPE_HAEIE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222463|sp|A5UGY8|ATPE_HAEIG RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|1573456|gb|AAC22136.1| ATP synthase F1, subunit epsilon (atpC) [Haemophilus influenzae Rd
           KW20]
 gi|68057279|gb|AAX87532.1| ATP synthase epsilon chain [Haemophilus influenzae 86-028NP]
 gi|144979328|gb|EDJ89014.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 22.1-21]
 gi|145270419|gb|EDK10353.1| ATP synthase subunit epsilon [Haemophilus influenzae PittHH]
 gi|145272201|gb|EDK12109.1| ATP synthase subunit epsilon [Haemophilus influenzae PittII]
 gi|148715403|gb|ABQ97613.1| ATP synthase subunit epsilon [Haemophilus influenzae PittEE]
 gi|148718916|gb|ABR00044.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae PittGG]
 gi|229810658|gb|EEP46376.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 7P49H1]
 gi|229812610|gb|EEP48299.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 6P18H1]
 gi|260092800|gb|EEW76735.1| ATP synthase F1, epsilon subunit [Haemophilus influenzae RdAW]
 gi|309750107|gb|ADO80091.1| Membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Haemophilus influenzae R2866]
 gi|309972366|gb|ADO95567.1| Membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Haemophilus influenzae R2846]
          Length = 142

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 65/128 (50%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +F GEV+ + +    G++ +L GH P+LT IK GIV  +L         
Sbjct: 4   FNLTIVSAEQKIFEGEVKQIQVTGVEGELGILPGHTPLLTAIKPGIVKFTLKDGNEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P+  TVL++  +    +D   +   +++ +E    ++   D D    + +L
Sbjct: 64  VSGGFLEVQPNIVTVLADIAIRGSELDADRIHEAKRKAEENI--VSRGSDADHDLLVAKL 121

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 122 SKELAKLR 129


>gi|320354739|ref|YP_004196078.1| ATP synthase F1 subcomplex subunit epsilon [Desulfobulbus
           propionicus DSM 2032]
 gi|320123241|gb|ADW18787.1| ATP synthase F1 subcomplex epsilon subunit [Desulfobulbus
           propionicus DSM 2032]
          Length = 138

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 10/131 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY- 65
           +  E+V+P   V S EV  V  P   G+  VL  HAP L+TIK+G  T+S   + + +Y 
Sbjct: 4   IQLEVVTPNGAVVSEEVDIVTAPGVGGEFGVLANHAPFLSTIKTG--TLSFKKDRVTKYL 61

Query: 66  VVIGGICDIVPSHCTVLSETI-----LPMDNA--CLQALEKRIDEVCSDLNNICDVDQRF 118
           +V GG  ++  +  T L E+      + +D A    +  EKR+ +       I  V    
Sbjct: 62  MVTGGFTEVSNNKITFLVESAEFGNEIDVDRALRAKERAEKRLTQTQQATEKINRVRAEA 121

Query: 119 QMEQLLVDLSC 129
            +++ +  L  
Sbjct: 122 ALQRAMARLRT 132


>gi|269468572|gb|EEZ80221.1| F0F1-type ATP synthase, epsilon subunit [uncultured SUP05 cluster
           bacterium]
          Length = 138

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 58/111 (52%), Gaps = 4/111 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS  + ++SGE   V  P+  G++ +   H  +L+T+K G V +  S   I    
Sbjct: 4   IHVDVVSATESLYSGEANCVFAPASTGELGIYPKHVALLSTLKPGEVRVETSS-GIESIY 62

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDV 114
           V GGI ++ P   T+ S+T +    +D +     ++R +E  +D +N  D+
Sbjct: 63  VSGGIVEVQPDVVTIFSDTAIRAHDLDESKALEAKQRAEEAMADTDNGYDI 113


>gi|242620113|ref|YP_003002117.1| ATP synthase CF1 epsilon chain [Aureococcus anophagefferens]
 gi|239997358|gb|ACS36881.1| ATP synthase CF1 epsilon chain [Aureococcus anophagefferens]
          Length = 139

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 71/132 (53%), Gaps = 9/132 (6%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            L+  +++PEK   + E + VVLPS  G + +L GHAP++T +++G++    +       
Sbjct: 2   SLNVRIITPEKVFLTSETEQVVLPSITGGLGILAGHAPLVTILEAGVLRYK-NNGSWTPT 60

Query: 66  VVIGGICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDV---DQRFQ 119
           V+ GG  ++  +  TVL   +E +    ++ ++ +EK + +  ++L  + +    D++ +
Sbjct: 61  VLYGGFAEVENNQVTVLVNGAEEV--ASSSSIEEVEKALVDATANLEKVKETISEDRKLK 118

Query: 120 MEQLLVDLSCLR 131
            E L V ++  R
Sbjct: 119 PEILKVQIAKAR 130


>gi|57234666|ref|YP_181308.1| ATP synthase F1, epsilon subunit [Dehalococcoides ethenogenes
          195]
 gi|119361426|sp|Q3Z8Z1|ATPE_DEHE1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|57225114|gb|AAW40171.1| ATP synthase F1, epsilon subunit [Dehalococcoides ethenogenes
          195]
          Length = 140

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ VFS EV  VV P   G++ +L  HAP++T +++G +   +  EE +  V
Sbjct: 4  LKLDIVTAERSVFSEEVDLVVAPGIEGEMAILPHHAPLMTALQAGELKAKIGSEE-YSMV 62

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  ++ P    VL+++
Sbjct: 63 VSGGFLEVRPDRVIVLADS 81


>gi|157414421|ref|YP_001481677.1| F0F1 ATP synthase subunit epsilon [Campylobacter jejuni subsp.
          jejuni 81116]
 gi|172046992|sp|A8FJR3|ATPE_CAMJ8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|157385385|gb|ABV51700.1| ATP synthase F1 sector epsilon subunit [Campylobacter jejuni
          subsp. jejuni 81116]
 gi|307747065|gb|ADN90335.1| ATP synthase epsilon chain [Campylobacter jejuni subsp. jejuni
          M1]
 gi|315931502|gb|EFV10469.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 327]
          Length = 129

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%), Gaps = 1/53 (1%)

Query: 4  VNDL-HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          +NDL +FE+V+P   ++ GEV+SV LP   G+  VL GHA +++++KSG++ I
Sbjct: 1  MNDLINFEIVTPLGVIYQGEVKSVTLPGSEGEFGVLKGHATLVSSLKSGVIDI 53


>gi|322434787|ref|YP_004216999.1| ATP synthase F1, epsilon subunit [Acidobacterium sp. MP5ACTX9]
 gi|321162514|gb|ADW68219.1| ATP synthase F1, epsilon subunit [Acidobacterium sp. MP5ACTX9]
          Length = 143

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 3/107 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   LV+P++ +  G   +V LPS  G +  L G AP+L  + +G V +     +   + 
Sbjct: 10  LAVRLVTPDRVLLDGFADAVELPSASGYLEALYGAAPLLAELGAGEVRLHGGDSDGKVFF 69

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNN 110
           V  G  +++P   T+L+ET L    +D A  +A  KR + + S+  +
Sbjct: 70  VAWGFVEVLPERVTILAETALKPEEIDRAAAEAELKRGETMWSEAGD 116


>gi|73748404|ref|YP_307643.1| F0F1 ATP synthase subunit epsilon [Dehalococcoides sp. CBDB1]
 gi|147669184|ref|YP_001214002.1| ATP synthase F1, epsilon subunit [Dehalococcoides sp. BAV1]
 gi|289432452|ref|YP_003462325.1| ATP synthase F1 subunit epsilon [Dehalococcoides sp. GT]
 gi|119361427|sp|Q3ZZT6|ATPE_DEHSC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|189081361|sp|A5FRQ6|ATPE_DEHSB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|73660120|emb|CAI82727.1| ATP synthase F1, epsilon subunit [Dehalococcoides sp. CBDB1]
 gi|146270132|gb|ABQ17124.1| ATP synthase F1 subcomplex epsilon subunit [Dehalococcoides sp.
          BAV1]
 gi|288946172|gb|ADC73869.1| ATP synthase F1, epsilon subunit [Dehalococcoides sp. GT]
          Length = 140

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ VFS EV  VV P   G++ +L  HAP++T +++G +   +  EE +  V
Sbjct: 4  LKLDIVTAERSVFSEEVDVVVAPGIEGEMAILPHHAPLMTALQAGELKAKIGTEE-YSLV 62

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  ++ P    VL+++
Sbjct: 63 VSGGFLEVRPDRVVVLADS 81


>gi|206577989|ref|YP_002241288.1| ATP synthase F1, epsilon subunit [Klebsiella pneumoniae 342]
 gi|288937927|ref|YP_003441986.1| ATP synthase F1 subunit epsilon [Klebsiella variicola At-22]
 gi|290511667|ref|ZP_06551035.1| ATP synthase F1, epsilon subunit [Klebsiella sp. 1_1_55]
 gi|226740265|sp|B5XZM5|ATPE_KLEP3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|206567047|gb|ACI08823.1| ATP synthase F1, epsilon subunit [Klebsiella pneumoniae 342]
 gi|288892636|gb|ADC60954.1| ATP synthase F1, epsilon subunit [Klebsiella variicola At-22]
 gi|289775457|gb|EFD83457.1| ATP synthase F1, epsilon subunit [Klebsiella sp. 1_1_55]
          Length = 139

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 7/128 (5%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E  +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAELQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GGI ++ P   TVL++T +    +D A  L+A  K  + + S      DVD      +L
Sbjct: 66  SGGILEVQPGSVTVLADTAIRGQDLDEARALEAKRKAEEHIKSSHG---DVDYAQASAEL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AKAIAKLR 130


>gi|51244687|ref|YP_064571.1| ATP synthase, epsilon chain (AtpE) [Desulfotalea psychrophila
           LSv54]
 gi|60389559|sp|Q6AQ09|ATPE_DESPS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|50875724|emb|CAG35564.1| probable ATP synthase, epsilon chain (AtpE) [Desulfotalea
           psychrophila LSv54]
          Length = 138

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 58/119 (48%), Gaps = 15/119 (12%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   ++ E+V+P   + + +V  V  P   GD  VL  HAP+L+TIK G +T  +  EE 
Sbjct: 1   MAQQINLEVVTPSGSIINKDVDIVNAPGSGGDFGVLANHAPLLSTIKIGALTYEIG-EER 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETI-----LPMDNACLQAL--EKRI-------DEVCSD 107
           +  +V GG C++  +  T L E+      +  D A    +  EKRI       DE  SD
Sbjct: 60  NTLMVSGGFCEVSNNKITFLVESAEAKQDIDTDRAMKAKIRAEKRIAKHGLPSDEAYSD 118


>gi|260771026|ref|ZP_05879954.1| ATP synthase epsilon chain [Vibrio furnissii CIP 102972]
 gi|260613915|gb|EEX39106.1| ATP synthase epsilon chain [Vibrio furnissii CIP 102972]
 gi|315178662|gb|ADT85576.1| F0F1 ATP synthase subunit epsilon [Vibrio furnissii NCTC 11218]
          Length = 140

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
           H ++VS EK +FSG V++  +    G++ +  GH P+LT I  G+V I      EEI  
Sbjct: 6  FHLDVVSAEKKIFSGLVETFQVTGSEGELGIFHGHTPLLTAITPGMVRIVKQHGHEEI-- 63

Query: 65 YVVIGGICDIVPSHCTVLSETIL 87
            V GGI ++ P   TVL++T +
Sbjct: 64 IYVSGGIIEVQPGTATVLADTAI 86


>gi|24376218|ref|NP_720262.1| F0F1 ATP synthase subunit epsilon [Shewanella oneidensis MR-1]
 gi|60389790|sp|Q8E8C1|ATPE_SHEON RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|24351278|gb|AAN57705.1|AE015907_3 ATP synthase F1, epsilon subunit [Shewanella oneidensis MR-1]
          Length = 142

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E  +FSG V S+ +    G++ ++ GHAP+L+ IK G+  I         + 
Sbjct: 6   VQLDIVSAESSIFSGRVASLQVTGSEGELGIMHGHAPLLSYIKPGMARIVKQDGNEEVFY 65

Query: 67  VIGGICDIVPSHCTVLSETILPM----DNACLQA---LEKRIDEVCSDLN 109
           + GG+ ++ PS  +VL++ ++      + A L+A    E  +    +D N
Sbjct: 66  LSGGLLEVQPSSVSVLADVVMRAKDIDEQAALEAKRRAEAHMATAGADFN 115


>gi|224024063|ref|ZP_03642429.1| hypothetical protein BACCOPRO_00780 [Bacteroides coprophilus DSM
          18228]
 gi|224017285|gb|EEF75297.1| hypothetical protein BACCOPRO_00780 [Bacteroides coprophilus DSM
          18228]
          Length = 83

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
           +LH  +VSPE+ V+ G+V SV LP E+G   +L GHAP+++++ +G +  ++  +E   
Sbjct: 4  KELHLTVVSPERTVYDGKVLSVTLPGEVGSFQILPGHAPLISSLGAGELKYTVG-KETQV 62

Query: 65 YVVIGGICDI 74
            + GG  ++
Sbjct: 63 LQIAGGFVEV 72


>gi|218248403|ref|YP_002373774.1| F0F1 ATP synthase subunit epsilon [Cyanothece sp. PCC 8801]
 gi|257061469|ref|YP_003139357.1| F0F1 ATP synthase subunit epsilon [Cyanothece sp. PCC 8802]
 gi|226740243|sp|B7K2R7|ATPE_CYAP8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|218168881|gb|ACK67618.1| ATP synthase F1, epsilon subunit [Cyanothece sp. PCC 8801]
 gi|256591635|gb|ACV02522.1| ATP synthase F1, epsilon subunit [Cyanothece sp. PCC 8802]
          Length = 136

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++P+K V+ G+V+  +LPS  G + +L  HAP+LT +  G++ + L  ++    V
Sbjct: 3  LQVRVITPDKIVWDGDVEEAILPSTSGQLGILPSHAPLLTNLDIGVMRVRLD-KDWKSLV 61

Query: 67 VIGGICDI 74
          V+GGI ++
Sbjct: 62 VMGGIAEV 69


>gi|163751423|ref|ZP_02158648.1| ATP synthase F1, epsilon subunit [Shewanella benthica KT99]
 gi|161328726|gb|EDP99874.1| ATP synthase F1, epsilon subunit [Shewanella benthica KT99]
          Length = 142

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 57/110 (51%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E  ++SG V  + +    GD+ ++ GHAP+LT IK G+  I     +   + 
Sbjct: 6   VQLDIVSAESSIYSGLVAHLQVTGGEGDLGIMPGHAPLLTNIKPGMARIVKQDGKEEVFY 65

Query: 67  VIGGICDIVPSHCTVLSETILPMD----NACLQA---LEKRIDEVCSDLN 109
           + GGI ++ P   +VL++ ++  D     A ++A    E  + E  +D N
Sbjct: 66  LSGGILEVQPFSVSVLADVVMRADEIDEQAAVEAKRHAEASLAEAGADFN 115


>gi|83649672|ref|YP_438107.1| F0F1 ATP synthase subunit epsilon [Hahella chejuensis KCTC 2396]
 gi|119367735|sp|Q2S6P2|ATPE_HAHCH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|83637715|gb|ABC33682.1| F0F1-type ATP synthase, epsilon subunit (mitochondrial delta
          subunit) [Hahella chejuensis KCTC 2396]
          Length = 141

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+ V+     GD+ +  GH P+LT +  G V I     E   + 
Sbjct: 5  VHCDIVSAEQEIFSGLVEMVIAAGSEGDLGITPGHTPLLTALNPGPVRIIKQGGEEEVFF 64

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  ++ P+  T+LS++
Sbjct: 65 VTGGFLEVQPNMVTILSDS 83


>gi|332976824|gb|EGK13650.1| ATP synthase F1 sector epsilon subunit [Psychrobacter sp.
           1501(2011)]
          Length = 138

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 20/124 (16%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHR 64
           L   +VS  + +++GE+  ++     G++ +L GH P++T +K G + I L    EE+  
Sbjct: 4   LQCRVVSAREEIYTGEISMLIATGSEGEVGILAGHTPLITLLKPGSMRIQLPDGSEEV-- 61

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
             V GG+ ++ P   TVL++T +  D                DL+    ++ R Q EQ+L
Sbjct: 62  IYVSGGVLEVQPKLVTVLADTAVRAD----------------DLDEAKIIEARKQAEQML 105

Query: 125 VDLS 128
           V+ S
Sbjct: 106 VNQS 109


>gi|254387509|ref|ZP_05002748.1| ATP synthase epsilon chain [Streptomyces clavuligerus ATCC 27064]
 gi|197701235|gb|EDY47047.1| ATP synthase epsilon chain [Streptomyces clavuligerus ATCC 27064]
          Length = 123

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  +  E    V
Sbjct: 1   MHVELVAADRQVWSGEATLVVARTASGDIGVMPGHQPLLGVLESGPVTIRTTSPEGAGTV 60

Query: 67  VI---GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
           V    GG      +  ++L+E     D    Q  E+ ++   S+ +   +
Sbjct: 61  VAAVHGGFISFADNKLSLLAEIAELADEIDAQRAERALERARSESDAAAE 110


>gi|51209971|ref|YP_063635.1| ATP synthase CF1 epsilon subunit [Gracilaria tenuistipitata var.
           liui]
 gi|60389561|sp|Q6B8S5|ATPE_GRATL RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|50657725|gb|AAT79710.1| ATP synthase CF1 epsilon subunit [Gracilaria tenuistipitata var.
           liui]
          Length = 134

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 60/118 (50%), Gaps = 1/118 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L+  +++P++ V+    + V+LPS  G + +L GH P+LT I  G++ + +  +E    +
Sbjct: 3   LNIRVIAPDRTVWDANAEEVILPSSTGQVGILKGHIPLLTAIDIGVMRVRIE-KEWQPII 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
           ++GG  ++     T+L      +    ++A ++ +++    LN   +   + +  Q L
Sbjct: 62  LLGGFAEVKDDKITILVNGAEEVSKIEIKAAKENLEKATKILNEARNDKDKIEATQNL 119


>gi|32034349|ref|ZP_00134549.1| COG0355: F0F1-type ATP synthase, epsilon subunit (mitochondrial
           delta subunit) [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
          Length = 139

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 8   HFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
            FEL  VS EK +F+G V SV +    G++ V  GH P+LT+IK G+V  +L   +    
Sbjct: 4   QFELSVVSAEKEIFNGNVVSVRVSGIDGELGVYAGHTPLLTSIKPGMVKYTLENGKEEFI 63

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQAL--EKRIDEVCSDLNNICDVDQRFQME 121
            V GG  ++ P+  TVL++  +  + +  Q +   KR  E    +++  ++  +   E
Sbjct: 64  YVSGGFLEVQPTIVTVLADVAIRGEESHQQRILAAKRKAEDTLXISDTAELSAKLSRE 121


>gi|187932336|ref|YP_001884712.1| ATP synthase F1, epsilon subunit [Clostridium botulinum B str.
          Eklund 17B]
 gi|226740236|sp|B2TK01|ATPE_CLOBB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|187720489|gb|ACD21710.1| ATP synthase F1, epsilon subunit [Clostridium botulinum B str.
          Eklund 17B]
          Length = 134

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 49/90 (54%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          ++V+P+K +F+G ++ + L + +G + +L  HA ++T+  S IV  + +  +  +  +  
Sbjct: 8  KIVTPDKDIFNGNIKRIFLKNSVGRLEILANHANMVTSTISSIVEFTDADGKDRKLFISK 67

Query: 70 GICDIVPSHCTVLSETILPMDNACLQALEK 99
          GI  I  +  T+ SE+    DN  L   EK
Sbjct: 68 GIASIFNNEMTIFSESAEFSDNIDLNRAEK 97


>gi|270307928|ref|YP_003329986.1| ATP synthase F1, epsilon subunit [Dehalococcoides sp. VS]
 gi|270153820|gb|ACZ61658.1| ATP synthase F1, epsilon subunit [Dehalococcoides sp. VS]
          Length = 140

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ VFS EV  VV P   G++ +L  HAP++T +++G +   +  EE +  V
Sbjct: 4  LKLDIVTAERSVFSEEVDVVVAPGIEGEMAILPHHAPLMTALQAGELKAKIGSEE-YSMV 62

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  ++ P    VL+++
Sbjct: 63 VSGGFLEVRPDRVIVLADS 81


>gi|94263071|ref|ZP_01286890.1| H+-transporting two-sector ATPase, delta/epsilon subunit [delta
           proteobacterium MLMS-1]
 gi|94266420|ref|ZP_01290115.1| H+-transporting two-sector ATPase, delta/epsilon subunit [delta
           proteobacterium MLMS-1]
 gi|93452962|gb|EAT03461.1| H+-transporting two-sector ATPase, delta/epsilon subunit [delta
           proteobacterium MLMS-1]
 gi|93456614|gb|EAT06722.1| H+-transporting two-sector ATPase, delta/epsilon subunit [delta
           proteobacterium MLMS-1]
          Length = 137

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 8/130 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
              E+V+P+  V S EV+ V  P   G   VL  HAP+L+TIK G +       + H   
Sbjct: 5   FQLEIVTPKGAVLSEEVEIVTAPGYAGVFGVLANHAPLLSTIKVGNLVYKKDGRD-HMVT 63

Query: 67  VIGGICDIVPSHCTVLSETI-----LPMDNA--CLQALEKRIDEVCSDLNNICDVDQRFQ 119
           + GG C++  +  T L E+      +  D A    +  EKR+ E  +    I        
Sbjct: 64  ISGGFCEVSNNKATFLVESAERGAEIDADRALRAKERAEKRLAEAVAQKEKIDRARAEAA 123

Query: 120 MEQLLVDLSC 129
           +++ L  L  
Sbjct: 124 LQRALARLKA 133


>gi|188590445|ref|YP_001919899.1| ATP synthase F1, epsilon subunit [Clostridium botulinum E3 str.
          Alaska E43]
 gi|251778969|ref|ZP_04821889.1| ATP synthase F1, epsilon subunit [Clostridium botulinum E1 str.
          'BoNT E Beluga']
 gi|226740235|sp|B2UZK1|ATPE_CLOBA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|188500726|gb|ACD53862.1| ATP synthase F1, epsilon subunit [Clostridium botulinum E3 str.
          Alaska E43]
 gi|243083284|gb|EES49174.1| ATP synthase F1, epsilon subunit [Clostridium botulinum E1 str.
          'BoNT E Beluga']
          Length = 134

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 49/90 (54%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          ++V+P+K +F+G ++ + L + +G + +L  HA ++T+  S IV  + +  +  +  V  
Sbjct: 8  KIVTPDKDIFNGNIKRIFLRNSVGRLEILANHANMVTSTVSSIVEFTDAEGKDRKLFVSK 67

Query: 70 GICDIVPSHCTVLSETILPMDNACLQALEK 99
          GI  I  +  T+ SE+    DN  L   EK
Sbjct: 68 GIASIFNNEMTIFSESAEFSDNIDLNRAEK 97


>gi|330898627|gb|EGH30046.1| F0F1 ATP synthase subunit epsilon [Pseudomonas syringae pv.
          japonica str. M301072PT]
          Length = 139

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 46/80 (57%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ V+    LGDI +  GHAP++T +K G + +         + 
Sbjct: 3  VHCDIVSAEGEIFSGLVEMVIAHGNLGDIGIAPGHAPLITDLKPGPIRLIKQGGGAEVFY 62

Query: 67 VIGGICDIVPSHCTVLSETI 86
          + GG  ++ P+   VL++T+
Sbjct: 63 ISGGFLEVQPNMVKVLADTV 82


>gi|171909874|ref|ZP_02925344.1| ATP synthase F1, epsilon subunit [Verrucomicrobium spinosum DSM
           4136]
          Length = 140

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 66/130 (50%), Gaps = 10/130 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+V+PEK VFS  V +VVLP   G++ VL  H P++T +  G   ++ + E +  ++
Sbjct: 3   LKLEIVTPEKRVFSDTVDTVVLPGSEGELGVLESHVPLVTALHPG--ELAYTKEGVVEHL 60

Query: 67  VIG-GICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
            +G G  +I      VL++  +    +D   ++   KR +E    L +  D+      E+
Sbjct: 61  AVGTGFVEITGHRVAVLTDMAMAESDIDEKAVEEALKRAEETVEKLKHSPDIGG----EE 116

Query: 123 LLVDLSCLRR 132
           L   ++ ++R
Sbjct: 117 LATVMASIQR 126


>gi|303237053|ref|ZP_07323623.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella disiens FB035-09AN]
 gi|302482440|gb|EFL45465.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella disiens FB035-09AN]
          Length = 79

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 46/68 (67%), Gaps = 1/68 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  +++SPEK +F GEV++V++P E+G+  +L  HAP+++T+  G V  +++ E+    +
Sbjct: 2  LVLKIISPEKILFQGEVENVLVPGEMGEFEILNNHAPIISTLVEGRVVYTINDEK-KTIM 60

Query: 67 VIGGICDI 74
          V GG  ++
Sbjct: 61 VKGGFVEV 68


>gi|220910364|ref|YP_002485675.1| F0F1 ATP synthase subunit epsilon [Cyanothece sp. PCC 7425]
 gi|254809359|sp|B8HP54|ATPE_CYAP4 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|219866975|gb|ACL47314.1| ATP synthase F1, epsilon subunit [Cyanothece sp. PCC 7425]
          Length = 138

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+    + V+LPS  G + +L GHAP+LT +++G++ +  S +E     
Sbjct: 3   LTVRVIAPDKTVWDSPAEEVILPSTTGQLGILSGHAPLLTALETGVMRVR-SGKEWLPIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  ++  +  T+L       D       E       + L+     D R    Q + +
Sbjct: 62  LMGGFAEVENNEVTILVNAAERGDRIDRAQAEASYAAAQTKLSQAEQSDSRQAKIQAVQE 121

Query: 127 LSCLRRRIQ 135
           L   R R+Q
Sbjct: 122 LKRARARVQ 130


>gi|217326483|ref|ZP_03442567.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|217322704|gb|EEC31128.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|326340521|gb|EGD64320.1| ATP synthase epsilon chain [Escherichia coli O157:H7 str. 1044]
          Length = 137

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 4   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 63

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
            GGI ++   + TVL++T +    +D A     +++ +E  S  +   D  Q
Sbjct: 64  SGGILEVQLGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQ 115


>gi|317052410|ref|YP_004113526.1| ATP synthase F1 subunit epsilon [Desulfurispirillum indicum S5]
 gi|316947494|gb|ADU66970.1| ATP synthase F1, epsilon subunit [Desulfurispirillum indicum S5]
          Length = 138

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   +  ELV+P K + S +V S+ +    GD +VL  H P+LTT++ G ++  ++  E 
Sbjct: 1  MAEKIRLELVTPTKQLLSVDVDSISMVGTEGDFSVLPNHTPMLTTLEMGELSYQVNG-ET 59

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
          H   V  G C+++P    +L+ET
Sbjct: 60 HFVFVDWGFCEVLPDKVIILAET 82


>gi|15804331|ref|NP_290370.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O157:H7 EDL933]
 gi|15833927|ref|NP_312700.1| F0F1 ATP synthase subunit epsilon [Escherichia coli O157:H7 str.
           Sakai]
 gi|189403743|ref|ZP_02784938.2| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|20137293|sp|P58646|ATPE_ECO57 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|12518588|gb|AAG58934.1|AE005605_2 membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Escherichia coli O157:H7 str. EDL933]
 gi|13364148|dbj|BAB38096.1| membrane-bound ATP synthase epsilon-subunit AtpC [Escherichia coli
           O157:H7 str. Sakai]
 gi|189369862|gb|EDU88278.1| ATP synthase F1, epsilon subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|209753900|gb|ACI75257.1| membrane-bound ATP synthase beta-subunit AtpD [Escherichia coli]
          Length = 139

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6   HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQ 116
            GGI ++   + TVL++T +    +D A     +++ +E  S  +   D  Q
Sbjct: 66  SGGILEVQLGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQ 117


>gi|297618428|ref|YP_003703587.1| ATP synthase F1 subunit epsilon [Syntrophothermus lipocalidus DSM
           12680]
 gi|297146265|gb|ADI03022.1| ATP synthase F1, epsilon subunit [Syntrophothermus lipocalidus DSM
           12680]
          Length = 139

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 60/109 (55%), Gaps = 9/109 (8%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
            E+V+PE+ V S EV+ +V+P+  G++ VL  HAP++  +K G++      + I R++ +
Sbjct: 8   LEVVTPERIVLSDEVEFMVVPAVEGELGVLRNHAPMVAGLKIGVLRYR-GTDGITRHMAV 66

Query: 69  -GGICDIVPSHCTVLSETI-------LPMDNACLQALEKRIDEVCSDLN 109
            GG  +++ +   VL+ET        +    A  +  E+R+ +   ++N
Sbjct: 67  SGGFMEVIDNEAIVLAETAERGSEIDILRAKAAKERAERRLQQRTEEIN 115


>gi|295697746|ref|YP_003590984.1| ATP synthase F1, epsilon subunit [Bacillus tusciae DSM 2912]
 gi|295413348|gb|ADG07840.1| ATP synthase F1, epsilon subunit [Bacillus tusciae DSM 2912]
          Length = 139

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 48/80 (60%), Gaps = 7/80 (8%)

Query: 9  FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           ++V+PE+ V+S  V+ V+L    GD+ +L GH P++TT+  G+V I    +E  R+ ++
Sbjct: 6  LDIVTPERTVYSRPVEMVILRGAEGDLGILPGHMPLVTTLPIGLVRI----KEEGRWSLV 61

Query: 69 ---GGICDIVPSHCTVLSET 85
             GG  ++ P   TVL+E 
Sbjct: 62 ALSGGFLEVRPDRVTVLAEA 81


>gi|188025438|ref|ZP_02958631.2| hypothetical protein PROSTU_00377 [Providencia stuartii ATCC 25827]
 gi|188023448|gb|EDU61488.1| hypothetical protein PROSTU_00377 [Providencia stuartii ATCC 25827]
          Length = 141

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H  +VS EK +F G VQ + +    G++ +   H P+LT IK G+V I+    E     +
Sbjct: 8   HLTVVSAEKQMFEGLVQKIQVTGSEGELGIYPQHTPLLTAIKPGMVRITKQFGEEELIYL 67

Query: 68  IGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ 116
            GGI ++ P+   VL++T +    +D A     ++R +E     +   D  Q
Sbjct: 68  SGGILEVQPNGVIVLADTAIRGKDLDEARALESKRRAEEHVRKAHGDVDYAQ 119


>gi|326203256|ref|ZP_08193121.1| LOW QUALITY PROTEIN: ATP synthase F1, epsilon subunit [Clostridium
           papyrosolvens DSM 2782]
 gi|325986514|gb|EGD47345.1| LOW QUALITY PROTEIN: ATP synthase F1, epsilon subunit [Clostridium
           papyrosolvens DSM 2782]
          Length = 134

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 63/134 (47%), Gaps = 11/134 (8%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
              E+++PE+  FSGE + V+  S  G++ VL  HAP ++ +  G + I+   + I   V
Sbjct: 4   FFLEVLTPERKFFSGEAECVIFKSSDGEMGVLAKHAPTVSAVSVGPLRINAQGKWIE-AV 62

Query: 67  VIGGICDIVPSHCTVLSETI-LPMD------NACLQALEKRIDEVCSDLNNICDVDQRFQ 119
           V  G   I+P    +L++T   P +       A  Q  E+R+ +  S L  +     +  
Sbjct: 63  VTEGFAKIMPDKVVILTDTAEYPEEIDINRAKAAKQRAEERLQKKLSQLEYM---RSKTA 119

Query: 120 MEQLLVDLSCLRRR 133
           + + +  LS   +R
Sbjct: 120 LARAMARLSATNKR 133


>gi|157964050|ref|YP_001504084.1| F0F1 ATP synthase subunit epsilon [Shewanella pealeana ATCC
          700345]
 gi|189081379|sp|A8HAG2|ATPE_SHEPA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|157849050|gb|ABV89549.1| ATP synthase F1, epsilon subunit [Shewanella pealeana ATCC
          700345]
          Length = 142

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 52/92 (56%), Gaps = 4/92 (4%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
          +  ++VS E  +FSG V  + +    G++ ++ GHA +LT+IK G+  I      EE+  
Sbjct: 6  VQLDMVSAENHIFSGRVAQLQVSGTEGELGIMPGHAALLTSIKPGMARIVKQNGSEEV-- 63

Query: 65 YVVIGGICDIVPSHCTVLSETILPMDNACLQA 96
          + + GGI ++ PS  +VL++ +L  D    QA
Sbjct: 64 FYLSGGILEVQPSSISVLADVVLRADEIDEQA 95


>gi|146309619|ref|YP_001190084.1| F0F1 ATP synthase subunit epsilon [Pseudomonas mendocina ymp]
 gi|166990386|sp|A4Y186|ATPE_PSEMY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|145577820|gb|ABP87352.1| ATP synthase F1 subcomplex epsilon subunit [Pseudomonas mendocina
          ymp]
          Length = 144

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 4/81 (4%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
          +H ++VS E+ +FSG V+ V+    LGD+ +L GH P+LT +K G V +      EE+  
Sbjct: 5  VHCDIVSAEEELFSGLVEMVIAHGHLGDLGILPGHTPLLTDLKPGPVRVIKQGGTEEV-- 62

Query: 65 YVVIGGICDIVPSHCTVLSET 85
          + + GG  ++ PS   VL++T
Sbjct: 63 FYISGGFLEVQPSMVKVLADT 83


>gi|284039967|ref|YP_003389897.1| H+transporting two-sector ATPase delta/subunit epsilon [Spirosoma
          linguale DSM 74]
 gi|283819260|gb|ADB41098.1| H+transporting two-sector ATPase delta/epsilon subunit [Spirosoma
          linguale DSM 74]
          Length = 81

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  ++++P++ VFSGE  +V  P   G   VL  HAP+++T+  G V +  +  +   + 
Sbjct: 1  MTLDIITPDRKVFSGEATAVTFPGSEGQFQVLNNHAPLVSTLDKGQVVVQTASGQ-QTFT 59

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG+ +++ +   VL+E I+
Sbjct: 60 VDGGVVEVLQNRVLVLAEAIV 80


>gi|94501601|ref|ZP_01308118.1| hypothetical protein RED65_08464 [Oceanobacter sp. RED65]
 gi|94426284|gb|EAT11275.1| hypothetical protein RED65_08464 [Oceanobacter sp. RED65]
          Length = 142

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+ ++     GD+ ++ GH P+LT ++ G V +     E   + 
Sbjct: 5  VHCDIVSAEEAIFSGRVEMLIAAGVQGDLGIMHGHTPLLTKLRPGPVRVIKQNGEEEIFY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDN----ACLQA 96
          V  G  ++ P   TVL++T     N    A L+A
Sbjct: 65 VSSGFLEVQPDGVTVLADTAARASNLDEAAALEA 98


>gi|330850636|ref|YP_004376517.1| ATP synthase CF1 epsilon subunit [Ptilidium pulcherrimum]
 gi|302024765|gb|ADK89611.1| ATP synthase CF1 epsilon subunit [Ptilidium pulcherrimum]
          Length = 135

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ E+Q ++L +  G I +L  HAP+LT +  GIV I L  E+     
Sbjct: 3  LNLRVMAPNRIVWNSEIQEIILSTNSGQIGILPNHAPLLTALDIGIVKIRLK-EQWSTMA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  T+L
Sbjct: 62 LMGGFAMIENNQMTIL 77


>gi|56751795|ref|YP_172496.1| F0F1 ATP synthase subunit epsilon [Synechococcus elongatus PCC
           6301]
 gi|81301125|ref|YP_401333.1| F0F1 ATP synthase subunit epsilon [Synechococcus elongatus PCC
           7942]
 gi|61219614|sp|P0A2Z8|ATPE_SYNE7 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|61219616|sp|P0A2Z9|ATPE_SYNP6 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|48025|emb|CAA29363.1| unnamed protein product [Synechococcus elongatus PCC 6301]
 gi|436955|gb|AAB82021.1| epsilon subunit of ATP synthase [Synechococcus elongatus PCC 7942]
 gi|56686754|dbj|BAD79976.1| ATP synthase epsilon subunit [Synechococcus elongatus PCC 6301]
 gi|81170006|gb|ABB58346.1| ATP synthase F1, epsilon subunit [Synechococcus elongatus PCC 7942]
          Length = 137

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 56/115 (48%), Gaps = 3/115 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P++ V+    Q V+LPS  G + +L GHAP+L+ + +G++ +    E +    
Sbjct: 3   LTVRVIAPDRTVWDAPAQEVILPSTTGQLGILPGHAPLLSALDTGVLRVRADKEWLA-IA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQ--RFQ 119
           V+GG  ++  +  TVL       D   L+       +    L  + + D+  +FQ
Sbjct: 62  VLGGFAEVENNEVTVLVNAAERGDKIDLEEARAAFSQADERLKGVKEDDRQGKFQ 116


>gi|323345610|ref|ZP_08085833.1| ATP synthase F1 sector epsilon subunit [Prevotella oralis ATCC
          33269]
 gi|323093724|gb|EFZ36302.1| ATP synthase F1 sector epsilon subunit [Prevotella oralis ATCC
          33269]
          Length = 80

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 43/68 (63%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  +++SPE+ +F+GEV +VV+P  LG+  +L  HAP++++++ G +   +   E     
Sbjct: 2  LKLKIISPERIIFTGEVDNVVVPGTLGEFEILSNHAPIISSLEKGTIRFIMPKGEKTAID 61

Query: 67 VIGGICDI 74
          ++GG  ++
Sbjct: 62 ILGGFVEV 69


>gi|198283039|ref|YP_002219360.1| ATP synthase F1 subunit epsilon [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|198247560|gb|ACH83153.1| ATP synthase F1, epsilon subunit [Acidithiobacillus ferrooxidans
           ATCC 53993]
          Length = 171

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 52/91 (57%)

Query: 18  VFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPS 77
           V++G  + V +P+ELG+I +L GHAP+L+ ++ G + I+    +     + GG+ +I P 
Sbjct: 18  VYTGMARFVAVPAELGEIGILPGHAPLLSGLRPGELRITQPDGQTQILFLEGGMLEIQPD 77

Query: 78  HCTVLSETILPMDNACLQALEKRIDEVCSDL 108
             T+L++  L + +  +    +RI +  S L
Sbjct: 78  IVTILADASLRISDINIHESRERIKDAQSTL 108


>gi|311745477|ref|ZP_07719262.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Algoriphagus sp. PR1]
 gi|126578030|gb|EAZ82250.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Algoriphagus sp. PR1]
          Length = 81

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 48/82 (58%), Gaps = 3/82 (3%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H E+V+P+K VF GEV     P   G   VL  HAP+++ +  G  T+S + +E  + +
Sbjct: 1  MHLEIVTPDKKVFQGEVTEASFPGANGSFQVLNNHAPIVSALAKG--TVSFTTDEGKQSM 58

Query: 67 VI-GGICDIVPSHCTVLSETIL 87
          V+ GG+ ++  +   +L+E ++
Sbjct: 59 VVDGGVVEVKDNVIVLLAEKVV 80


>gi|220927731|ref|YP_002504640.1| ATP synthase F1 subunit epsilon [Clostridium cellulolyticum H10]
 gi|259585478|sp|B8I580|ATPE_CLOCE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|219998059|gb|ACL74660.1| ATP synthase F1, epsilon subunit [Clostridium cellulolyticum H10]
          Length = 134

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 63/134 (47%), Gaps = 11/134 (8%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
              E+++P++  FSGE + V+  S  G++ VL  HAP ++ +  G + I+   + I   V
Sbjct: 4   FFLEVLTPDRKFFSGEAECVIFKSSDGEMGVLAKHAPTVSAVSVGPLRINAQGKWIE-AV 62

Query: 67  VIGGICDIVPSHCTVLSETI-LPMD------NACLQALEKRIDEVCSDLNNICDVDQRFQ 119
           V  G   I+P    +L++T   P +       A  Q  E+R+ +  S L  +     +  
Sbjct: 63  VTEGFAKIMPDKVVILTDTAEYPEEIDINRAKAAKQRAEERLQKKLSQLEYM---RSKTA 119

Query: 120 MEQLLVDLSCLRRR 133
           + + +  LS   RR
Sbjct: 120 LARAMARLSATNRR 133


>gi|119776775|ref|YP_929515.1| F0F1 ATP synthase subunit epsilon [Shewanella amazonensis SB2B]
 gi|119769275|gb|ABM01846.1| ATP synthase F1, epsilon subunit [Shewanella amazonensis SB2B]
          Length = 141

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (53%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  +FSG V+ + +    G++ ++ GHAP+LT IK G+V I     +   + 
Sbjct: 5   VHLDIVSAETRIFSGLVEHLQVTGGEGELGIMPGHAPLLTFIKPGMVRIVKQHGKEEVFY 64

Query: 67  VIGGICDIVPSHCTVLSETILPM----DNACLQA---LEKRIDEVCSDLN 109
           + GG+ ++  +  +VL++  L      + A L+A    E  + E  +D N
Sbjct: 65  LSGGLLEVQANSVSVLADVALRAKDIDEQAALEAKRRAEAHMAEAGADFN 114


>gi|145632745|ref|ZP_01788479.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 3655]
 gi|145634524|ref|ZP_01790233.1| ATP synthase subunit epsilon [Haemophilus influenzae PittAA]
 gi|144986940|gb|EDJ93492.1| F0F1 ATP synthase subunit epsilon [Haemophilus influenzae 3655]
 gi|145268069|gb|EDK08064.1| ATP synthase subunit epsilon [Haemophilus influenzae PittAA]
          Length = 142

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 65/128 (50%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +F GEV+ +      G++ +L GH P+LT IK GIV  +L         
Sbjct: 4   FNLTIVSAEQKIFEGEVKQIQATGVEGELGILPGHTPLLTAIKPGIVKFTLKDGNEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P+  TVL++  +    +D   +   +++ +E    +++  D D    + +L
Sbjct: 64  VSGGFLEVQPNIVTVLADIAIRGSELDADRIYEAKRKAEENI--VSHGSDADHDLLVAKL 121

Query: 124 LVDLSCLR 131
             +L+ LR
Sbjct: 122 SKELAKLR 129


>gi|329962160|ref|ZP_08300169.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Bacteroides fluxus YIT 12057]
 gi|328530565|gb|EGF57432.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Bacteroides fluxus YIT 12057]
          Length = 83

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
          ++  LH  +VSPEK +F+GEV+ V LP  +G  ++L  HAP+++++ +G +      EE
Sbjct: 1  MMKGLHLTIVSPEKELFNGEVERVTLPGTMGSFSILPQHAPIVSSLGAGTLVYVTGGEE 59


>gi|323702637|ref|ZP_08114299.1| ATP synthase F1, epsilon subunit [Desulfotomaculum nigrificans DSM
           574]
 gi|323532456|gb|EGB22333.1| ATP synthase F1, epsilon subunit [Desulfotomaculum nigrificans DSM
           574]
          Length = 132

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 8/101 (7%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
             ++V+PEK VFS E+  +V P   G++ +L  HAP++T +K G++ +     +  +  V
Sbjct: 6   RLDIVTPEKVVFSEEIDFIVAPGADGELGILPEHAPLVTALKIGVMRVQQDG-KFFKVAV 64

Query: 68  IGGICDIVPSHCTVLSETILPMD-------NACLQALEKRI 101
            GG  ++  S   VL++T    D        A  Q  E+R+
Sbjct: 65  SGGFMEVKNSRVVVLADTAERADEIDVERARAAKQRAEQRL 105


>gi|325576870|ref|ZP_08147485.1| ATP synthase F1 sector epsilon subunit [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325161076|gb|EGC73194.1| ATP synthase F1 sector epsilon subunit [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 142

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 64/124 (51%), Gaps = 5/124 (4%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VS E+ +F G V+ +      G++ +L  H P++T IK GIV ++L         V GG
Sbjct: 8   IVSAERKIFEGAVKQIQATGVEGELGILPNHTPLMTAIKPGIVKLTLEDGNEEVIYVSGG 67

Query: 71  ICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
             ++ P   TVL++  +    +D   ++  +++ +E    +N+  DVD    + +L  +L
Sbjct: 68  FLEVQPKVVTVLADVAIRGSELDADRIREAKRKAEENI--VNHAVDVDHDLLVAKLSKEL 125

Query: 128 SCLR 131
           + LR
Sbjct: 126 AKLR 129


>gi|326316546|ref|YP_004234218.1| ATP synthase F1 subunit epsilon [Acidovorax avenae subsp. avenae
          ATCC 19860]
 gi|323373382|gb|ADX45651.1| ATP synthase F1, epsilon subunit [Acidovorax avenae subsp. avenae
          ATCC 19860]
          Length = 151

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++   E  V+SG V+ V LP   G   VL GH P+LT +++G V I     E     
Sbjct: 17 LQLDIAHMEGLVWSGPVRVVGLPGAEGAFGVLHGHTPLLTRLRAGFVHIETPAGERIEVY 76

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  +I P+  TVL++T
Sbjct: 77 VSGGYVEIQPARVTVLADT 95


>gi|77920720|ref|YP_358535.1| F0F1 ATP synthase subunit epsilon [Pelobacter carbinolicus DSM
           2380]
 gi|119361404|sp|Q39ZU2|ATPE2_PELCD RecName: Full=ATP synthase epsilon chain 2; AltName: Full=ATP
           synthase F1 sector epsilon subunit 2; AltName:
           Full=F-ATPase epsilon subunit 2
 gi|77546803|gb|ABA90365.1| ATP synthase F1 subcomplex epsilon subunit [Pelobacter carbinolicus
           DSM 2380]
          Length = 138

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 1/129 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  E+V+P   V S EV  +  P  LG   VL GH P+LTT++ G  +      ++
Sbjct: 1   MAQKLKLEMVTPAAQVLSEEVDEIAAPGSLGQFGVLPGHTPLLTTLQVGEFSYR-KGSDV 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           +   V  G  ++      VL ET    D+  L   +  +    + L  +   D+ +   Q
Sbjct: 60  YYLAVNWGYVEVAEDRVLVLVETAETQDHIDLARAKAALGRAEARLRELTPADKEYHNMQ 119

Query: 123 LLVDLSCLR 131
             +  + +R
Sbjct: 120 AALQRAMVR 128


>gi|304313400|ref|YP_003812998.1| ATPase, delta/epsilon subunit [gamma proteobacterium HdN1]
 gi|301799133|emb|CBL47376.1| ATPase, delta/epsilon subunit [gamma proteobacterium HdN1]
          Length = 140

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          ++VS E+ +FSG V+ VV    LGD+ V  GH P+LT +  G V +     +   Y V G
Sbjct: 6  DIVSAEREIFSGLVEMVVAHGTLGDLGVYPGHTPLLTQLDPGPVRVIRQGGKEEVYFVSG 65

Query: 70 GICDIVPSHCTVLSE 84
          G  ++ PS  TVL++
Sbjct: 66 GFLEVQPSVVTVLAD 80


>gi|48474556|sp|Q8VV76|ATPE_COLMA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|18146852|dbj|BAB82485.1| F0F1-ATPase subunit epsilon [Colwellia maris]
          Length = 140

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 52/80 (65%), Gaps = 4/80 (5%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHR 64
          ++  +VS E+ +FSG ++S+ +    G++ ++ GHAP+LT++K G+  I+     EE+  
Sbjct: 6  VNLNVVSAEESLFSGSIKSLQITGSEGELGIMPGHAPLLTSLKPGMALITKKDGSEEV-- 63

Query: 65 YVVIGGICDIVPSHCTVLSE 84
            + GG+ ++ P++ TVL++
Sbjct: 64 IYLSGGMLEVQPNNVTVLAD 83


>gi|107025848|ref|YP_623359.1| ATP synthase F1, epsilon subunit [Burkholderia cenocepacia AU 1054]
 gi|119361401|sp|Q1BPR9|ATPE2_BURCA RecName: Full=ATP synthase epsilon chain 2; AltName: Full=ATP
           synthase F1 sector epsilon subunit 2; AltName:
           Full=F-ATPase epsilon subunit 2
 gi|105895222|gb|ABF78386.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia
           cenocepacia AU 1054]
          Length = 152

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEE 61
           +   +  ++VS E  +++G+   VV+P E G++ +   HAP+LT I+ G+VT +     E
Sbjct: 1   MKTSMKLDIVSVEAALYAGDAHFVVVPGESGELGIYPHHAPLLTRIRPGVVTLVDAPTGE 60

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
             R +V GG+ ++     T++++  L      L  L  R     +D     D  QR+  E
Sbjct: 61  HRRLLVAGGVLEVSRDGVTLIADHAL--RTPELDELRTREARHAAD-----DWRQRYAHE 113

Query: 122 -QLLVDLSCLR 131
            +   D +  R
Sbjct: 114 NRRAFDFASAR 124


>gi|183220216|ref|YP_001838212.1| F0F1 ATP synthase subunit epsilon [Leptospira biflexa serovar
          Patoc strain 'Patoc 1 (Paris)']
 gi|189910334|ref|YP_001961889.1| F0F1 ATP synthase subunit epsilon [Leptospira biflexa serovar
          Patoc strain 'Patoc 1 (Ames)']
 gi|167775010|gb|ABZ93311.1| epsilon subunit of the H(+)-transporting two- sector ATPase, F1
          sector [Leptospira biflexa serovar Patoc strain 'Patoc
          1 (Ames)']
 gi|167778638|gb|ABZ96936.1| ATP synthase F1, epsilon subunit [Leptospira biflexa serovar
          Patoc strain 'Patoc 1 (Paris)']
          Length = 126

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +  +L   ++SP+K ++ G+ +SV+LP  +G   +L GHA +++ +  G++ +  + +E 
Sbjct: 1  MSKELTLTVISPDKILYQGKAESVILPGAVGYFGILPGHATLVSQLDFGLIKLHTAGKEF 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
           R  + GG C++      VL+E
Sbjct: 61 -RIAIDGGFCEVKNDQIRVLTE 81


>gi|301155215|emb|CBW14680.1| F1 sector of membrane-bound ATP synthase, epsilon subunit
           [Haemophilus parainfluenzae T3T1]
          Length = 142

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 5/124 (4%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VS E+ +F G V+ +      G++ +L  H P++T IK GIV  +L         V GG
Sbjct: 8   IVSAERKIFEGAVKQIQATGVEGELGILPNHTPLMTAIKPGIVKFTLEDGNEEVIYVSGG 67

Query: 71  ICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
             ++ P   TVL++  +    +D   ++  +++ +E    +N+  DVD    + +L  +L
Sbjct: 68  FLEVQPKVVTVLADVAIRGSELDADRIREAKRKAEENI--VNHAVDVDHDLLVAKLSKEL 125

Query: 128 SCLR 131
           + LR
Sbjct: 126 AKLR 129


>gi|283955274|ref|ZP_06372774.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 414]
 gi|283793188|gb|EFC31957.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          jejuni 414]
          Length = 129

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 38/53 (71%), Gaps = 1/53 (1%)

Query: 4  VNDL-HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          +NDL +FE+V+P   ++ GEV+SV  P   G+  VL GHA +++++KSG++ I
Sbjct: 1  MNDLINFEIVTPLGLIYQGEVKSVTFPGSEGEFGVLKGHAALVSSLKSGVIDI 53


>gi|325291353|ref|YP_004267534.1| ATP synthase F1 subcomplex epsilon subunit [Syntrophobotulus
          glycolicus DSM 8271]
 gi|324966754|gb|ADY57533.1| ATP synthase F1 subcomplex epsilon subunit [Syntrophobotulus
          glycolicus DSM 8271]
          Length = 136

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +       +VSP   +F+ EV+ +V+P E G++ +L  H+P++ T+  G++ I+ +  ++
Sbjct: 1  MAGSFTLNVVSPNGAIFNDEVEFLVVPGEDGELGILPNHSPLMATLNIGVIRITQNG-KV 59

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
          +R  + GG  ++  +  T+L+E+
Sbjct: 60 NRMALSGGFMEVGGNKVTLLAES 82


>gi|311743984|ref|ZP_07717790.1| ATP synthase F1 sector epsilon subunit [Aeromicrobium marinum DSM
           15272]
 gi|311313114|gb|EFQ83025.1| ATP synthase F1 sector epsilon subunit [Aeromicrobium marinum DSM
           15272]
          Length = 130

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 4/116 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ELV+ ++ V+SG+   V   +  GD+ VL GH P+L+ +  G+V I  +  E  R  
Sbjct: 10  LQVELVAADRVVWSGQAGEVSARTVEGDLGVLRGHTPLLSLLVPGVVVIRSTDGETVRAA 69

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQ 119
           V  G   +   H ++LSE +     +D A +Q  E        D + +   + +F+
Sbjct: 70  VAEGFLSVANDHVSILSEDVYLESELDTATIQ-HEIETARAAEDHDAVLRAEAKFR 124


>gi|239982328|ref|ZP_04704852.1| F0F1 ATP synthase subunit epsilon [Streptomyces albus J1074]
 gi|291454173|ref|ZP_06593563.1| ATP synthase subunit epsilon [Streptomyces albus J1074]
 gi|291357122|gb|EFE84024.1| ATP synthase subunit epsilon [Streptomyces albus J1074]
          Length = 124

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +  +LH ELV+ ++ V+SGE   VV     GD+ ++ GH P+L  ++SG VTI  +  + 
Sbjct: 1  MAAELHVELVAADRSVWSGEATLVVARLTTGDVGIMPGHQPLLGVLESGPVTIRTADGKT 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
              V GG         +VL+E
Sbjct: 61 VAAAVHGGFLSFADDKLSVLAE 82


>gi|71278528|ref|YP_266831.1| ATP synthase F1, epsilon subunit [Colwellia psychrerythraea 34H]
 gi|119361423|sp|Q48AV9|ATPE_COLP3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|71144268|gb|AAZ24741.1| ATP synthase F1, epsilon subunit [Colwellia psychrerythraea 34H]
          Length = 140

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 53/80 (66%), Gaps = 4/80 (5%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSG--IVTISLSCEEIHR 64
          ++  +VS E+ +FSG ++S+ +    G++ ++ GHAP+LT++K G  ++T +   EE+  
Sbjct: 6  VNLNVVSAEESLFSGSIKSLQITGSEGELGIMPGHAPLLTSLKPGMALITKADGTEEV-- 63

Query: 65 YVVIGGICDIVPSHCTVLSE 84
            + GG+ ++ P++ TVL++
Sbjct: 64 IYLSGGMLEVQPNNVTVLAD 83


>gi|71066577|ref|YP_265304.1| F0F1 ATP synthase subunit epsilon [Psychrobacter arcticus 273-4]
 gi|119367763|sp|Q4FQ38|ATPE_PSYA2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|71039562|gb|AAZ19870.1| ATP synthase F1, epsilon subunit [Psychrobacter arcticus 273-4]
          Length = 138

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 16/122 (13%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +VS  + ++SGE+  ++     G+I +L GH P++T +K G + +  S  E     
Sbjct: 4   LQCRIVSAREELYSGEISMLIASGTEGEIGILPGHTPLITLLKPGAMRVQTSNGEEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG+ ++ P   TVL++T +   N                L+    V+ R + EQ+LV+
Sbjct: 64  VSGGVLEVQPKMVTVLADTAMRAHN----------------LDESKIVEARKKAEQMLVN 107

Query: 127 LS 128
            S
Sbjct: 108 QS 109


>gi|223931069|ref|YP_002586930.1| ATP synthase CF1 epsilon subunit [Syntrichia ruralis]
 gi|219562283|gb|ACL27614.1| ATP synthase CF1 epsilon subunit [Syntrichia ruralis]
          Length = 133

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 6  DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
          +L+  +++P + V++ +VQ ++L +  G I +L  HAP+LT +  GI+ I L+ E+    
Sbjct: 2  NLNLRVMAPNRIVWNSDVQEIILSTNSGRIGILPNHAPLLTALDIGIIKIRLN-EKWSTM 60

Query: 66 VVIGGICDIVPSHCTVL 82
           ++GG   I  +  T+L
Sbjct: 61 ALMGGFAMIDNNQMTIL 77


>gi|310778012|ref|YP_003966345.1| ATP synthase F1 subcomplex epsilon subunit [Ilyobacter polytropus
          DSM 2926]
 gi|309747335|gb|ADO81997.1| ATP synthase F1 subcomplex epsilon subunit [Ilyobacter polytropus
          DSM 2926]
          Length = 134

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             E+++P K +   EV+ ++L +  GD+ VL  HAP +  +  G + I  S EE+  Y 
Sbjct: 4  FKLEVITPIKKILEKEVEMIILRTTEGDMGVLANHAPFVAELAIGEMKIKSSDEEVA-YF 62

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG  DI     T+L++  L
Sbjct: 63 VSGGFIDISRERTTILADEAL 83


>gi|282859104|ref|ZP_06268235.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella bivia JCVIHMP010]
 gi|282588134|gb|EFB93308.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella bivia JCVIHMP010]
          Length = 79

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 45/68 (66%), Gaps = 1/68 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  +++SP K +F+G V  V++P E GD  +LV HAP+++T+ +G V  +++  ++ +  
Sbjct: 2  LTLKIISPAKIIFNGTVDRVLVPGEKGDFEILVNHAPIISTLVAGKVVYTINASQL-QLD 60

Query: 67 VIGGICDI 74
          ++GG  ++
Sbjct: 61 ILGGFVEV 68


>gi|312131446|ref|YP_003998786.1| ATP synthase f1 subcomplex epsilon subunit [Leadbetterella
          byssophila DSM 17132]
 gi|311907992|gb|ADQ18433.1| ATP synthase F1 subcomplex epsilon subunit [Leadbetterella
          byssophila DSM 17132]
          Length = 80

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+ +PEK VFSGEV  V LP + G   +L  HAP+++T+ +G +   +S ++     
Sbjct: 1  MRLEITTPEKNVFSGEVDLVTLPGKEGQFQILKDHAPMVSTLATGELVYEISGKK-ESIT 59

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG+  +  +   VL+E ++
Sbjct: 60 VEGGVVQVQNNKVLVLAEGVI 80


>gi|226326988|ref|ZP_03802506.1| hypothetical protein PROPEN_00848 [Proteus penneri ATCC 35198]
 gi|225204825|gb|EEG87179.1| hypothetical protein PROPEN_00848 [Proteus penneri ATCC 35198]
          Length = 138

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 1/126 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK ++ GEV+ + +    G++ +   H P+LT IK G+V +  +  E     
Sbjct: 6   FHLKVVSAEKQLYDGEVKRIQVTGSEGELGIYPQHTPLLTAIKPGMVRVVKTSGEEEVIY 65

Query: 67  VIGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLV 125
           + GGI ++ P+   VL++T I   D    +ALE +        ++  DVD      +L  
Sbjct: 66  LSGGILEVQPTGVIVLADTAIRGRDLDEAKALESKRKAEEHIQSSHGDVDYAQASAELAK 125

Query: 126 DLSCLR 131
            ++ LR
Sbjct: 126 AIAKLR 131


>gi|256827612|ref|YP_003151571.1| ATP synthase, F1 epsilon subunit [Cryptobacterium curtum DSM 15641]
 gi|256583755|gb|ACU94889.1| ATP synthase, F1 epsilon subunit [Cryptobacterium curtum DSM 15641]
          Length = 133

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI-SLSCEEIHRYVVI 68
           ++V+P K +F+ E   VV+P + G++  L GHA +++T+  G+V + S +    H Y + 
Sbjct: 7   DIVTPAKKLFTEECYMVVVPGKEGEMGFLPGHAQLMSTLADGVVRVLSDASTVAHTYALQ 66

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLS 128
           GG   +      +L++    +++  L  ++ RI ++ S +    D   R  +E   VDL 
Sbjct: 67  GGYVQVTGEKVIILADRAQSVEDINLDEVQTRIADLTSRIEAESDEAHRDLLE---VDLG 123

Query: 129 CLR 131
             R
Sbjct: 124 WYR 126


>gi|119487856|ref|ZP_01621353.1| ATP synthase subunit epsilon [Lyngbya sp. PCC 8106]
 gi|119455432|gb|EAW36570.1| ATP synthase subunit epsilon [Lyngbya sp. PCC 8106]
          Length = 137

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P++ V+  + + V+LPS  G + VL GHAP++T +  G++ +    E I    
Sbjct: 3  LNVRVIAPDRTVWDDQAEEVILPSTTGQLGVLSGHAPMMTALDVGVMRVRSKSEWIP-IA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG  ++  +  T+L
Sbjct: 62 LLGGFAEVEENEVTIL 77


>gi|258406331|ref|YP_003199073.1| F0F1 ATP synthase subunit epsilon [Desulfohalobium retbaense DSM
          5692]
 gi|257798558|gb|ACV69495.1| ATP synthase F1, epsilon subunit [Desulfohalobium retbaense DSM
          5692]
          Length = 138

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + N + FELV+P++ V S +V+ V  P   G+  VL  H P L+ +  G+ ++       
Sbjct: 1  MANTIKFELVTPDRSVVSEDVEYVGAPGVNGEFGVLPNHIPFLSAL--GVGSLYFKTGGR 58

Query: 63 HRYV-VIGGICDIVPSHCTVLSE 84
            YV V GG  +I P   TVL+E
Sbjct: 59 RSYVFVAGGFAEISPDKVTVLAE 81


>gi|197286890|ref|YP_002152762.1| ATP synthase subunit epsilon [Proteus mirabilis HI4320]
 gi|227354877|ref|ZP_03839292.1| H (+)-transporting two-sector ATPase, subunit epsilon [Proteus
           mirabilis ATCC 29906]
 gi|226740274|sp|B4F0E8|ATPE_PROMH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|194684377|emb|CAR46026.1| ATP synthase epsilon chain [Proteus mirabilis HI4320]
 gi|227165030|gb|EEI49866.1| H (+)-transporting two-sector ATPase, subunit epsilon [Proteus
           mirabilis ATCC 29906]
          Length = 138

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 1/126 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H ++VS EK ++ GEV+ + +    G++ +   H P+LT IK G+V +  +  E     
Sbjct: 6   FHLKVVSAEKHLYDGEVKHIQVTGSEGELGIYPQHTPLLTAIKPGMVRVVKTSGEEEFIY 65

Query: 67  VIGGICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLV 125
           + GGI ++ P+   VL++T I   D    +ALE +        ++  DVD      +L  
Sbjct: 66  LSGGILEVQPTGVIVLADTAIRGRDLDEAKALESKRKAEEHIQSSHGDVDYAQASAELAK 125

Query: 126 DLSCLR 131
            ++ LR
Sbjct: 126 AIAKLR 131


>gi|89897657|ref|YP_521144.1| ATP synthase F1 epsilon subunit [Desulfitobacterium hafniense Y51]
 gi|119361429|sp|Q24MP2|ATPE_DESHY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|89337105|dbj|BAE86700.1| ATP synthase F1 epsilon subunit [Desulfitobacterium hafniense Y51]
          Length = 132

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 55/106 (51%), Gaps = 8/106 (7%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +       +VSPE  V   E + VVLP   G+I +L  HAP++++I+ G++  +++  ++
Sbjct: 1   MAGTFTLRVVSPEGNVLKEEAEFVVLPGGNGEIGILPNHAPLISSIEIGVIRYTVNG-KV 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDN-------ACLQALEKRI 101
            +    GG  ++  +  T+L++T  P +        A  +  EKR+
Sbjct: 60  EKIATSGGFVEVSDNKVTILADTAEPGEKVDLDRALAAKERAEKRL 105


>gi|304382806|ref|ZP_07365289.1| ATP synthase F1 sector epsilon subunit [Prevotella marshii DSM
          16973]
 gi|304335991|gb|EFM02238.1| ATP synthase F1 sector epsilon subunit [Prevotella marshii DSM
          16973]
          Length = 80

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +VSPE+ VF GEV+SV++P  LG   +L  HAP++++++ G V  +    ++H + 
Sbjct: 3  LKLRIVSPERIVFDGEVESVLVPGTLGCFEILKDHAPIISSLEEGKVEYTAKDSKVH-FN 61

Query: 67 VIGGICDIVPSHCTVLSE 84
          + GG  ++  +  +++ E
Sbjct: 62 IKGGFVEVKRNEVSLVVE 79


>gi|170737769|ref|YP_001779029.1| ATP synthase F1, epsilon subunit [Burkholderia cenocepacia MC0-3]
 gi|169819957|gb|ACA94539.1| ATP synthase F1, epsilon subunit [Burkholderia cenocepacia MC0-3]
          Length = 152

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEE 61
           +   +  ++VS E  +++G+   VV+P E G++ +   HAP+LT I+ G+VT +     E
Sbjct: 1   MKTSMKLDIVSVEAVLYAGDAHFVVVPGESGELGIYPHHAPLLTRIRPGVVTLVDAPTGE 60

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
             R +V GG+ ++     T++++  L      L  L  R     +D     D  QR+  E
Sbjct: 61  HRRLLVAGGVLEVSRDGVTLIADHAL--RTPELDELRAREARHAAD-----DWRQRYAHE 113

Query: 122 -QLLVDLSCLR 131
            +   D +  R
Sbjct: 114 NRRAFDFASAR 124


>gi|219670786|ref|YP_002461221.1| F0F1 ATP synthase subunit epsilon [Desulfitobacterium hafniense
           DCB-2]
 gi|254809361|sp|B8FZ33|ATPE_DESHD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|219541046|gb|ACL22785.1| ATP synthase F1, epsilon subunit [Desulfitobacterium hafniense
           DCB-2]
          Length = 132

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 56/108 (51%), Gaps = 8/108 (7%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +       +VSPE  V   E + VVLP   G+I +L  HAP++++I+ G++  +++  ++
Sbjct: 1   MAGTFTLRVVSPEGNVLKEEAEFVVLPGGNGEIGILPNHAPLISSIEIGVIRYTVNG-KV 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDE 103
            +    GG  ++  +  T+L++T  P +        A  +  EKR+ +
Sbjct: 60  EKIATSGGFVEVSDNKVTILADTAEPGERVDLDRALAAKERAEKRLTQ 107


>gi|225378698|ref|ZP_03755919.1| hypothetical protein ROSEINA2194_04368 [Roseburia inulinivorans DSM
           16841]
 gi|225209535|gb|EEG91889.1| hypothetical protein ROSEINA2194_04368 [Roseburia inulinivorans DSM
           16841]
          Length = 136

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 4/126 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           E+++P++  + GE   +   + +G+I V   H P+ T +  G+V I  + E+     V  
Sbjct: 11  EIITPDRIFYKGEGDMIEFTTAVGEIGVYKKHIPLTTVLAPGVVKIHKTGEDDVIAAVHS 70

Query: 70  GICDIVPSHCTVLSETI-LP--MDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQLLV 125
           G  +I+P   T+L+E    P  +D    +A  KR +E  ++     DV +  F + + LV
Sbjct: 71  GFAEILPDKVTLLAEIAEWPDEIDKGRAEAAMKRAEERLANKTEAIDVKRAEFALRKALV 130

Query: 126 DLSCLR 131
            L   +
Sbjct: 131 RLDIAK 136


>gi|253702619|ref|YP_003023808.1| F0F1 ATP synthase subunit epsilon [Geobacter sp. M21]
 gi|259585484|sp|C6E9F0|ATPE_GEOSM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|251777469|gb|ACT20050.1| ATP synthase F1, epsilon subunit [Geobacter sp. M21]
          Length = 138

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 3/130 (2%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  ELV+P K V S EV  +     LG+  VL GHAP LT++K G   ++   + +
Sbjct: 1   MAEKLKVELVTPYKKVLSEEVDEITATGALGEFGVLPGHAPFLTSLKIG--ELAYRKDGV 58

Query: 63  -HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            H   +  G  ++     TVL ET    D   L+  +  +     +L  +   D+ F++ 
Sbjct: 59  SHHMALNWGYFEVENDTVTVLVETAEKADEIDLERAKAALGRAEVELKALTPEDKNFRIY 118

Query: 122 QLLVDLSCLR 131
           +  ++ + +R
Sbjct: 119 EAALERALIR 128


>gi|238899336|ref|YP_002925019.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
          [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
          pisum)]
 gi|229467097|gb|ACQ68871.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
          [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
          pisum)]
          Length = 139

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 2/76 (2%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV-TISLSCEEIHRYVVIG 69
          +VS EK +FSG VQ + +    G++ +  GHAP+LT +K G+V  I+   EE   Y+  G
Sbjct: 9  VVSVEKNMFSGVVQKIRVTGSEGELGIFSGHAPLLTALKPGMVCMINEQGEEEFIYLS-G 67

Query: 70 GICDIVPSHCTVLSET 85
          GI ++ P   T+L++T
Sbjct: 68 GILEVQPKLVTILADT 83


>gi|134294037|ref|YP_001117773.1| ATP synthase F1, epsilon subunit [Burkholderia vietnamiensis G4]
 gi|134137194|gb|ABO58308.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia
           vietnamiensis G4]
          Length = 151

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 53/96 (55%), Gaps = 2/96 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEEIHRY 65
           +  +++S E  ++SG+   VV+P E G++ +   HAP+LT I+ G+VT +     E  R 
Sbjct: 5   MKLDILSVENVLYSGDAHFVVVPGESGELGIYPRHAPLLTRIRPGVVTLVDAPSGERRRI 64

Query: 66  VVIGGICDIVPSHCTVLSETILPMDN-ACLQALEKR 100
           +V GG+ ++     T++++  L       L+A E R
Sbjct: 65  LVAGGVLEVSREGVTLIADHALRTPELDALRAREAR 100


>gi|239944302|ref|ZP_04696239.1| F0F1 ATP synthase subunit epsilon [Streptomyces roseosporus NRRL
          15998]
 gi|239990756|ref|ZP_04711420.1| F0F1 ATP synthase subunit epsilon [Streptomyces roseosporus NRRL
          11379]
 gi|291447769|ref|ZP_06587159.1| H+-transporting two-sector ATPase epsilon chain [Streptomyces
          roseosporus NRRL 15998]
 gi|291350716|gb|EFE77620.1| H+-transporting two-sector ATPase epsilon chain [Streptomyces
          roseosporus NRRL 15998]
          Length = 124

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 44/82 (53%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1  MAAELHVELVAADRSVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGGT 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
              V GG         ++L+E
Sbjct: 61 VVAAVHGGFISFADDKLSLLAE 82


>gi|85858478|ref|YP_460680.1| ATP synthase epsilon chain [Syntrophus aciditrophicus SB]
 gi|119367798|sp|Q2LR04|ATPE_SYNAS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|85721569|gb|ABC76512.1| ATP synthase epsilon chain [Syntrophus aciditrophicus SB]
          Length = 135

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +  +L  E+V+PEK  FS  V+ V +P   G+  V  GH  +L+++  G ++ ++  ++ 
Sbjct: 1  MAEELILEIVTPEKMAFSSVVEEVTIPGSEGEFGVYKGHESLLSSVDIGELSFTVKNKK- 59

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
          H Y V  G  ++     TVL ET
Sbjct: 60 HYYAVNTGFAEVTSEKVTVLVET 82


>gi|332519271|ref|ZP_08395738.1| ATPase, F1 complex, delta/epsilon subunit-like protein
          [Lacinutrix algicola 5H-3-7-4]
 gi|332045119|gb|EGI81312.1| ATPase, F1 complex, delta/epsilon subunit-like protein
          [Lacinutrix algicola 5H-3-7-4]
          Length = 92

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTIS 56
          ++ E+VSPE  +FSGEV SV +P   GD  +L  HAPV++ +K G + I+
Sbjct: 1  MYLEIVSPEAILFSGEVTSVTVPGINGDFEMLNNHAPVVSILKEGTIKIT 50


>gi|328885073|emb|CCA58312.1| ATP synthase epsilon chain [Streptomyces venezuelae ATCC 10712]
          Length = 124

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (53%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +  +LH ELV+ ++ V+SGE   V+  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1  MAAELHVELVAADRSVWSGEATLVIARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGAT 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
              V GG         ++L+E
Sbjct: 61 VVAAVHGGFISFADDKLSLLAE 82


>gi|218666362|ref|YP_002425246.1| ATP synthase F1, epsilon subunit, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|218518575|gb|ACK79161.1| ATP synthase F1, epsilon subunit, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 171

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 52/91 (57%)

Query: 18  VFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPS 77
           V++G  + V +P+ELG+I +L GHAP+L+ ++ G + I+    +     + GG+ +I P 
Sbjct: 18  VYTGMARFVAVPAELGEIGILPGHAPLLSGLRPGELRITQPDGQTQILFLEGGMLEIQPD 77

Query: 78  HCTVLSETILPMDNACLQALEKRIDEVCSDL 108
             T+L++  L + +  +    +RI +  S L
Sbjct: 78  IVTILADASLRIADIDIHESRERIKDAQSTL 108


>gi|238753981|ref|ZP_04615340.1| ATP synthase epsilon chain [Yersinia ruckeri ATCC 29473]
 gi|238707733|gb|EEQ00092.1| ATP synthase epsilon chain [Yersinia ruckeri ATCC 29473]
          Length = 124

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 18  VFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPS 77
           +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     + GGI ++ PS
Sbjct: 1   MFSGVVQKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGEEEFIYLSGGILEVQPS 60

Query: 78  HCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLR 131
              VL++T I   D    +ALE +        N+  DVD      +L   ++ LR
Sbjct: 61  VVIVLADTAIRGTDLDEAKALESKRKAEAHINNSHGDVDYAQASAELAKAIAKLR 115


>gi|116692968|ref|YP_838501.1| ATP synthase F1, epsilon subunit [Burkholderia cenocepacia HI2424]
 gi|116650968|gb|ABK11608.1| ATP synthase F1 subcomplex epsilon subunit [Burkholderia
           cenocepacia HI2424]
          Length = 152

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEE 61
           +   +  ++VS E  +++G+   VV+P E G++ +   HAP+LT I+ G+VT +     E
Sbjct: 1   MKTSMKLDIVSVEAVLYAGDAHFVVVPGESGELGIYPHHAPLLTRIRPGVVTLVDAPTGE 60

Query: 62  IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
             R +V GG+ ++     T++++  L      L  L  R     +D     D  QR+  E
Sbjct: 61  HRRLLVAGGVLEVSRDGVTLIADHAL--RTPELDELRTREARHAAD-----DWRQRYAHE 113

Query: 122 -QLLVDLSCLR 131
            +   D +  R
Sbjct: 114 NRRAFDFASAR 124


>gi|157377615|ref|YP_001476215.1| F0F1 ATP synthase subunit epsilon [Shewanella sediminis HAW-EB3]
 gi|189081380|sp|A8G1W4|ATPE_SHESH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|157319989|gb|ABV39087.1| ATP synthase F1, epsilon subunit [Shewanella sediminis HAW-EB3]
          Length = 142

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 7/106 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
           +  ++VS E  ++SG V  + +    GD+ V+ GHAP+LT IK G+  I      EE+  
Sbjct: 6   VQLDIVSAESRIYSGLVAHLQVTGSEGDLGVMPGHAPLLTHIKPGMARIVKQDGSEEV-- 63

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQA---LEKRIDEVCSD 107
           + + GGI ++ P   +VL++ +L  D    QA    ++R +   +D
Sbjct: 64  FYLSGGILEVQPFSVSVLADVVLRADEIDEQAAVEAKRRAETALAD 109


>gi|124516444|gb|EAY57952.1| ATP synthase F1, epsilon subunit [Leptospirillum rubarum]
          Length = 143

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 5/128 (3%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           L++ E+ + S EV  +      G+  VL GH P LT +  G + +  + E ++ Y V GG
Sbjct: 7   LMTQERHLLSEEVDYIQAKGVEGEFGVLTGHTPFLTLLDIGELLVR-NKESLYSYFVAGG 65

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL----VD 126
           + +++P   T+L++TI   +    +  E+        L      + R   EQ+L    V 
Sbjct: 66  VVEVLPDRVTILADTIERAEEIDGKRAEEARQNAIEALKQPISPESRLGFEQVLKREGVR 125

Query: 127 LSCLRRRI 134
           L  L RR+
Sbjct: 126 LKILSRRL 133


>gi|91204912|ref|YP_537267.1| F0F1 ATP synthase subunit epsilon [Rickettsia bellii RML369-C]
 gi|157827762|ref|YP_001496826.1| F0F1 ATP synthase subunit epsilon [Rickettsia bellii OSU 85-389]
 gi|119367775|sp|Q1RKD6|ATPE_RICBR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222489|sp|A8GY39|ATPE_RICB8 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|91068456|gb|ABE04178.1| ATP synthase epsilon chain [Rickettsia bellii RML369-C]
 gi|157803066|gb|ABV79789.1| ATP synthase epsilon chain [Rickettsia bellii OSU 85-389]
          Length = 108

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 59/99 (59%), Gaps = 6/99 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR-- 64
           ++ ++++P   VF  + + + LP E G+  VL GHAP++ ++K+G++ + +  +++H+  
Sbjct: 5   INVKIITPLNIVFEEQAKMITLPGEEGEFGVLQGHAPMIVSLKAGLLKVYI--DDMHKPK 62

Query: 65  --YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRI 101
             Y++  G+ ++  S+  + +ET + + +     +E ++
Sbjct: 63  ITYLIANGVTEVTGSYINIATETAINITDLSEAEIENKL 101


>gi|224370582|ref|YP_002604746.1| AtpC2 [Desulfobacterium autotrophicum HRM2]
 gi|259585481|sp|C0Q977|ATPE_DESAH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|223693299|gb|ACN16582.1| AtpC2 [Desulfobacterium autotrophicum HRM2]
          Length = 135

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  ++  E+V+P   V S E Q V+ P   G+  VL GH   LT++K G +    +  + 
Sbjct: 1   MAENIFLEVVTPGASVVSEEAQIVMAPGSEGEFGVLRGHTTFLTSLKIGSLRYKDAAGKE 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMD-------NACLQALEKRIDE 103
               V GG  +++P+  TVL+E+             A     EKRI E
Sbjct: 61  RVLFVNGGFAEVLPTKVTVLAESAERRSQIEVERVRAAKARAEKRISE 108


>gi|156619213|gb|ABU88285.1| ATP synthase CF1 epsilon subunit [Chlamydomonas moewusii]
          Length = 135

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 51/88 (57%), Gaps = 7/88 (7%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++P++  ++G+ + ++LP+E G++ VL  HAP++T +  G + +  + E    Y 
Sbjct: 3  LEITILTPQRPFWNGQAEEIILPTETGEMGVLKNHAPIITGLDVGAMLVR-TKENWTSYA 61

Query: 67 VIGGICDIVPSHCTVL------SETILP 88
          ++GG   +  ++ T+L      SE+I P
Sbjct: 62 IMGGFALVKQNNVTILANEAQASESIDP 89


>gi|193237706|dbj|BAG50116.1| ATP synthase epsilon subunit [Takakia lepidozioides]
 gi|193237727|dbj|BAG50132.1| ATP synthase epsilon subunit [Takakia lepidozioides]
          Length = 138

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ EVQ ++L +  G I VL  HAP+LT +  GI+ I L+ +      
Sbjct: 3  LNLRVMAPNRIVWNSEVQEIILSTNSGQIGVLPNHAPLLTALDIGIIKIRLNGQWFT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  T+L
Sbjct: 62 LMGGFAMIDNNRMTIL 77


>gi|91795096|ref|YP_564747.1| F0F1 ATP synthase subunit epsilon [Shewanella denitrificans
          OS217]
 gi|119367780|sp|Q12HQ2|ATPE_SHEDO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|91717098|gb|ABE57024.1| ATP synthase F1, epsilon subunit [Shewanella denitrificans OS217]
          Length = 142

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 52/87 (59%), Gaps = 4/87 (4%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGI--VTISLSCEEIHR 64
          +  ++VS E  ++SG V  + +    G++ ++ GHAP+++ IK G+  VT     EE+  
Sbjct: 6  VQLDIVSAEGGIYSGRVSHLQVTGSEGELGIMHGHAPLISKIKPGMARVTKQDGSEEV-- 63

Query: 65 YVVIGGICDIVPSHCTVLSETILPMDN 91
          + + GGI ++ P+  ++L++ +L  D+
Sbjct: 64 FYLSGGILEVQPASTSILADVVLRADD 90


>gi|86135197|ref|ZP_01053779.1| ATP synthase, delta/epsilon subunit [Polaribacter sp. MED152]
 gi|85822060|gb|EAQ43207.1| ATP synthase, delta/epsilon subunit [Polaribacter sp. MED152]
          Length = 97

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 36/55 (65%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
          ++ E+VSPE  +FS EV ++ +P E G+  +L  HAP++  +K G+V I +  ++
Sbjct: 1  MYLEIVSPEAILFSSEVDAITVPGEHGEFQMLNNHAPIVANLKEGMVKIHVHSQQ 55


>gi|291327303|ref|ZP_06127734.2| ATP synthase F1, epsilon subunit [Providencia rettgeri DSM 1131]
 gi|291310936|gb|EFE51389.1| ATP synthase F1, epsilon subunit [Providencia rettgeri DSM 1131]
          Length = 141

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H  +VS EK +F G VQ + +    G++ +   H P+LT IK G+V I+    E     +
Sbjct: 8   HLTVVSAEKQMFEGMVQKIQVTGSEGELGIYPQHTPLLTAIKPGMVRITKQFGEEELIYL 67

Query: 68  IGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ 116
            GGI ++ P+   VL++T +    +D A     +++ +E     +   D  Q
Sbjct: 68  SGGILEVQPNGVIVLADTAIRGKDLDEARAVESKRKAEEHVRKAHGDVDYAQ 119


>gi|206603285|gb|EDZ39765.1| ATP synthase F1, epsilon subunit [Leptospirillum sp. Group II
           '5-way CG']
          Length = 143

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           L++ E+ + S EV  +      G+  VL GH P LT +  G + +  + E ++ Y V GG
Sbjct: 7   LMTQERHLLSEEVDYIQAKGVEGEFGVLTGHTPFLTLLDIGELLVR-NKESLYSYFVAGG 65

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL----VD 126
           + +++P   TVL++TI   +    +  E+        L      + R   EQ+L    V 
Sbjct: 66  VVEVLPDRVTVLADTIERAEEIDGKRAEEARQNAIEALKQPISPESRLGFEQVLKREGVR 125

Query: 127 LSCLRRR 133
           L  L RR
Sbjct: 126 LKILSRR 132


>gi|182435955|ref|YP_001823674.1| F0F1 ATP synthase subunit epsilon [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|326776579|ref|ZP_08235844.1| ATP synthase epsilon chain [Streptomyces cf. griseus XylebKG-1]
 gi|226740290|sp|B1W0A2|ATPE_STRGG RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|178464471|dbj|BAG18991.1| putative ATP synthase epsilon chain [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|326656912|gb|EGE41758.1| ATP synthase epsilon chain [Streptomyces cf. griseus XylebKG-1]
          Length = 124

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 44/82 (53%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1  MAAELHVELVAADRSVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGGT 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
              V GG         ++L+E
Sbjct: 61 VIAAVHGGFISFADDKLSLLAE 82


>gi|127514769|ref|YP_001095966.1| F0F1 ATP synthase subunit epsilon [Shewanella loihica PV-4]
 gi|189081378|sp|A3QJQ9|ATPE_SHELP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|126640064|gb|ABO25707.1| ATP synthase F1, epsilon subunit [Shewanella loihica PV-4]
          Length = 142

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 7/110 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS E  +FSG V  + +    GD+ V+ GHAP+LT IK G+  I     +   + 
Sbjct: 6   VQLDIVSAESSIFSGLVAHLQVSGAEGDLGVMPGHAPLLTHIKPGMARIVKQDGKEEVFY 65

Query: 67  VIGGICDIVPSHCTVLSETILPM----DNACLQA---LEKRIDEVCSDLN 109
           + GGI ++ P   +VL++ +L      + A ++A    E  +    +D N
Sbjct: 66  LSGGILEVQPFSVSVLADVVLRAEEIDEQAAVEAKRRAEAHMANAGADFN 115


>gi|255020242|ref|ZP_05292311.1| ATP synthase epsilon chain [Acidithiobacillus caldus ATCC 51756]
 gi|254970384|gb|EET27877.1| ATP synthase epsilon chain [Acidithiobacillus caldus ATCC 51756]
          Length = 141

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          ++VS E  ++ G    VV P E+G++ +L  HAP+LT ++ G + I    +E     V G
Sbjct: 8  QVVSAEGSIYEGAADMVVAPGEMGELGILPMHAPLLTGLRPGELRIK-HGDETEYLFVNG 66

Query: 70 GICDIVPSHCTVLSET 85
          GI +I P   TVL+++
Sbjct: 67 GILEIQPHLVTVLADS 82


>gi|145218846|ref|YP_001129555.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Prosthecochloris vibrioformis DSM 265]
 gi|145205010|gb|ABP36053.1| ATP synthase F1 subcomplex epsilon subunit [Chlorobium
          phaeovibrioides DSM 265]
          Length = 88

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 5  NDLHFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +D  FEL  V+P+K  FSG+V SV  P   G   V+  HAP+L  +K G V ++L  +  
Sbjct: 4  SDKGFELDIVTPQKLHFSGQVTSVTAPGLDGLFQVMKNHAPLLAALKKGPVRLALGDKTE 63

Query: 63 HRYVVIGGICDIVPSHCTVLSETI 86
            + +  G  ++  +   +L+ETI
Sbjct: 64 KSFSIKDGFFEVSGNKAILLTETI 87


>gi|167626198|ref|YP_001676492.1| F0F1 ATP synthase subunit epsilon [Shewanella halifaxensis
          HAW-EB4]
 gi|189081377|sp|B0TQF3|ATPE_SHEHH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|167356220|gb|ABZ78833.1| ATP synthase F1, epsilon subunit [Shewanella halifaxensis
          HAW-EB4]
          Length = 142

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 52/92 (56%), Gaps = 4/92 (4%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
          +  ++VS E  +FSG V  + +    G++ ++ GHA +LT+IK G+  I      EE+  
Sbjct: 6  VQLDMVSAESNIFSGRVAQLQVSGTEGELGIMPGHAALLTSIKPGMARIVKQDGSEEV-- 63

Query: 65 YVVIGGICDIVPSHCTVLSETILPMDNACLQA 96
          + + GGI ++ PS  +VL++ +L  +    QA
Sbjct: 64 FYLSGGILEVQPSSISVLADVVLRAEEIDEQA 95


>gi|289805058|ref|ZP_06535687.1| F0F1 ATP synthase subunit epsilon [Salmonella enterica subsp.
          enterica serovar Typhi str. AG3]
          Length = 83

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 8  HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
          H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I           +
Sbjct: 6  HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYL 65

Query: 68 IGGICDIVPSHCTVLSET 85
           GGI ++ P   TVL++T
Sbjct: 66 SGGILEVQPGSVTVLADT 83


>gi|297202404|ref|ZP_06919801.1| ATP synthase F1, epsilon subunit [Streptomyces sviceus ATCC 29083]
 gi|197710075|gb|EDY54109.1| ATP synthase F1, epsilon subunit [Streptomyces sviceus ATCC 29083]
          Length = 124

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH  LV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVALVAADREVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
               V GG      +  ++L+E     D   +Q  E+ ++   ++ +   +
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEIAELSDEIDVQRAERELERAKAEGDAAAE 111


>gi|94971357|ref|YP_593405.1| hypothetical protein Acid345_4331 [Candidatus Koribacter versatilis
           Ellin345]
 gi|119361407|sp|Q1IIG9|ATPE_ACIBL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|94553407|gb|ABF43331.1| ATP synthase F1 subcomplex epsilon subunit [Candidatus Koribacter
           versatilis Ellin345]
          Length = 142

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 58/105 (55%), Gaps = 6/105 (5%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + +   FE+V+P+K V     + + +P + G + +L GHAP++T +  G ++ +L  E  
Sbjct: 1   MADTFEFEIVTPDKLVVKDVAEQMQIPGKNGYLGILPGHAPLITELSIGEISYTLRGET- 59

Query: 63  HRYVVIG-GICDIVPSHCTVLSETI-LP--MDNACLQALEKRIDE 103
            +Y+ +  G  +++P   T+L+E    P  +D A  Q  +KR ++
Sbjct: 60  -KYLALAWGFAEVLPDKVTILAEAAERPEEIDVARAQEAKKRAEQ 103


>gi|198284154|ref|YP_002220475.1| ATP synthase F1 subunit epsilon [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665866|ref|YP_002426809.1| ATP synthase F1, epsilon subunit, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248675|gb|ACH84268.1| ATP synthase F1, epsilon subunit [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518079|gb|ACK78665.1| ATP synthase F1, epsilon subunit, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 163

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 52/91 (57%)

Query: 18  VFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPS 77
           V++G  + V +P+ELG+I +L GHAP+L+ ++ G + I+    +     + GG+ +I P 
Sbjct: 10  VYTGMARFVAVPAELGEIGILPGHAPLLSGLRPGELRITQPDGQTQILFLEGGMLEIQPD 69

Query: 78  HCTVLSETILPMDNACLQALEKRIDEVCSDL 108
             T+L++  L + +  +    +RI +  S L
Sbjct: 70  IVTILADASLRIADIDIHESRERIKDAQSTL 100


>gi|189499030|ref|YP_001958500.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Chlorobium phaeobacteroides BS1]
 gi|189494471|gb|ACE03019.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Chlorobium phaeobacteroides BS1]
          Length = 88

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+V+P+   F+GEV S++ P   G   VL  HAP+++ +K G VT+ L       +++  
Sbjct: 11 EIVTPQAQFFAGEVTSILAPGRDGLFQVLKNHAPLVSALKGGKVTLGLPDNSEKTFMIAD 70

Query: 70 GICDIVPSHCTVLSETI 86
          G  ++  +   +L+E I
Sbjct: 71 GFFEMSDNKAILLAEDI 87


>gi|52426400|ref|YP_089537.1| F0F1 ATP synthase subunit epsilon [Mannheimia succiniciproducens
          MBEL55E]
 gi|60389527|sp|Q65Q08|ATPE_MANSM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|52308452|gb|AAU38952.1| AtpC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 142

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 45/80 (56%), Gaps = 4/80 (5%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS--CEEIHR 64
           +  +VS E  +F G V+SV      G++ +L GH P+LT IK GIV  + +   EE+  
Sbjct: 4  FNLTIVSAENKIFEGAVKSVQATGIEGELGILAGHTPLLTAIKPGIVKFTYNDGIEEV-- 61

Query: 65 YVVIGGICDIVPSHCTVLSE 84
            V GG  +I P+  TVL++
Sbjct: 62 IYVSGGFLEIQPNIVTVLAD 81


>gi|300693750|ref|YP_003749723.1| ATP synthase epsilon chain (ATP synthase f1 sector epsilon subunit)
           [Ralstonia solanacearum PSI07]
 gi|299075787|emb|CBJ35092.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit)
           [Ralstonia solanacearum PSI07]
          Length = 139

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 4/118 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++V+ E+ ++ G  + VV+P   G++ +L GH P+LT ++ G V ++L  ++     
Sbjct: 4   LTVDVVTAEERLYQGTAKFVVVPGTEGELGILPGHEPLLTRLRPGTVRVTLENDDEVILF 63

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           V GG   I+P    +L++T +    +D A  Q      +E+  +  +  D   R Q E
Sbjct: 64  VAGGFAHILPQEVILLADTAVRARDLDEAKAQQARTAAEELLQNSRSKIDY-ARAQAE 120


>gi|317502819|ref|ZP_07960922.1| ATP synthase F1 sector epsilon subunit [Prevotella salivae DSM
          15606]
 gi|315666059|gb|EFV05623.1| ATP synthase F1 sector epsilon subunit [Prevotella salivae DSM
          15606]
          Length = 80

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 34/48 (70%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT 54
          L+  +VSPEK V+ G V  VV+P  LG+  +L  HAP++++++ G+VT
Sbjct: 2  LNLRIVSPEKVVYDGRVMRVVVPGTLGEFEILENHAPIISSLEKGLVT 49


>gi|224539736|ref|ZP_03680275.1| hypothetical protein BACCELL_04645 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|224518659|gb|EEF87764.1| hypothetical protein BACCELL_04645 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 81

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 36/50 (72%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV 53
          +  L+  +VSPEK +++GEV+SV LP  +G  T+L  HAP++++++ G V
Sbjct: 1  MKKLYLNIVSPEKEIYNGEVESVTLPGTIGTFTILPQHAPIVSSLREGKV 50


>gi|332707647|ref|ZP_08427675.1| ATP synthase F1 subcomplex epsilon subunit [Lyngbya majuscula 3L]
 gi|332353556|gb|EGJ33068.1| ATP synthase F1 subcomplex epsilon subunit [Lyngbya majuscula 3L]
          Length = 136

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 58/110 (52%), Gaps = 8/110 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+  + Q ++LPS  G + +L  HAP+L+ + +G++ I    E I    
Sbjct: 3   LTVRIIAPDKTVWDDQAQEIILPSTTGQLGILSDHAPLLSALDTGVMRIRSEKEWIP-IA 61

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNAC----LQALEKRIDEVCSDLN 109
           ++GG  ++  +  T+L   +E+   +D           + R++E+ SD N
Sbjct: 62  LMGGFVEVEDNEVTILVNGAESADEIDKDAAGVDFNEAKARLEELQSDEN 111


>gi|289548935|ref|YP_003473923.1| ATP synthase F1 subunit epsilon [Thermocrinis albus DSM 14484]
 gi|289182552|gb|ADC89796.1| ATP synthase F1, epsilon subunit [Thermocrinis albus DSM 14484]
          Length = 133

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 6/127 (4%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           E+V+P+  VFS +V SV +P+  G+I VL  H  ++T +K G++      E  + + V  
Sbjct: 5   EVVTPKGIVFSNDVTSVNIPTVEGEIGVLEKHMYLMTLLKPGLLYFDGKQE--NGFAVTY 62

Query: 70  GICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR----FQMEQLLV 125
           G  D+ P+   VL+E   P+ +      ++  DE    L     V++      QME+   
Sbjct: 63  GFVDVTPTKVIVLAEEAYPIGSIDPGREKELFDEAVKKLATATTVEEYEEYLRQMERART 122

Query: 126 DLSCLRR 132
            L  + R
Sbjct: 123 LLELVER 129


>gi|307720698|ref|YP_003891838.1| ATP synthase F1 subcomplex epsilon subunit [Sulfurimonas
           autotrophica DSM 16294]
 gi|306978791|gb|ADN08826.1| ATP synthase F1 subcomplex epsilon subunit [Sulfurimonas
           autotrophica DSM 16294]
          Length = 130

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
              E+++P   +++GE  SVVLP + G+  VL GHA + T +++G+V +    + +   V
Sbjct: 4   FKLEILTPNGEIYNGEAVSVVLPGKEGEFGVLAGHASLTTLLEAGVVDVEKEDKSVESIV 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLN 109
           V  G+  +      +L E    +       + K +DE    +N
Sbjct: 64  VNWGVVQVDEEKVVILVEGAAAIRGKTESEIAKALDEAKQLIN 106


>gi|126667609|ref|ZP_01738578.1| F0F1 ATP synthase subunit epsilon [Marinobacter sp. ELB17]
 gi|126627878|gb|EAZ98506.1| F0F1 ATP synthase subunit epsilon [Marinobacter sp. ELB17]
          Length = 140

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 53/94 (56%), Gaps = 4/94 (4%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS EK ++SG V+ ++     G++ + +GHAP+L+ +K G V I     E     
Sbjct: 5  VHCDVVSAEKKIYSGLVEMLIATGSEGELGIQLGHAPLLSALKPGAVRIIKQGGEEEILY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDN----ACLQA 96
          V GG  ++ P+  T++++T +   +    A LQA
Sbjct: 65 VSGGYLEVQPNLVTLMADTAVRAKDVDEAAALQA 98


>gi|308807473|ref|XP_003081047.1| putative ATP synthase delta chain, mitochondrial prec (ISS)
           [Ostreococcus tauri]
 gi|116059509|emb|CAL55216.1| putative ATP synthase delta chain, mitochondrial prec (ISS)
           [Ostreococcus tauri]
          Length = 210

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 21  GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCT 80
            +V  V++P+  GD  VL GH P ++ ++ G+V++ +S +++ RY V GG C +     T
Sbjct: 93  AQVDMVLVPATTGDFGVLPGHVPTVSQLRPGVVSVHVSDKDVQRYFVSGGFCFVHADSTT 152

Query: 81  -VLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
            + +   +P++    +A++K + E  +   N  D
Sbjct: 153 DICAVEAVPVEQLDPEAVKKGLAEHQAKFANAKD 186


>gi|219847905|ref|YP_002462338.1| F0F1 ATP synthase subunit epsilon [Chloroflexus aggregans DSM
          9485]
 gi|254809353|sp|B8G6G5|ATPE_CHLAD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|219542164|gb|ACL23902.1| ATP synthase F1, epsilon subunit [Chloroflexus aggregans DSM
          9485]
          Length = 139

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H E+V+ E+ + S +V  + +P++ G + +L  HAP++T ++ G + I  + E    + 
Sbjct: 3  IHLEIVTAERVILSDDVDMISVPTKDGRVGILPRHAPLMTILEPGELDIIKNGERTP-FA 61

Query: 67 VIGGICDIVPSHCTVLSETI 86
          V GG  +++P   T+L++T+
Sbjct: 62 VSGGFMEVLPHRVTILADTV 81


>gi|22266800|gb|AAM94914.1|AF522463_9 subunit epsilon [Ilyobacter tartaricus]
          Length = 134

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             E+++P K +   EV+ +VL +  GD+ VL  HAP +  +  G + I  S EE+  Y 
Sbjct: 4  FKLEVITPLKKIIEKEVEMIVLRTTEGDMGVLANHAPFVAELSIGEMKIKSSDEEVS-YF 62

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG  D+     T+L++  +
Sbjct: 63 VSGGFMDVSREKTTILADEAM 83


>gi|295836485|ref|ZP_06823418.1| ATP synthase, delta/epsilon chain, beta-sandwich
          domain-containing protein [Streptomyces sp. SPB74]
 gi|295826054|gb|EDY45955.2| ATP synthase, delta/epsilon chain, beta-sandwich
          domain-containing protein [Streptomyces sp. SPB74]
          Length = 90

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +  +LH ELV+ ++ V+SGE   VV  +  GDI V+ GH PVL  ++SG VTI  +    
Sbjct: 1  MAAELHVELVAADRSVWSGEATLVVARTTSGDIGVMPGHQPVLGVLESGPVTIRTTDGGT 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
              V GG      +  ++L+E
Sbjct: 61 VVVAVHGGFLSFADNKLSLLAE 82


>gi|317154798|ref|YP_004122846.1| ATP synthase F1 subunit epsilon [Desulfovibrio aespoeensis Aspo-2]
 gi|316945049|gb|ADU64100.1| ATP synthase F1, epsilon subunit [Desulfovibrio aespoeensis Aspo-2]
          Length = 140

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 65/136 (47%), Gaps = 11/136 (8%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + N L  E+V+P++ V S +V+ V  P  LG+  VL  H P L+ +  GI  +    E  
Sbjct: 1   MANTLKLEIVTPDRKVLSEDVEYVGAPGILGEFGVLPSHVPFLSAL--GIGNLHYKQEGK 58

Query: 63  HRYVVI-GGICDIVPSHCTVLSE-----TILPMDNACLQALEKRIDEVCSDLNNICDVDQ 116
             YV + GG  ++  +  T+L+E     T + +D A  Q   +R +E  +      D  +
Sbjct: 59  AHYVFVSGGFAEVSNNKVTILAEVAEKATEIDIDRA--QKARERAEERNAQAKEKIDAAR 116

Query: 117 -RFQMEQLLVDLSCLR 131
            +  + + +  +SC R
Sbjct: 117 NQAALRRAIARMSCQR 132


>gi|109947170|ref|YP_664398.1| F0F1 ATP synthase subunit epsilon [Helicobacter acinonychis str.
          Sheeba]
 gi|123173493|sp|Q17Y77|ATPE_HELAH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|109714391|emb|CAJ99399.1| ATP synthase epsilon chain [Helicobacter acinonychis str. Sheeba]
          Length = 123

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVRSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETESQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++   H  +L++
Sbjct: 63 ISWGYAEVTGEHVDILAD 80


>gi|163848584|ref|YP_001636628.1| F0F1 ATP synthase subunit epsilon [Chloroflexus aurantiacus
          J-10-fl]
 gi|222526519|ref|YP_002570990.1| F0F1 ATP synthase subunit epsilon [Chloroflexus sp. Y-400-fl]
 gi|254809352|sp|A9WGS3|ATPE_CHLAA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|254809354|sp|B9LBL9|ATPE_CHLSY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|163669873|gb|ABY36239.1| ATP synthase F1, epsilon subunit [Chloroflexus aurantiacus
          J-10-fl]
 gi|222450398|gb|ACM54664.1| ATP synthase F1, epsilon subunit [Chloroflexus sp. Y-400-fl]
          Length = 139

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H E+V+ E+ + S +V  +  P++ G + +L  HAP++T ++ G + I  + E    + 
Sbjct: 3  IHLEIVTAERVILSDDVDMISAPTKDGRVGILPRHAPLMTILEPGELDIIKNGERTP-FA 61

Query: 67 VIGGICDIVPSHCTVLSETI 86
          V GG  +++P   T+L++T+
Sbjct: 62 VSGGFMEVLPHRVTILADTV 81


>gi|288803180|ref|ZP_06408615.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella melaninogenica D18]
 gi|302346237|ref|YP_003814535.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella melaninogenica ATCC 25845]
 gi|288334441|gb|EFC72881.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella melaninogenica D18]
 gi|302151091|gb|ADK97352.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella melaninogenica ATCC 25845]
          Length = 79

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 44/70 (62%), Gaps = 5/70 (7%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS--CEEIHR 64
          L   +VSPE+ VF+GEV SV++P  +G   +L  HAP+++T+  G V  S+    +E+H 
Sbjct: 2  LTLRIVSPERIVFTGEVDSVLVPGTVGPFEILNNHAPIISTLVEGKVAYSVKGDTKELH- 60

Query: 65 YVVIGGICDI 74
            ++GG  ++
Sbjct: 61 --IVGGFVEV 68


>gi|21223734|ref|NP_629513.1| F0F1 ATP synthase subunit epsilon [Streptomyces coelicolor A3(2)]
 gi|256785173|ref|ZP_05523604.1| F0F1 ATP synthase subunit epsilon [Streptomyces lividans TK24]
 gi|289769066|ref|ZP_06528444.1| ATP synthase F1, epsilon subunit [Streptomyces lividans TK24]
 gi|61219612|sp|P0A2Z6|ATPE_STRCO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|61219613|sp|P0A2Z7|ATPE_STRLI RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|581686|emb|CAA80328.1| H(+)-transporting ATP synthase [Streptomyces lividans]
 gi|8568796|emb|CAB94545.1| ATP synthase epsilon chain [Streptomyces coelicolor A3(2)]
 gi|289699265|gb|EFD66694.1| ATP synthase F1, epsilon subunit [Streptomyces lividans TK24]
          Length = 124

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH  LV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVALVAADREVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSD 107
               V GG      +  ++L+E     D   +   E+++++  ++
Sbjct: 61  VVAAVHGGFISFADNKLSLLAEVAELSDEIDVHRAERKLEQAKTE 105


>gi|198284878|ref|YP_002221199.1| F0F1 ATP synthase subunit epsilon [Acidithiobacillus ferrooxidans
          ATCC 53993]
 gi|218666899|ref|YP_002427558.1| ATP synthase F1, epsilon subunit [Acidithiobacillus ferrooxidans
          ATCC 23270]
 gi|198249399|gb|ACH84992.1| ATP synthase F1, epsilon subunit [Acidithiobacillus ferrooxidans
          ATCC 53993]
 gi|218519112|gb|ACK79698.1| ATP synthase F1, epsilon subunit [Acidithiobacillus ferrooxidans
          ATCC 23270]
          Length = 141

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +VS E  +++G    VV P E+G++ +L  HAP+LT ++ G + I    E  + +V  GG
Sbjct: 9  VVSAEGSIYAGVADMVVAPGEMGELGILPRHAPLLTGLRPGELRIIHGAETEYLFVN-GG 67

Query: 71 ICDIVPSHCTVLSET 85
          I +I P   TVL+++
Sbjct: 68 ILEIQPDMVTVLADS 82


>gi|212712644|ref|ZP_03320772.1| hypothetical protein PROVALCAL_03739 [Providencia alcalifaciens DSM
           30120]
 gi|212684860|gb|EEB44388.1| hypothetical protein PROVALCAL_03739 [Providencia alcalifaciens DSM
           30120]
          Length = 141

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 3/112 (2%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           + ++VS EK +F G VQ + +    G++ +   H P+LT IK G+V I+    E     +
Sbjct: 8   YLKVVSAEKQMFEGLVQKIQVTGSEGELGIYPQHTPLLTAIKPGMVRITKQFGEEELIYL 67

Query: 68  IGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCSDLNNICDVDQ 116
            GGI ++ P+   VL++T +    +D A     +++ +E     +   D  Q
Sbjct: 68  SGGILEVQPTGVIVLADTAIRGKDLDEARAVEAKRKAEEHVRKAHGDVDYAQ 119


>gi|317011329|gb|ADU85076.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori
          SouthAfrica7]
          Length = 123

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETESKKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++   H  +L++
Sbjct: 63 ISWGYAEVTGEHVDILAD 80


>gi|290957351|ref|YP_003488533.1| ATP synthase subunit epsilon [Streptomyces scabiei 87.22]
 gi|260646877|emb|CBG69974.1| ATP synthase epsilon chain [Streptomyces scabiei 87.22]
          Length = 124

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH  LV+ ++ V+SG+   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVALVAADREVWSGQATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRID 102
               V GG      +  ++L+E     D   +Q+ E+ ++
Sbjct: 61  VVVAVHGGFISFADNKLSLLAEVAELADEIDVQSAERELE 100


>gi|169142797|ref|YP_001687222.1| ATP synthase CF1 epsilon subunit [Aneura mirabilis]
 gi|153973823|gb|ABS54483.1| ATP synthase CF1 epsilon subunit [Aneura mirabilis]
          Length = 139

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ EVQ ++L +  G I +L  HAP+LT +  GI+ I L  E+     
Sbjct: 3  LNLRIMAPNRIVWTNEVQEIILSTNSGRIGILPNHAPLLTALDIGIIKIRLR-EQWSTMA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +   VL
Sbjct: 62 LMGGFAMIENNQMIVL 77


>gi|238759559|ref|ZP_04620721.1| ATP synthase epsilon chain [Yersinia aldovae ATCC 35236]
 gi|238702218|gb|EEP94773.1| ATP synthase epsilon chain [Yersinia aldovae ATCC 35236]
          Length = 124

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 7/118 (5%)

Query: 18  VFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPS 77
           +FSG VQ + +    G++ +  GHAP+LT IK G++ I     E     + GGI ++ PS
Sbjct: 1   MFSGVVQKIQVTGSEGELGIFPGHAPLLTAIKPGMIRIVKQFGEEEFIYLSGGILEVQPS 60

Query: 78  HCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLR 131
              VL++T +    +D A  L++  K  D +    N+  DVD      +L   ++ LR
Sbjct: 61  VVIVLADTAIRGTDLDEAKALESKRKAEDHIN---NSHGDVDYAQASAELAKAIAKLR 115


>gi|728927|sp|P41171|ATPE_THIFE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|154675|gb|AAA53128.1| F1F0-ATPase epsilon subunit [Acidithiobacillus ferrooxidans]
          Length = 141

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +VS E  +++G    VV P E+G++ +L  HAP+LT ++ G + I    E  + +V  GG
Sbjct: 9  VVSAEGSIYAGVADMVVAPGEMGELGILPRHAPLLTGLRPGELRIIHGAETEYLFVN-GG 67

Query: 71 ICDIVPSHCTVLSET 85
          I +I P   TVL+++
Sbjct: 68 ILEIQPDMVTVLADS 82


>gi|584814|sp|Q08808|ATPE_GALSU RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|2146719|pir||S70820 H+-transporting two-sector ATPase (EC 3.6.3.14) epsilon chain - red
           alga (Cyanidium caldarium) chloroplast
 gi|396526|emb|CAA47242.1| H(+)-transporting ATP synthase [Cyanidium caldarium]
          Length = 138

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 66/134 (49%), Gaps = 14/134 (10%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L+  +++P++ V++ + + V+LP+  G + +L GHAP+LT +  G++ + ++       V
Sbjct: 3   LNIRVIAPDRIVWNAKAEEVILPTSTGQLGILSGHAPLLTALDIGVMRVRIT-NTWTSIV 61

Query: 67  VIGGICDIVPSHCTVL-----SETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           + GG  ++      +L       +++ +D A      K + E  S LN      ++F+  
Sbjct: 62  LFGGFAEVENDEILILVNGAEEASVINLDKA-----NKELIESSSLLNEAKTNKEKFEAT 116

Query: 122 QLLVDLSCLRRRIQ 135
           Q    L   + R+Q
Sbjct: 117 Q---KLRKAKARVQ 127


>gi|221194956|ref|ZP_03568012.1| ATP synthase F1, epsilon subunit [Atopobium rimae ATCC 49626]
 gi|221184859|gb|EEE17250.1| ATP synthase F1, epsilon subunit [Atopobium rimae ATCC 49626]
          Length = 145

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE----IHRY 65
           + V P++ ++ G V S++L +  G++ V  GH P +  +  G+V +S++       I + 
Sbjct: 7   QFVRPDRLLYEGNVASLILATIDGELGVWPGHEPEIVALGDGVVRLSINQPNGEVSIQKV 66

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
           V+ GG  +I PS   +L++     D+  +  + +  D     +N+  + D R
Sbjct: 67  VISGGYAEIDPSGVIILADHARRSDDIDVDVVRETRDAAIDKMNDFDEKDNR 118


>gi|301059564|ref|ZP_07200476.1| ATP synthase F1, epsilon subunit [delta proteobacterium NaphS2]
 gi|300446329|gb|EFK10182.1| ATP synthase F1, epsilon subunit [delta proteobacterium NaphS2]
          Length = 136

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 6/116 (5%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +  L+ E+V+PEK + S EV  VV P  +G+  VL  H P L+ I+ G +  S S  +  
Sbjct: 1   MGKLNLEVVTPEKVMVSQEVDIVVAPGTMGEFGVLENHVPFLSGIEPGELRFS-SGSQTE 59

Query: 64  RYVVIGGICDIVPSHCTVL---SETILPMD-NACLQALEKRIDEVCSDLNNICDVD 115
           R++V  G  ++  +  ++L   +E    +D     +A+E+  + +  D     DVD
Sbjct: 60  RFLVTTGFSEVSNNKVSILVDAAEKATEIDVERARKAMERAKERLAMDRGR-EDVD 114


>gi|332146794|dbj|BAK19949.1| ApH+ATPase epsilon subunit [Aphanothece halophytica]
          Length = 138

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 60/129 (46%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+  V+    + V+LPS  G + +L GHAP+L+ +  G++ +    + +    
Sbjct: 3   LTVRVITPDNTVWDSSAEEVILPSTTGQLGILSGHAPLLSALDIGVMRVRPQKDWLS-IS 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG  ++     T+L  +    +N   +   +  +   + L    + DQR ++ Q    
Sbjct: 62  VAGGFAEVEEDEVTILVNSAERGENIDPEKAREIYESAKTRLEQAQEADQRQEIIQATQA 121

Query: 127 LSCLRRRIQ 135
           L   R R+Q
Sbjct: 122 LKKARSRLQ 130


>gi|300726964|ref|ZP_07060387.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella bryantii B14]
 gi|299775749|gb|EFI72336.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella bryantii B14]
          Length = 83

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 37/49 (75%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSG 51
          +V+ L  ++VS EK VF+G+V+SV +P  LG+  +LV HAP++++++ G
Sbjct: 2  IVSMLKLKIVSTEKVVFTGDVESVTVPGTLGEFEILVNHAPIISSLEKG 50


>gi|189465909|ref|ZP_03014694.1| hypothetical protein BACINT_02272 [Bacteroides intestinalis DSM
          17393]
 gi|189434173|gb|EDV03158.1| hypothetical protein BACINT_02272 [Bacteroides intestinalis DSM
          17393]
          Length = 81

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 36/50 (72%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV 53
          +  L+  +VSPEK +++GE++SV LP  +G  T+L  HAP++++++ G V
Sbjct: 1  MKKLYLNIVSPEKEIYNGEIESVTLPGTIGTFTILPQHAPIVSSLREGKV 50


>gi|239946818|ref|ZP_04698571.1| ATP synthase F1, epsilon subunit [Rickettsia endosymbiont of
          Ixodes scapularis]
 gi|239921094|gb|EER21118.1| ATP synthase F1, epsilon subunit [Rickettsia endosymbiont of
          Ixodes scapularis]
          Length = 112

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 51/86 (59%), Gaps = 6/86 (6%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR----Y 65
          ++++P    F  + + V +P E G   VL GHAP++  +K+G+V + +  +++H+    Y
Sbjct: 8  KIITPLSIAFEKQAKMVTMPGEEGMFGVLPGHAPMIVNLKAGLVQVYI--DDMHKSENTY 65

Query: 66 VVIGGICDIVPSHCTVLSETILPMDN 91
          ++ GG+ ++  ++  + +ET + + N
Sbjct: 66 LISGGVTEVTANYINIATETAINVTN 91


>gi|167588246|ref|ZP_02380634.1| ATP synthase F1, epsilon subunit [Burkholderia ubonensis Bu]
          Length = 149

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 10/117 (8%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  +++S +  +FSG  ++V +P E G++ +   HAP+ T ++ G+VT++ +    HR +
Sbjct: 2   LQLDILSIDDVLFSGVARAVTVPGESGELGIHPRHAPLFTRLRPGVVTVTDAKTGEHRRI 61

Query: 67  -VIGGICDIVPSHCTVLSETILPMDN-ACLQALEKRIDEVCSDLNNICDVDQRFQME 121
            V GG+ ++     T++++  L       L+A E R        N   D  +R+  E
Sbjct: 62  LVAGGVLEVSRDGVTLIADHALRTPELDALRAREAR--------NAANDWRRRYAQE 110


>gi|207092450|ref|ZP_03240237.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori
          HPKX_438_AG0C1]
          Length = 123

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++   H  +L++
Sbjct: 63 INWGYAEVTGEHVDILAD 80


>gi|117926731|ref|YP_867348.1| ATP synthase F1 subunit epsilon [Magnetococcus sp. MC-1]
 gi|189081367|sp|A0LD99|ATPE_MAGSM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|117610487|gb|ABK45942.1| ATP synthase F1 subcomplex epsilon subunit [Magnetococcus sp.
          MC-1]
          Length = 137

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 9  FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
           E+V+PEK + S  VQ V +P   G   VL GH P++++++SG+V +    + +H   V 
Sbjct: 7  LEVVTPEKLILSETVQLVTVPGSEGYFGVLSGHVPMISSLRSGVVRMGQGDDAVH-LAVS 65

Query: 69 GGICDIVPSHCTVL 82
           G  ++ P   T+L
Sbjct: 66 KGFAEVRPDRVTLL 79


>gi|32490758|ref|NP_871012.1| hypothetical protein WGLp009 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|31339980|sp|Q8D3J2|ATPE_WIGBR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|25165964|dbj|BAC24155.1| atpC [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 138

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 4/85 (4%)

Query: 4  VNDLHFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
          +N+  ++L  +S E  +FS  V+   +    G++ +L GHAP++T IK G++ I +S + 
Sbjct: 1  MNNKFYQLTVISAENFIFSNLVKKSNITGSEGNLGILPGHAPLITKIKPGLIHI-ISSKN 59

Query: 62 IHRYVVI-GGICDIVPSHCTVLSET 85
          I  Y+ + GGI +I  +  TVL++T
Sbjct: 60 IEEYIYLSGGILEINSNVVTVLADT 84


>gi|332980983|ref|YP_004462424.1| ATP synthase F1 subcomplex subunit epsilon [Mahella australiensis
          50-1 BON]
 gi|332698661|gb|AEE95602.1| ATP synthase F1 subcomplex epsilon subunit [Mahella australiensis
          50-1 BON]
          Length = 139

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLP-----SELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
           H ++VSP++  F G+V+ ++ P     +  G + VL GH P++  I  G++ I  S  +
Sbjct: 4  FHLDIVSPDREFFDGDVEEIIFPVSNGYTSDGYMGVLAGHEPLVCPIGIGVLRIKQSG-Q 62

Query: 62 IHRYVVIGGICDIVPSHCTVLSETI 86
               + GG  +I P   T+LS+T+
Sbjct: 63 WRDAAISGGFIEIRPQKVTILSDTV 87


>gi|225159359|ref|ZP_03725656.1| ATP synthase F1, epsilon subunit [Opitutaceae bacterium TAV2]
 gi|224802065|gb|EEG20340.1| ATP synthase F1, epsilon subunit [Opitutaceae bacterium TAV2]
          Length = 135

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  E+++PE  V+S  + +VV+P+ +G+I +L GH P+LT +  G + ++ + +  H  +
Sbjct: 3  LTLEIITPEARVYSDTIDTVVIPTVMGEIGILPGHMPLLTQVSDGELRVTKNGQTEH-LI 61

Query: 67 VIGGICDIVPSHCTVLSE 84
          V GG   +     +VL+E
Sbjct: 62 VSGGFAQVEGDTVSVLAE 79


>gi|83749929|ref|ZP_00946887.1| ATP synthase epsilon chain [Ralstonia solanacearum UW551]
 gi|207739163|ref|YP_002257556.1| atp synthase epsilon chain 2 (atp synthase f1 sectorepsilon
          subunit 2) protein [Ralstonia solanacearum IPO1609]
 gi|83723403|gb|EAP70623.1| ATP synthase epsilon chain [Ralstonia solanacearum UW551]
 gi|206592536|emb|CAQ59442.1| atp synthase epsilon chain 2 (atp synthase f1 sectorepsilon
          subunit 2) protein [Ralstonia solanacearum IPO1609]
          Length = 139

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 46/79 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ ++ G  + VV+P   G++ +L GH P+LT ++ G V ++L  +E     
Sbjct: 4  LTVDVVTAEERLYQGTAKFVVVPGTEGELGILPGHEPLLTRLRPGTVRLTLENDEEVILF 63

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG   ++P    +L++T
Sbjct: 64 VAGGFAHVLPREVILLADT 82


>gi|147679146|ref|YP_001213361.1| F0F1 ATP synthase subunit epsilon [Pelotomaculum
          thermopropionicum SI]
 gi|226740304|sp|A5CYE1|ATPE_PELTS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|146275243|dbj|BAF60992.1| F0F1-type ATP synthase, epsilon subunit [Pelotomaculum
          thermopropionicum SI]
          Length = 134

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 8  HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
            E+V+P++ VFS +V  +V P   G++ VL  HAP++T++  GI+ I     +  + VV
Sbjct: 7  RLEIVTPQRKVFSEDVSFLVAPGTEGELGVLPNHAPLITSLNIGIMRIQQEG-KTFKVVV 65

Query: 68 IGGICDIVPSHCTVLS 83
           GG  ++  +  TVL+
Sbjct: 66 TGGFMEVRDNKVTVLA 81


>gi|257459079|ref|ZP_05624198.1| ATP synthase F1, epsilon subunit [Campylobacter gracilis RM3268]
 gi|257443464|gb|EEV18588.1| ATP synthase F1, epsilon subunit [Campylobacter gracilis RM3268]
          Length = 134

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 62/122 (50%), Gaps = 11/122 (9%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIK----SGIVTISLSCEEI 62
           L  ++V+PE  VFSGEV+SV LP   G++ +L GHA +LT +K     G+V I     + 
Sbjct: 5   LLLDIVTPEGMVFSGEVKSVQLPGITGEMGILPGHASLLTGLKDKSEGGVVEIVDKDGKK 64

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPM----DNACLQALEKRID---EVCSDLNNICDVD 115
              +V  G  ++     T+L+   + +    ++A  ++L++  D    + SD  N   + 
Sbjct: 65  QLVLVNDGFLEVTEEKTTILATQAVAIGGDSESAVAKSLQRAKDMLTSISSDAANSAAIM 124

Query: 116 QR 117
            R
Sbjct: 125 AR 126


>gi|311898390|dbj|BAJ30798.1| putative ATP synthase subunit epsilon [Kitasatospora setae
          KM-6054]
          Length = 127

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (55%)

Query: 6  DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
          +LH ELV+ ++ V+SG    VV  +  GD  ++ GH PVL+ ++SG VTI  + +     
Sbjct: 3  ELHVELVAADRKVWSGAATIVVARTASGDTGIMPGHTPVLSVLESGPVTIRTADQGTVVA 62

Query: 66 VVIGGICDIVPSHCTVLSE 84
           V GG      +  ++L+E
Sbjct: 63 AVHGGFISFAENKLSILAE 81


>gi|89628441|gb|ABD77506.1| putative mitochondrial ATP synthase [Theileria lestoquardi]
          Length = 148

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 5  NDLHFELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEEI 62
           DL F L+S  + +F+   V+++ +P   G  TV  GH+P+L+T+K G+V+ SL    E+
Sbjct: 18 KDLVFSLLSSHESLFNKVPVKNLTVPGYDGYFTVTPGHSPMLSTLKPGVVSFSLKDSNEV 77

Query: 63 HRYVVIGGI 71
          H+Y +  G 
Sbjct: 78 HKYFISSGF 86


>gi|302554178|ref|ZP_07306520.1| ATP synthase F1, epsilon subunit [Streptomyces viridochromogenes
           DSM 40736]
 gi|302471796|gb|EFL34889.1| ATP synthase F1, epsilon subunit [Streptomyces viridochromogenes
           DSM 40736]
          Length = 125

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH  LV+ ++ V+SG+   VV  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVALVAADREVWSGQATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSD 107
               V GG         ++L+E     D   +Q +E+ ++   ++
Sbjct: 61  VVAAVHGGFISFADDKLSLLAEVAELSDEIDVQRVERELERAKAE 105


>gi|268679157|ref|YP_003303588.1| ATP synthase F1 subunit epsilon [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617188|gb|ACZ11553.1| ATP synthase F1, epsilon subunit [Sulfurospirillum deleyianum DSM
           6946]
          Length = 131

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 64/132 (48%), Gaps = 2/132 (1%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +N L  E+V+PE  +F+ +V+ V LP + G+  VL  HA ++  +++GI+ I L  +  H
Sbjct: 1   MNTLKLEIVTPEGQIFTNDVKGVTLPGKEGEFGVLPNHASIVALLQAGIIDIELK-DGNH 59

Query: 64  RYVVIG-GICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
             V I  G   +  +  T+L++  + +       + K ++     L +I D D    M  
Sbjct: 60  DVVAINWGHVKVDENSVTILADGAVSIGGTSESEVAKSLEAAKELLKSISDSDVAIAMAT 119

Query: 123 LLVDLSCLRRRI 134
             ++ +   ++ 
Sbjct: 120 AKIESAAKLKKF 131


>gi|300087663|ref|YP_003758185.1| ATP synthase F1 subunit epsilon [Dehalogenimonas
          lykanthroporepellens BL-DC-9]
 gi|299527396|gb|ADJ25864.1| ATP synthase F1, epsilon subunit [Dehalogenimonas
          lykanthroporepellens BL-DC-9]
          Length = 146

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  E+V+PE+ VFS +V  VV P   G++ +L  H P++T +K+G +      EE    +
Sbjct: 4  LKLEIVTPERQVFSDDVDIVVAPGIEGELGILPHHTPLMTALKTGELRARKGSEEFL-LL 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          V GG  ++ P    VL++
Sbjct: 63 VSGGFLEVRPDRVIVLAD 80


>gi|246880770|gb|ACS95082.1| ATP synthase CF1 epsilon subunit [Dunaliella salina]
          Length = 135

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 6  DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
          +L   +++PE+  ++G+   +VLP+E G++ VL  HAP++T +  G + I  + +E    
Sbjct: 2  NLQISILTPERPFWNGQADEIVLPTETGEMGVLKNHAPIITGLDVGAMLIR-TNQEWTSL 60

Query: 66 VVIGGICDIVPSHCTVLS 83
           ++GG   +  +  T+L+
Sbjct: 61 AIMGGFALVKQNVVTILA 78


>gi|326792678|ref|YP_004310499.1| ATP synthase F1 subunit epsilon [Clostridium lentocellum DSM 5427]
 gi|326543442|gb|ADZ85301.1| ATP synthase F1, epsilon subunit [Clostridium lentocellum DSM 5427]
          Length = 133

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 56/109 (51%), Gaps = 6/109 (5%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
           N +  ++++P K +   EV SV+L +  G++ +L  H PV+  +  G  T+S + +E+ +
Sbjct: 4   NKMRLQIITPMKTILDEEVDSVILSTTEGEMGILYDHEPVVVLL--GYKTLSYTQDEVKK 61

Query: 65  YV-VIGGICDIVPSHCTVLSETILPMDNACLQALEK---RIDEVCSDLN 109
           Y   +GG  +I      VL++     D   L+  ++   R ++  SD N
Sbjct: 62  YATTLGGFAEITKDKIVVLTDASEFADEIDLERAKRAKERAEKRLSDSN 110


>gi|222053554|ref|YP_002535916.1| ATP synthase F1, epsilon subunit [Geobacter sp. FRC-32]
 gi|254809367|sp|B9LZ83|ATPE_GEOSF RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|221562843|gb|ACM18815.1| ATP synthase F1, epsilon subunit [Geobacter sp. FRC-32]
          Length = 138

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 60/132 (45%), Gaps = 7/132 (5%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE- 61
           +   L  ELV+P K V + EV  +     LG+  VL GHAP LT++K G     LS ++ 
Sbjct: 1   MAEKLKVELVTPYKKVLTEEVDEITATGALGEFGVLPGHAPFLTSLKIG----ELSYKKD 56

Query: 62  --IHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQ 119
             I    +  G  ++     TVL ET    D   L+  +  +      L  +   D+ F+
Sbjct: 57  GVISHLALNWGYFEVENDKVTVLVETAEKADEIDLERAKSALGRAEEALKKLNPEDKSFR 116

Query: 120 MEQLLVDLSCLR 131
           + +  ++ + +R
Sbjct: 117 VYEAALERALIR 128


>gi|299069170|emb|CBJ40425.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon
          subunit) [Ralstonia solanacearum CMR15]
          Length = 139

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 46/79 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ ++ G  + VV+P   G++ +L GH P+LT ++ G V ++L  ++     
Sbjct: 4  LTVDVVTAEERLYQGTAKFVVVPGTEGELGILPGHEPLLTRLRPGTVRVTLENDDEIILF 63

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG   I+P    +L++T
Sbjct: 64 VAGGFAHILPQEVILLADT 82


>gi|198274976|ref|ZP_03207508.1| hypothetical protein BACPLE_01135 [Bacteroides plebeius DSM
          17135]
 gi|198272423|gb|EDY96692.1| hypothetical protein BACPLE_01135 [Bacteroides plebeius DSM
          17135]
          Length = 81

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          + +LH  +VSPEK V+ G+V     P   G   V+  HAP+++T+ +G V   ++ +E  
Sbjct: 1  MKELHLVIVSPEKLVYEGKVSQATFPGSAGKFQVMADHAPLISTLSAGEVKY-VAGQETQ 59

Query: 64 RYVVIGGICDIVPSHCTV 81
             + GG  ++  +  +V
Sbjct: 60 SLQIKGGFVEVKENQISV 77


>gi|269957231|ref|YP_003327020.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Xylanimonas cellulosilytica DSM 15894]
 gi|269305912|gb|ACZ31462.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Xylanimonas cellulosilytica DSM 15894]
          Length = 91

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  +LVS ++ V+SG  ++V  PS  G I +L GH P+L  +++G V ++    E     
Sbjct: 4  LSVDLVSADRKVWSGTARAVSAPSVDGQIGILSGHTPILAVLRAGTVRVTTDGAEPFEVH 63

Query: 67 VIGGICDIVPSHCTVLSETILPMDNA 92
          V GG   +     TV+++ I P+  A
Sbjct: 64 VTGGFVSVDDDLVTVVADEISPVTGA 89


>gi|17367084|sp|Q9TKI6|ATPE_MEDSA RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|5679310|gb|AAD46915.1|AF163770_2 ATP synthase epsilon subunit [Medicago sativa]
          Length = 137

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ ++     ++GG
Sbjct: 7  VLTPNRTVWDSEVKEIILSTNSGQIGVLKNHAPIATALDIGILKIRLTNQQWVTMALMGG 66

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 67 FARIGNNEITIL 78


>gi|281420265|ref|ZP_06251264.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella copri DSM 18205]
 gi|281405760|gb|EFB36440.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella copri DSM 18205]
          Length = 79

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 34/47 (72%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV 53
          L  ++VSPEK VF GEV+SV++P  LG   +L  HAP++++++ G V
Sbjct: 2  LQLKIVSPEKVVFQGEVESVLVPGTLGSFEILKDHAPIISSLEVGKV 48


>gi|17549031|ref|NP_522371.1| ATP synthase epsilon chain protein [Ralstonia solanacearum
          GMI1000]
 gi|20137358|sp|Q8XRM1|ATPE2_RALSO RecName: Full=ATP synthase epsilon chain 2; AltName: Full=ATP
          synthase F1 sector epsilon subunit 2; AltName:
          Full=F-ATPase epsilon subunit 2
 gi|17431282|emb|CAD17961.1| probable atp synthase epsilon chain 2 (atp synthase f1
          sectorepsilon subunit 2) protein [Ralstonia
          solanacearum GMI1000]
          Length = 139

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 46/79 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ ++ G  + VV+P   G++ +L GH P+LT ++ G V ++L  ++     
Sbjct: 4  LTVDVVTAEERLYQGTAKFVVVPGTEGELGILPGHEPLLTRLRPGTVRVTLENDDEVILF 63

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG   I+P    +L++T
Sbjct: 64 VAGGFAHILPQEVILLADT 82


>gi|28202178|ref|NP_777419.1| ATP synthase CF1 epsilon subunit [Anthoceros formosae]
 gi|29337037|sp|Q31793|ATPE_ANTFO RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|27807880|dbj|BAC55355.1| ATPase epsilon subunit [Anthoceros formosae]
 gi|27808007|dbj|BAC55450.1| ATPase epsilon subunit [Anthoceros formosae]
          Length = 138

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ EV+ +VL +  G I VL  HAP+LT +  GI+ I L+  E     
Sbjct: 3  LNLRVMAPNRIVWNSEVEEIVLSTNSGQIGVLPNHAPLLTALDIGIIKIRLNG-EWSTMA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  T+L
Sbjct: 62 LMGGFAMIDNNGMTIL 77


>gi|258512715|ref|YP_003186149.1| ATP synthase F1, epsilon subunit [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479441|gb|ACV59760.1| ATP synthase F1, epsilon subunit [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 148

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 60/117 (51%), Gaps = 2/117 (1%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
            E+V+PE+ V S +V+ V+L    G+I +L  H P+ T +K  +V I L+ +      V 
Sbjct: 6   LEIVTPERIVLSMDVRMVILRGGDGEIGILPRHMPLATAVKPCLVRIRLADDRQDVVPVS 65

Query: 69  GGICDIVPSHCTVLSETI-LPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
           GG  +++P   T+L++T  LP +    +AL  + D     L    D ++  +  Q L
Sbjct: 66  GGFVEVLPEKITILADTAELPEEIDVDRALRAK-DRAEKRLQAAVDEEEADRARQAL 121


>gi|16080733|ref|NP_391561.1| F0F1 ATP synthase subunit epsilon [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221311640|ref|ZP_03593487.1| F0F1 ATP synthase subunit epsilon [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315968|ref|ZP_03597773.1| F0F1 ATP synthase subunit epsilon [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320879|ref|ZP_03602173.1| F0F1 ATP synthase subunit epsilon [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221325164|ref|ZP_03606458.1| F0F1 ATP synthase subunit epsilon [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|584813|sp|P37812|ATPE_BACSU RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|433992|emb|CAA82261.1| ATP synthase subunit epsilon [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|2636205|emb|CAB15697.1| ATP synthase (subunit epsilon, F1 subunit) [Bacillus subtilis
           subsp. subtilis str. 168]
          Length = 132

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +V+P+  V+  +++ V + +E GD+ +L GH P +  +K G V +     +     V GG
Sbjct: 8   IVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDG-QTEMVAVSGG 66

Query: 71  ICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDV 114
             ++ P H T+L   +ET   +D    +A  +R  E  +  ++  D+
Sbjct: 67  FVEVRPDHVTILAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDI 113


>gi|24215475|ref|NP_712956.1| F0F1 ATP synthase subunit epsilon [Leptospira interrogans serovar
          Lai str. 56601]
 gi|45657127|ref|YP_001213.1| F0F1 ATP synthase subunit epsilon [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
 gi|60389684|sp|Q72SX8|ATPE_LEPIC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|60389794|sp|Q8F2J6|ATPE_LEPIN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|24196606|gb|AAN49974.1| ATP synthase F1 sector epsilon subunit [Leptospira interrogans
          serovar Lai str. 56601]
 gi|45600365|gb|AAS69850.1| ATP synthase epsilon chain [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
          Length = 127

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           N L   ++SPEK ++ GEV S+++P   G   +L  HAP++ T+  GI+ I    E++ 
Sbjct: 3  ANKLKVSVISPEKILYKGEVDSLIVPGSEGFFGILPNHAPLVATLGIGILEIR-KGEKLK 61

Query: 64 RYVVIGGICDIVPSHCTVLSE 84
             V GG  +I  +  ++L++
Sbjct: 62 VLSVEGGFVEIKDNSISILTD 82


>gi|284007072|emb|CBA72347.1| F0F1 ATP synthase subunit epsilon [Arsenophonus nasoniae]
          Length = 138

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           H  +VS EK +F G VQ + +    G++ +   H P+LT IK G++ I+    E     +
Sbjct: 7   HLVVVSAEKQMFDGLVQKIQVTGSEGELGIYPQHTPLLTAIKPGMIRITKQFGEEELIYL 66

Query: 68  IGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
            GGI ++ P+   VL++T +    +D A     +++ +E     +   DVD      +L 
Sbjct: 67  SGGILEVQPNGVIVLADTAIRGKDLDEAKALESKRKAEEHIRKAH--ADVDYAQASAELA 124

Query: 125 VDLSCLR 131
             ++ LR
Sbjct: 125 KAIAKLR 131


>gi|154174884|ref|YP_001408808.1| F0F1 ATP synthase subunit epsilon [Campylobacter curvus 525.92]
 gi|166222443|sp|A7H016|ATPE_CAMC5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|112803731|gb|EAU01075.1| ATP synthase F1, epsilon subunit [Campylobacter curvus 525.92]
          Length = 129

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          ++ LH E+V+P+  VFS +V SVVLP   G+  VL  HA +++ +K+GI+ I
Sbjct: 1  MDKLHLEIVTPQGQVFSDDVSSVVLPGSEGEFGVLPNHASLISLLKAGIIDI 52


>gi|303232585|ref|ZP_07319271.1| ATP synthase F1, epsilon subunit [Atopobium vaginae PB189-T1-4]
 gi|302481372|gb|EFL44446.1| ATP synthase F1, epsilon subunit [Atopobium vaginae PB189-T1-4]
          Length = 145

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL---SCEEIHRYV 66
           + V P+K +++G V S++L ++ G++ V  GHA  + ++  GIV +        E  + V
Sbjct: 7   QFVRPDKLIYNGYVASLILATQDGELGVWPGHASAIVSLGDGIVRLHHLEDDGGETDKVV 66

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           V GG  +I P+   +L+     +D+     + +   E    LN I + D R    Q
Sbjct: 67  VSGGYAEINPNGVIILASHARLVDDIERDVVLETRQEAFDKLNEIDEKDNRRAYYQ 122


>gi|262374658|ref|ZP_06067931.1| ATP synthase F1, epsilon subunit [Acinetobacter junii SH205]
 gi|262310448|gb|EEY91539.1| ATP synthase F1, epsilon subunit [Acinetobacter junii SH205]
          Length = 139

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 62/119 (52%), Gaps = 20/119 (16%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVV 67
           ++VS ++ ++SG+V  ++     G++ +L GHAP++T ++ G + + L    EEI    V
Sbjct: 7   DVVSVKESIYSGQVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVQLENGTEEI--VYV 64

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
            GG+ ++ P   TVL+++ +  DN                L+    ++ R Q EQLL +
Sbjct: 65  SGGVLEVQPHVVTVLADSAIRADN----------------LDEAAIMEARKQAEQLLAN 107


>gi|257785095|ref|YP_003180312.1| ATP synthase F1, epsilon subunit [Atopobium parvulum DSM 20469]
 gi|257473602|gb|ACV51721.1| ATP synthase F1, epsilon subunit [Atopobium parvulum DSM 20469]
          Length = 140

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 58/113 (51%), Gaps = 5/113 (4%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSC-----EEIHR 64
           + V P+K ++ G V+S++L S  G+  V  GHAP +  +  G+V + +       E + +
Sbjct: 7   QFVRPDKLLYEGTVESLILASSDGEYGVWPGHAPEIIALGDGVVRLHMPHPESEEESMTK 66

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
            V+ GG  +I P+   +L++    +D+     + +  D+V   + ++ + D R
Sbjct: 67  IVISGGYAEIDPTGVIILADHARRVDDIDADVVRETRDDVIDQMLSLPEDDNR 119


>gi|114567887|ref|YP_755041.1| ATP synthase F1 subunit epsilon [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|119367804|sp|Q0AUD4|ATPE_SYNWW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|114338822|gb|ABI69670.1| ATP synthase F1, epsilon subunit [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 137

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 55/109 (50%), Gaps = 7/109 (6%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
            E+V+PE+ ++  E+Q +V P   G++ ++  HAP++  +  G++    S     R  + 
Sbjct: 8   LEVVTPERILYRDEIQFMVAPGIEGELGIMKNHAPLVAALNIGVLRYQTSTGVDKRMAIS 67

Query: 69  GGICDIVPSHCTVLSETI-------LPMDNACLQALEKRIDEVCSDLNN 110
           GG  +++ +   VL+ET        +    A  +  EKR++    ++N+
Sbjct: 68  GGFMEVIDNGTRVLAETAEHGSEIDVLRAKAAKERAEKRLEVRSEEINH 116


>gi|319952699|ref|YP_004163966.1| atpase, f1 complex, delta/epsilon subunit [Cellulophaga algicola
          DSM 14237]
 gi|319421359|gb|ADV48468.1| ATPase, F1 complex, delta/epsilon subunit [Cellulophaga algicola
          DSM 14237]
          Length = 93

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 34/49 (69%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          ++ E+VSPE  +FSGEV SV +P   G+  +L  HAP+++ ++ G+V I
Sbjct: 1  MYLEIVSPEATLFSGEVTSVTVPGINGEFQMLANHAPIVSLLQDGVVKI 49


>gi|288928044|ref|ZP_06421891.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330878|gb|EFC69462.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella sp. oral taxon 317 str. F0108]
          Length = 80

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +VSPEK ++ G+ QSV +P  LG+  +L  HAP+++++ +G V       E H   + GG
Sbjct: 6  IVSPEKQLYQGDAQSVKVPGSLGEFEILDSHAPIISSLDAGQVVYVTGEGETHECAIAGG 65

Query: 71 ICDI 74
            ++
Sbjct: 66 FVEV 69


>gi|226226123|ref|YP_002760229.1| ATP synthase epsilon chain [Gemmatimonas aurantiaca T-27]
 gi|226089314|dbj|BAH37759.1| ATP synthase epsilon chain [Gemmatimonas aurantiaca T-27]
          Length = 86

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   ++SPE+ +F G  + V+ P+  G+I +L  HAP++T +  GI+ +     E  R+ 
Sbjct: 5  LKVSVISPERVLFEGTARGVIAPAFDGEIGILPMHAPLMTLLGKGILRVDTVQGE-QRFT 63

Query: 67 VIGGICDIVPSHCTVLSE 84
          V GG   +V +   V++E
Sbjct: 64 VDGGFLQVVDNQVRVVTE 81


>gi|330469842|ref|YP_004407585.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Verrucosispora maris AB-18-032]
 gi|328812813|gb|AEB46985.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Verrucosispora maris AB-18-032]
          Length = 94

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTI-KSGIVTISLSCEE 61
          +   L+ +LV+ E+ V+SG+ + V+  +  G++ VL GHAP+L  + + G V I L   E
Sbjct: 1  MAEQLNVQLVAVEEKVWSGKAEMVMARTTEGELGVLPGHAPLLGQLAEPGQVRIKLPGGE 60

Query: 62 IHRYVVIGGICDIVPSHCTVLSETILPMDNAC 93
             Y V GG   +     TVL+E+  P   A 
Sbjct: 61 QVAYEVSGGFLSVSGQGVTVLAESATPASAAS 92


>gi|218290060|ref|ZP_03494227.1| ATP synthase F1, epsilon subunit [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239894|gb|EED07082.1| ATP synthase F1, epsilon subunit [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 148

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%), Gaps = 4/95 (4%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
            E+V+PE+ V S +V+ V+L    G+I +L  H P+ T +K  +V I L+ +      V 
Sbjct: 6   LEIVTPERIVLSMDVRMVILRGGDGEIGILPRHMPLATAVKPCLVRIRLADDRQDVVPVS 65

Query: 69  GGICDIVPSHCTVLSETI-LPMD---NACLQALEK 99
           GG  +++P   T+L++T  LP +   +  L+A E+
Sbjct: 66  GGFVEVLPEKITILADTAELPEEIDVDRALRAKER 100


>gi|33519492|ref|NP_878324.1| ATP synthase epsilon subunit [Candidatus Blochmannia floridanus]
 gi|60389740|sp|Q7VQV5|ATPE_BLOFL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|33517155|emb|CAD83537.1| ATP synthase epsilon subunit [Candidatus Blochmannia floridanus]
          Length = 138

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +VN     +VS EK +FSG ++ + +    G++ +  GH+P+LT IK G++ I       
Sbjct: 2  IVNSCQLNVVSVEKSIFSGVIKKIYVMGVEGELGIFPGHSPLLTLIKPGLLKIFQVYNNE 61

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
          + Y+  GGI ++ P+  T+L++
Sbjct: 62 YLYLS-GGILEVQPTVITILAD 82


>gi|302869576|ref|YP_003838213.1| F1 complex delta/epsilon subunit-like ATPase [Micromonospora
          aurantiaca ATCC 27029]
 gi|315503962|ref|YP_004082849.1| atpase, f1 complex, delta/epsilon subunit-like protein
          [Micromonospora sp. L5]
 gi|302572435|gb|ADL48637.1| ATPase, F1 complex, delta/epsilon subunit-like [Micromonospora
          aurantiaca ATCC 27029]
 gi|315410581|gb|ADU08698.1| ATPase, F1 complex, delta/epsilon subunit-like protein
          [Micromonospora sp. L5]
          Length = 92

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTI-KSGIVTISLSCEE 61
          +   LH ELV+ E+ V++GE + VV  +  G++ VL GHAP+L  + +   V I  +  +
Sbjct: 1  MAQQLHVELVAVEEKVWTGEAEMVVARTTEGELGVLPGHAPLLGQLAEPSQVRIKQAGGQ 60

Query: 62 IHRYVVIGGICDIVPSHCTVLSETILPMDNA 92
             Y V GG   +     TVL+E+  P   A
Sbjct: 61 QIAYDVAGGFLSVTGEGVTVLAESATPATPA 91


>gi|161344760|ref|NP_441408.2| F0F1 ATP synthase subunit epsilon [Synechocystis sp. PCC 6803]
 gi|114608|sp|P26533|ATPE_SYNY3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|47517|emb|CAA41138.1| ATPase subunit epsilon [Synechocystis sp. PCC 6803]
          Length = 136

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++P+K V+  EVQ ++LPS  G + +L  HAP+LT ++ G++ +    ++     
Sbjct: 3  LTVRVITPDKVVWDEEVQELILPSTTGQLGILSNHAPLLTALEIGVMRVR-PGKDWQNIA 61

Query: 67 VIGGICDIVPSHCTVL 82
          V+GG  ++  +   VL
Sbjct: 62 VMGGFAEVENNEVKVL 77


>gi|207109373|ref|ZP_03243535.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori
          HPKX_438_CA4C1]
          Length = 120

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 1  MKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 59

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++   H  +L++
Sbjct: 60 INWGYAEVTGEHVDILAD 77


>gi|116328612|ref|YP_798332.1| F0F1 ATP synthase subunit epsilon [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116331341|ref|YP_801059.1| F0F1 ATP synthase subunit epsilon [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|122280913|sp|Q04S19|ATPE_LEPBJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|122283601|sp|Q04ZU6|ATPE_LEPBL RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|116121356|gb|ABJ79399.1| epsilon subunit of the H(+)-transporting two- sector ATPase, F1
           sector [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116125030|gb|ABJ76301.1| epsilon subunit of the H(+)-transporting two- sector ATPase, F1
           sector [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 127

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 57/102 (55%), Gaps = 1/102 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
             + L+  ++SPEK ++ GEV S+V+P   G   +L  HAP++ T+  G++ I    E++
Sbjct: 2   FAHKLNVSVISPEKILYKGEVDSLVVPGSEGFFGILPNHAPLVATLGIGVLEIR-KGEKL 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV 104
               V GG  ++  +  ++L++     ++  ++A +K + EV
Sbjct: 61  KNISVEGGFIEVKDNTVSILTDHGALKEDIDIEAEKKALAEV 102


>gi|114775672|ref|ZP_01451240.1| ATP synthase epsilon chain [Mariprofundus ferrooxydans PV-1]
 gi|114553783|gb|EAU56164.1| ATP synthase epsilon chain [Mariprofundus ferrooxydans PV-1]
          Length = 151

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 66/133 (49%), Gaps = 5/133 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY- 65
           +H  + + E+ V+ G+   VV P   G + +L  HAP+L TI++G++ I    E+  +  
Sbjct: 15  MHVLVATAEEEVYRGDALRVVAPGTAGSLAILPNHAPLLATIRAGVLRIDCCHEKQEQRC 74

Query: 66  ---VVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR-FQME 121
              VVIGG  ++  ++ T+L++ I    +      +K + +  S+       ++    +E
Sbjct: 75  LHVVVIGGFLEVHANNVTILADAIERAHDIDEARAQKALHQAQSEAQTTGHTERTMLALE 134

Query: 122 QLLVDLSCLRRRI 134
             L  L  +R+R+
Sbjct: 135 VSLARLQVVRQRL 147


>gi|297621355|ref|YP_003709492.1| F-type ATP synthase, subunit epsilon [Waddlia chondrophila WSU
          86-1044]
 gi|297376656|gb|ADI38486.1| F-type ATP synthase, subunit epsilon [Waddlia chondrophila WSU
          86-1044]
          Length = 134

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%)

Query: 15 EKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDI 74
          +K V+ G+  S+ +P  LG   VL  HA ++T ++ G + I+ S +E   + + GGI ++
Sbjct: 10 DKKVYEGKALSLTIPGTLGYFEVLNNHASLMTPLQPGKLAITFSQQEKSVFAISGGIMEM 69

Query: 75 VPSHCTVLSETI 86
            +  T+L +TI
Sbjct: 70 HQNQVTILGDTI 81


>gi|307265809|ref|ZP_07547360.1| ATP synthase F1, epsilon subunit [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919204|gb|EFN49427.1| ATP synthase F1, epsilon subunit [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 137

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 61/130 (46%), Gaps = 12/130 (9%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
            + H E+++P +  + G+V+ +++    G I +L GH P+   + +G + I    +    
Sbjct: 3   KNFHLEVLTPHRKFYEGDVEEIIVTITTGQIGILKGHIPMTAAVGTGTLQIKKDGQWREA 62

Query: 65  YVVIGGICDIVPSHCTVLSETI-LP--MDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           ++  GG  ++     T+LS  +  P  +D A  QA ++R +E            +R + E
Sbjct: 63  FIS-GGFMEVKRDSVTILSSAVEWPEEIDIARAQAAKERAEEKLR--------QKRSKQE 113

Query: 122 QLLVDLSCLR 131
            LL + +  R
Sbjct: 114 HLLAEAALKR 123


>gi|255088485|ref|XP_002506165.1| H+-or Na+-translocating f-type, v-type and A-type ATPase
           superfamily [Micromonas sp. RCC299]
 gi|226521436|gb|ACO67423.1| H+-or Na+-translocating f-type, v-type and A-type ATPase
           superfamily [Micromonas sp. RCC299]
          Length = 214

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 7   LHFELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           L+F +  P +  + G EV S+ LP+  GD+ VL GH P +  ++ G+V +++  +E  +Y
Sbjct: 83  LNFYM--PHEIEYEGAEVDSIQLPAVTGDMGVLPGHVPTVAQLRPGVVAVNMDDKETKKY 140

Query: 66  VVIGGICDIVPSHCT-VLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
            V  G   +  +  T V++   +P++    +A++K + +  + L N  D
Sbjct: 141 FVSSGFAFVHANSVTDVMAVEAVPVEQLDGEAVKKALADYQAKLVNAKD 189


>gi|302392946|ref|YP_003828766.1| ATP synthase F1 subunit epsilon [Acetohalobium arabaticum DSM
          5501]
 gi|302205023|gb|ADL13701.1| ATP synthase F1, epsilon subunit [Acetohalobium arabaticum DSM
          5501]
          Length = 135

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + N +  ++++ E+ V+S EV+ V++P+  G++  L  H+P++T ++ G + I    EEI
Sbjct: 1  MANTVQVDILTSERTVYSDEVEMVIVPTIDGNLGFLPNHSPLITGLQIGQIRIKKDGEEI 60

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
                GG  ++ P    +L++T
Sbjct: 61 E-LATSGGFIEVKPDQINILADT 82


>gi|254250179|ref|ZP_04943499.1| F0F1-type ATP synthase, epsilon subunit [Burkholderia cenocepacia
           PC184]
 gi|124876680|gb|EAY66670.1| F0F1-type ATP synthase, epsilon subunit [Burkholderia cenocepacia
           PC184]
          Length = 143

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 9/122 (7%)

Query: 12  VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEEIHRYVVIGG 70
           +S E  +++G+   VV+P E G++ +   HAP+LT I+ G+VT +     E  R +V GG
Sbjct: 1   MSVEAVLYAGDAHFVVVPGESGELGIYPHHAPLLTRIRPGVVTLVDAPTGEHRRLLVAGG 60

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME-QLLVDLSC 129
           + ++     T++++  L      L  L  R     +D     D  QR+  E +   D + 
Sbjct: 61  VLEVSRDGVTLIADHAL--RTPELDELRAREARHAAD-----DWRQRYAHENRRAFDFAS 113

Query: 130 LR 131
            R
Sbjct: 114 AR 115


>gi|108804473|ref|YP_644410.1| ATP synthase F1 subunit epsilon [Rubrobacter xylanophilus DSM 9941]
 gi|119367777|sp|Q1AVI0|ATPE_RUBXD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|108765716|gb|ABG04598.1| ATP synthase F1, epsilon subunit [Rubrobacter xylanophilus DSM
           9941]
          Length = 146

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           L++PE+ V+ GE   VV     G+I V+V H PV++T+    V I+   EE   Y    G
Sbjct: 12  LITPERVVYDGEADLVVAKIADGEIGVMVDHYPVISTVDFWDVRIT-RGEERRVYATSDG 70

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNIC---DVDQRFQMEQL 123
              +  +   +L E  +P     ++  E RI++   +L  +    D D R   E++
Sbjct: 71  FFKVADNLVQILVEEAVPASEINVEEAEHRIEQAERELGQLPEEEDEDSRRAREEI 126


>gi|149435351|ref|XP_001513376.1| PREDICTED: similar to ATP synthase [Ornithorhynchus anatinus]
          Length = 165

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 2/116 (1%)

Query: 4   VNDLHFELVSPEKCVF-SGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +N + F   SP +  F S  V+ V +P++ G   +L  H P L  ++ G+VT+       
Sbjct: 32  LNQMSFTFASPTQVYFNSANVKQVDVPTQSGAFGILAAHVPTLQVLRPGVVTVHAEDGTA 91

Query: 63  HRYVVIGGICDI-VPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
            +Y V  G   +   S   +L+E  + +D   L   +  +++  S+L+ + D   R
Sbjct: 92  TKYFVSSGSVTVNADSSVQLLAEEAVSLDMLDLAVAKSNLEKANSELSGVSDEAAR 147


>gi|163787221|ref|ZP_02181668.1| ATP synthase F1, epsilon subunit [Flavobacteriales bacterium
          ALC-1]
 gi|159877109|gb|EDP71166.1| ATP synthase F1, epsilon subunit [Flavobacteriales bacterium
          ALC-1]
          Length = 91

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 2/57 (3%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSG--IVTISLSCEE 61
          ++ E+VSPE  +FSGEV SV +P   G+  +L  HAP+++ +K G   VT S++ EE
Sbjct: 1  MYLEIVSPEATLFSGEVDSVAVPGVNGEFEMLKNHAPIVSILKEGHVKVTGSVTLEE 57


>gi|326391020|ref|ZP_08212569.1| ATP synthase F1, epsilon subunit [Thermoanaerobacter ethanolicus JW
           200]
 gi|325992965|gb|EGD51408.1| ATP synthase F1, epsilon subunit [Thermoanaerobacter ethanolicus JW
           200]
          Length = 137

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 61/130 (46%), Gaps = 12/130 (9%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
            + H E+++P +  + G+V+ +++    G I +L GH P+   + +G + I    +    
Sbjct: 3   KNFHLEVLTPHRKFYEGDVEEIIVTITTGQIGILKGHIPLTAAVGTGTLQIKKDGQWREA 62

Query: 65  YVVIGGICDIVPSHCTVLSETI-LP--MDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           ++  GG  ++     T+LS  +  P  +D A  QA ++R +E            +R + E
Sbjct: 63  FIS-GGFMEVKRDSVTILSSAVEWPEEIDIARAQAAKERAEEKLR--------QKRSKQE 113

Query: 122 QLLVDLSCLR 131
            LL + +  R
Sbjct: 114 HLLAEAALKR 123


>gi|256832992|ref|YP_003161719.1| H+transporting two-sector ATPase delta/epsilon subunit [Jonesia
          denitrificans DSM 20603]
 gi|256686523|gb|ACV09416.1| H+transporting two-sector ATPase delta/epsilon subunit [Jonesia
          denitrificans DSM 20603]
          Length = 92

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 40/65 (61%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ ++ V+SG+   V  P+  G+I +L GH+P+L+ + +G V +S +    H++ 
Sbjct: 4  LTVDVVAADRKVWSGDASLVSAPAADGEIGILAGHSPILSALTAGTVRVSANNGVTHKFT 63

Query: 67 VIGGI 71
          V GG 
Sbjct: 64 VSGGF 68


>gi|93007150|ref|YP_581587.1| ATP synthase F1, epsilon subunit [Psychrobacter cryohalolentis K5]
 gi|119367764|sp|Q1Q8A0|ATPE_PSYCK RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|92394828|gb|ABE76103.1| ATP synthase F1, epsilon subunit [Psychrobacter cryohalolentis K5]
          Length = 138

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 16/122 (13%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +VS  + ++SGE+  ++     G+I VL GH P++T +K G + +     E     
Sbjct: 4   LQCRVVSAREELYSGEISMLIATGTEGEIGVLPGHTPLITLLKPGAMRVQTPDGEEEVIY 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           V GG+ ++ P   TVL++T +   N                L+    V+ R + EQ+LV+
Sbjct: 64  VSGGVLEVQPKMVTVLADTAMRAHN----------------LDESKIVEARKKAEQMLVN 107

Query: 127 LS 128
            S
Sbjct: 108 QS 109


>gi|118475189|ref|YP_892658.1| F0F1 ATP synthase subunit epsilon [Campylobacter fetus subsp.
          fetus 82-40]
 gi|166222444|sp|A0RR25|ATPE_CAMFF RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|118414415|gb|ABK82835.1| ATP synthase F1, epsilon subunit [Campylobacter fetus subsp.
          fetus 82-40]
          Length = 129

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          +N +H E+V+PE  +FS + + VVLP   G+  VL GHA +++ +K G+V I  + +  H
Sbjct: 1  MNTIHLEIVTPEGLIFSNDAKMVVLPGSEGEFGVLPGHASLVSLLKIGVVDIE-NVDGTH 59

Query: 64 RYVVI 68
            V I
Sbjct: 60 DAVAI 64


>gi|325285954|ref|YP_004261744.1| ATPase, F1 complex, delta/epsilon subunit [Cellulophaga lytica DSM
           7489]
 gi|324321408|gb|ADY28873.1| ATPase, F1 complex, delta/epsilon subunit [Cellulophaga lytica DSM
           7489]
          Length = 92

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 52/97 (53%), Gaps = 12/97 (12%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI--SLSCEEIHR 64
           ++ E+VSPE  +F+GEV SV +P   GD  +L  HAP+++ ++ G V I  ++S +E   
Sbjct: 1   MYLEIVSPEATLFAGEVVSVTVPGINGDFQMLSNHAPIVSLLQQGTVKIQGNVSIDEAFE 60

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRI 101
                G             ET+LP+++  ++  + ++
Sbjct: 61  GKFSKGSN----------GETVLPINSGTIEMKDNKV 87


>gi|77918558|ref|YP_356373.1| F0F1 ATP synthase subunit epsilon [Pelobacter carbinolicus DSM
           2380]
 gi|119361398|sp|Q3A604|ATPE1_PELCD RecName: Full=ATP synthase epsilon chain 1; AltName: Full=ATP
           synthase F1 sector epsilon subunit 1; AltName:
           Full=F-ATPase epsilon subunit 1
 gi|77544641|gb|ABA88203.1| ATP synthase F1 subcomplex epsilon subunit [Pelobacter carbinolicus
           DSM 2380]
          Length = 138

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 1/129 (0%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   L  E+V+P   V   EV  +  P  LG   VL GH P+LTT++ G  +      ++
Sbjct: 1   MAQKLKLEMVTPAAQVLIEEVDEIAAPGSLGQFGVLPGHTPLLTTLQVGEFSYR-KGSDV 59

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQ 122
           +   V  G  ++      VL ET    D+  L   +  +    + L  +   D+ +   Q
Sbjct: 60  YYLAVNWGYVEVAEDRVLVLVETAETQDHIDLARAKAALGRAEARLRELTPADKEYHNMQ 119

Query: 123 LLVDLSCLR 131
             +  + +R
Sbjct: 120 AALQRAMVR 128


>gi|222823237|ref|YP_002574810.1| ATP synthase F1 sector, epsilon subunit [Campylobacter lari RM2100]
 gi|254809351|sp|B9KES4|ATPE_CAMLR RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|222538458|gb|ACM63559.1| ATP synthase F1 sector, epsilon subunit [Campylobacter lari RM2100]
          Length = 130

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 54/99 (54%), Gaps = 2/99 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  E+++P   ++ G+ + VVLP   G+  VL GHA +++++K+GI+ I  S +  H  V
Sbjct: 5   ISLEIITPLGMIYQGDARLVVLPGSEGEFGVLKGHASLISSLKAGIIDIEKS-DSTHELV 63

Query: 67  VI-GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV 104
            I  G   +  +  +VL++  + +       + KR++E 
Sbjct: 64  AIDSGHAKVSETKVSVLAKGAVWVGGNSDSEIAKRLEEA 102


>gi|15606086|ref|NP_213463.1| ATP synthase F1 epsilon subunit [Aquifex aeolicus VF5]
 gi|14285355|sp|O66903|ATPE_AQUAE RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|2983262|gb|AAC06856.1| ATP synthase F1 epsilon subunit [Aquifex aeolicus VF5]
          Length = 132

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 47/78 (60%), Gaps = 2/78 (2%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VSP+  V+SGEV+SV +P+  G++ +L  H  ++T +K G+V    + ++ +   
Sbjct: 2  IQVEIVSPQGMVYSGEVESVNVPTVEGEVGILENHMYLMTLLKPGLV--YFNGDDKNGIA 59

Query: 67 VIGGICDIVPSHCTVLSE 84
          V  G+ D+ P    +L+E
Sbjct: 60 VTYGVLDVTPQKVLILAE 77


>gi|50083470|ref|YP_044980.1| F0F1 ATP synthase subunit epsilon [Acinetobacter sp. ADP1]
 gi|60389585|sp|Q6FFJ9|ATPE_ACIAD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|49529446|emb|CAG67158.1| membrane-bound ATP synthase , F1 sector, epsilon-subunit
           [Acinetobacter sp. ADP1]
          Length = 139

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 11/120 (9%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVV 67
           ++VS ++ ++SG+V  ++     G++ +L GHAP++T ++ G + + L    EEI    V
Sbjct: 7   DVVSVKESIYSGQVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVQLENGTEEI--VYV 64

Query: 68  IGGICDIVPSHCTVLSETILPMDN----ACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P   TVL++T +  DN    A L+A  K  +++ +  N   D+D    +  L
Sbjct: 65  SGGVLEVQPHVVTVLADTAIRADNLDEAAILEA-RKNAEQLLA--NQKSDLDSAAALASL 121


>gi|283806761|pdb|2RQ7|A Chain A, Solution Structure Of The Epsilon Subunit Chimera
          Combining The N-Terminal Beta-Sandwich Domain From T.
          Elongatus Bp-1 F1 And The C-Terminal Alpha-Helical
          Domain From Spinach Chloroplast F1
          Length = 134

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +   +++P+K V+    + V+LPS  G + +L  HAP+LT +++G++ +    E +    
Sbjct: 3  MTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVA-IA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG  ++  +  T+L
Sbjct: 62 LMGGFAEVENNEVTIL 77


>gi|229819803|ref|YP_002881329.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Beutenbergia cavernae DSM 12333]
 gi|229565716|gb|ACQ79567.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Beutenbergia cavernae DSM 12333]
          Length = 109

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 46/78 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+ E+VS ++ ++SGE  + V+P+  G++ +L GH+PVL  ++ G V I+ S  E   + 
Sbjct: 3  LNVEVVSTDQTLWSGEAVTAVVPAADGEMGILPGHSPVLAVLRQGSVRITPSSGEKVSFD 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          V+GG         TV+ E
Sbjct: 63 VVGGFVSFDHDSLTVVVE 80


>gi|261366299|ref|ZP_05979182.1| ATP synthase F1, epsilon subunit [Subdoligranulum variabile DSM
          15176]
 gi|282571897|gb|EFB77432.1| ATP synthase F1, epsilon subunit [Subdoligranulum variabile DSM
          15176]
          Length = 135

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
             E+++PE+  ++G+V+S+VLP+  G+  VL GH PV+T ++ G           H  +
Sbjct: 5  FQLEIITPERQFYTGQVESLVLPALDGEYGVLPGHEPVVTAVEPGEARFKADG-VWHNVI 63

Query: 67 VIGGICDIVPSHCTVLSET 85
          V  G  +I   +  VL  T
Sbjct: 64 VTQGFAEITSEYAVVLVST 82


>gi|90578411|ref|ZP_01234222.1| hypothetical ATP synthase epsilon chain [Vibrio angustum S14]
 gi|90441497|gb|EAS66677.1| hypothetical ATP synthase epsilon chain [Vibrio angustum S14]
          Length = 147

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
          N     +VS E  +FSG   ++ +    G++ +  GH+P+L+ +K G+ +     ++   
Sbjct: 8  NTFQLNIVSAEGPLFSGPAHALAISGSDGELGIRPGHSPLLSRLKPGVASFVTDLKDPEE 67

Query: 65 YVVI-GGICDIVPSHCTVLSETIL 87
           + I GGI ++ PS  TVL++T +
Sbjct: 68 ILYISGGIVEVQPSVVTVLADTAM 91


>gi|11334|emb|CAA31381.1| Cf1 ATPase epsilon subunit (AA 1-132) [Arabidopsis thaliana]
          Length = 132

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+TI L+ + +    ++GG
Sbjct: 7  VLTPNRIVWDSEVEEIILSTNSGQIGVLANHAPIATAVDIGILTIRLANQWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 66 FARIGNNEITIL 77


>gi|290490110|gb|ADD31462.1| ATP synthase CF1 epsilon subunit protein [Phoradendron serotinum]
          Length = 131

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LH  +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ ++     
Sbjct: 3  LHLCVLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPLATAVDIGILRIHLNDDQWLTMA 62

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  TVL
Sbjct: 63 LMGGFARIGNNDITVL 78


>gi|220905451|ref|YP_002480763.1| ATP synthase F1, epsilon subunit [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869750|gb|ACL50085.1| ATP synthase F1, epsilon subunit [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 134

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+V+P+K V SGEV+  V P   G+  VL  H  +L+ +K+G +       +     
Sbjct: 4   LQLEVVTPDKTVVSGEVEMAVCPGIEGEFGVLPKHVSLLSALKTGGLRYKTPGGKEEYVF 63

Query: 67  VIGGICDIVPSHCTVLSET---ILPMDNACLQALEKRIDEVCSDLNNICDV 114
           + GG  D+     TVL+E+      +D A   A ++R ++  +D     DV
Sbjct: 64  ISGGFADVNNDVLTVLAESAELAQDIDTARAMAAKERAEKRIADHAEQTDV 114


>gi|291286804|ref|YP_003503620.1| ATP synthase F1, epsilon subunit [Denitrovibrio acetiphilus DSM
          12809]
 gi|290883964|gb|ADD67664.1| ATP synthase F1, epsilon subunit [Denitrovibrio acetiphilus DSM
          12809]
          Length = 140

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 47/82 (57%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + +  ELV+PE+ + S +V+ V+ P   GD+ VL  HAP+LT ++ G +   +  +  
Sbjct: 1  MADTIRLELVTPERMILSEDVEEVIAPGVEGDLGVLPEHAPLLTALRVGEMAYRVGKQID 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
          +  +V GG  ++  +   VL++
Sbjct: 61 YIAIVGGGFLEVNNNKVIVLAD 82


>gi|226952189|ref|ZP_03822653.1| membrane-bound ATP synthase, F1 sector, epsilon subunit
           [Acinetobacter sp. ATCC 27244]
 gi|294648872|ref|ZP_06726328.1| ATP synthase F1 sector epsilon subunit [Acinetobacter haemolyticus
           ATCC 19194]
 gi|226837027|gb|EEH69410.1| membrane-bound ATP synthase, F1 sector, epsilon subunit
           [Acinetobacter sp. ATCC 27244]
 gi|292825263|gb|EFF84010.1| ATP synthase F1 sector epsilon subunit [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 139

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 60/119 (50%), Gaps = 20/119 (16%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVV 67
           ++VS  + ++SG V  ++     G++ +L GHAP++T ++ G + + L    EEI    V
Sbjct: 7   DVVSVNESIYSGTVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVQLENGTEEI--VYV 64

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
            GG+ ++ P   TVL++T +  DN                L+    ++ R Q EQLL +
Sbjct: 65  SGGVLEVQPHVVTVLADTAIRADN----------------LDEAAILEARKQAEQLLAN 107


>gi|150005510|ref|YP_001300254.1| ATP synthase epsilon chain [Bacteroides vulgatus ATCC 8482]
 gi|254884059|ref|ZP_05256769.1| ATP synthase subunit epsilon [Bacteroides sp. 4_3_47FAA]
 gi|294778712|ref|ZP_06744131.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides vulgatus PC510]
 gi|319640733|ref|ZP_07995446.1| ATP synthase [Bacteroides sp. 3_1_40A]
 gi|149933934|gb|ABR40632.1| ATP synthase epsilon chain [Bacteroides vulgatus ATCC 8482]
 gi|254836852|gb|EET17161.1| ATP synthase subunit epsilon [Bacteroides sp. 4_3_47FAA]
 gi|294447368|gb|EFG15949.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroides vulgatus PC510]
 gi|317387545|gb|EFV68411.1| ATP synthase [Bacteroides sp. 3_1_40A]
          Length = 84

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 32/47 (68%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSG 51
           DLH  +VSPE  +F G+V+ V LP ELG  +VL  HAP+++++  G
Sbjct: 5  EDLHLIVVSPESTLFDGKVEIVTLPGELGSFSVLYDHAPLISSLIKG 51


>gi|260551345|ref|ZP_05825546.1| predicted protein [Acinetobacter sp. RUH2624]
 gi|260405659|gb|EEW99150.1| predicted protein [Acinetobacter sp. RUH2624]
          Length = 139

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 71/135 (52%), Gaps = 11/135 (8%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVV 67
           ++VS ++ ++SG V  ++     G++ +L GHAP++T ++ G + + L    EEI    V
Sbjct: 7   DVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVLLENGTEEI--VYV 64

Query: 68  IGGICDIVPSHCTVLSETILPMDN----ACLQA---LEKRIDEVCSDLNNICDVDQRFQM 120
            GG+ ++ P   TVL++T +  DN    A L+A    E+ +    SDL++   +    ++
Sbjct: 65  SGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAEQLLANQKSDLDSAAALASLSEI 124

Query: 121 EQLLVDLSCLRRRIQ 135
              L  +  +R R Q
Sbjct: 125 SGQLETIRKIRNRAQ 139


>gi|260061528|ref|YP_003194608.1| ATP synthase F1 subunit epsilon [Robiginitalea biformata
          HTCC2501]
 gi|88785660|gb|EAR16829.1| ATP synthase F1, epsilon subunit [Robiginitalea biformata
          HTCC2501]
          Length = 92

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTIS 56
          +H E+VSPE  +FSGEV SV +P   G+  +L  HAP+++ ++SG V  +
Sbjct: 1  MHLEIVSPEATLFSGEVTSVTVPGINGEFQMLENHAPIVSLLQSGEVRFA 50


>gi|320108420|ref|YP_004184010.1| ATP synthase F1 subunit epsilon [Terriglobus saanensis SP1PR4]
 gi|319926941|gb|ADV84016.1| ATP synthase F1, epsilon subunit [Terriglobus saanensis SP1PR4]
          Length = 143

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 52/114 (45%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   LV+P++ +     +++ LP+  G +  L G AP+L  + +G V +        ++ 
Sbjct: 12  LKIRLVTPDRILIDTTAEAIELPALCGYMEALYGAAPLLAELGAGEVKLHGGASGDAKFF 71

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120
           V  G  +++P   TVL+ET    +       +K ++    D N   D   +++ 
Sbjct: 72  VAWGFVEVLPERVTVLAETAQKPEEIDPTQAQKELESAQKDWNESGDDADKYEY 125


>gi|229915400|gb|ACQ90745.1| CF1 epsilon subunit of ATP synthase [Oocystis solitaria]
          Length = 135

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 9/97 (9%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +++P++  F  + + ++LP+  G I +L  HAP++T +  G++ I  S  E     ++GG
Sbjct: 7   IMTPDRIFFQDQAEEIILPTNTGQIGILKNHAPLITALDIGVLLIR-SKNEWTPLALMGG 65

Query: 71  ICDIVPSHCTVL------SETILPM--DNACLQALEK 99
              +  +  TVL      +ETI P   + A L A EK
Sbjct: 66  FALVKQNQVTVLVNEAESAETIDPQQAEEAFLSAKEK 102


>gi|260943874|ref|XP_002616235.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238849884|gb|EEQ39348.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 160

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 7   LHFELVSPEKCVFS-GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           L   L  P + ++S  EVQ V LPS  GD+ +L  H P++  ++ G++ I     E  +Y
Sbjct: 31  LKLSLALPHQTLYSESEVQQVNLPSVNGDLGILANHIPIVEQLRPGLLEIISKGGETEQY 90

Query: 66  VVIGGICDIVPSHCTVLS 83
            V GGI  + P +   +S
Sbjct: 91  FVSGGIATVQPGNKLTIS 108


>gi|300721113|ref|YP_003710381.1| membrane-bound ATP synthase, F1 sector subunit epsilon [Xenorhabdus
           nematophila ATCC 19061]
 gi|297627598|emb|CBJ88117.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Xenorhabdus nematophila ATCC 19061]
          Length = 140

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 5/124 (4%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VS EK +F G VQ + +    G++ +   H P+LT IK G++ I     E     + GG
Sbjct: 10  VVSAEKLMFEGLVQKIQVTGSEGELGIYPQHTPLLTAIKPGMIRIVKQFGEEEFIYLSGG 69

Query: 71  ICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
           I ++ P+   VL++T +    +D A +   +++ +E     N+  DVD      +L   +
Sbjct: 70  ILEVQPNGVIVLADTAIRGKDLDEAKVLEAKRKAEENIR--NSHGDVDYAQASAELSKAI 127

Query: 128 SCLR 131
           + LR
Sbjct: 128 AKLR 131


>gi|309784442|ref|ZP_07679081.1| ATP synthase F1, epsilon subunit [Shigella dysenteriae 1617]
 gi|308927949|gb|EFP73417.1| ATP synthase F1, epsilon subunit [Shigella dysenteriae 1617]
          Length = 124

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 18  VFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPS 77
           +FSG V+ + +    G++ +  GHAP+LT IK G++ I           + GGI ++ P 
Sbjct: 1   MFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPG 60

Query: 78  HCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLR 131
           + TVL++T +    +D A     +++ +E  S  +   DVD      +L   ++ LR
Sbjct: 61  NVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHG--DVDYAQASAELAKAIAQLR 115


>gi|300697407|ref|YP_003748068.1| ATP synthase epsilon chain (ATP synthase F1 sector subunit
          epsilon) [Ralstonia solanacearum CFBP2957]
 gi|299074131|emb|CBJ53676.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon
          subunit) [Ralstonia solanacearum CFBP2957]
          Length = 139

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 46/79 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ ++ G  + VV+P   G++ +L GH P+LT ++ G V ++L  ++     
Sbjct: 4  LTVDVVTAEERLYQGTAKFVVVPGTEGELGILPGHEPLLTRLRPGTVRLTLENDDEVILF 63

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG   ++P    +L++T
Sbjct: 64 VAGGFAHVLPQEVILLADT 82


>gi|207724525|ref|YP_002254922.1| atp synthase epsilon chain 2 (atp synthase f1 sectorepsilon
          subunit 2) protein [Ralstonia solanacearum MolK2]
 gi|206589747|emb|CAQ36708.1| atp synthase epsilon chain 2 (atp synthase f1 sectorepsilon
          subunit 2) protein [Ralstonia solanacearum MolK2]
          Length = 139

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 46/79 (58%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ ++ G  + VV+P   G++ +L GH P+LT ++ G V ++L  ++     
Sbjct: 4  LTVDVVTAEERLYQGTAKFVVVPGTEGELGILPGHEPLLTRLRPGTVRLTLENDDEVILF 63

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG   ++P    +L++T
Sbjct: 64 VAGGFAHVLPQEVILLADT 82


>gi|303274831|ref|XP_003056730.1| H+-or Na+-translocating f-type, v-type and A-type ATPase
           superfamily [Micromonas pusilla CCMP1545]
 gi|226461082|gb|EEH58375.1| H+-or Na+-translocating f-type, v-type and A-type ATPase
           superfamily [Micromonas pusilla CCMP1545]
          Length = 213

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 21  GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCT 80
            EV  V++P+  GD  VL GH P +  ++ G+V++ L+  E  +Y V  G   +  +  T
Sbjct: 96  AEVDQVMIPATSGDFGVLPGHVPTVAQLRPGVVSVQLNSSETQKYFVSSGFAFVHANSVT 155

Query: 81  -VLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
            +++   +P++     A++K + +  + L N  D
Sbjct: 156 DIMAVEAIPLEQLDDAAVKKGLADFNNKLVNAKD 189


>gi|60117189|ref|YP_209523.1| ATP synthase CF1 epsilon subunit [Huperzia lucidula]
 gi|68052071|sp|Q5SD05|ATPE_HUPLU RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|50659997|gb|AAT80719.1| ATP synthase CF1 epsilon subunit [Huperzia lucidula]
          Length = 138

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ EVQ ++L +  G I VL  HAP+LT +  GI  I L+  +     
Sbjct: 3  LNLRVMTPNRTVWNSEVQEMILSTNSGQIGVLPNHAPLLTALDIGITKIRLNG-QWSTMA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   +  +  T+L
Sbjct: 62 LMGGFAMVDNNQVTIL 77


>gi|297544154|ref|YP_003676456.1| ATP synthase F1 subunit epsilon [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296841929|gb|ADH60445.1| ATP synthase F1, epsilon subunit [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 137

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 12/130 (9%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
            + H E+++P +  + G+V+ +++    G I +L GH P+   I +G + I    +    
Sbjct: 3   KNFHLEVLTPHRKFYEGDVEEIIVTITTGQIGILKGHIPMTAAIGTGTLQIKEDGQWREA 62

Query: 65  YVVIGGICDIVPSHCTVLSETI-LP--MDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           ++  GG  ++     T+LS  +  P  +D A  QA ++R +E            +R + E
Sbjct: 63  FIS-GGFMEVKRDSVTILSSAVEWPEEIDIARAQAAKERAEEKLR--------QRRSKHE 113

Query: 122 QLLVDLSCLR 131
            LL + +  R
Sbjct: 114 HLLAEAALKR 123


>gi|62318464|dbj|BAD94440.1| epsilon subunit of F1F0-ATP synthase [Acidithiobacillus
          ferrooxidans]
          Length = 141

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +VS E  +++G    VV P E+G++ +L  HAP+LT ++ G + I    E  + +V  GG
Sbjct: 9  VVSVEGSIYAGVADMVVAPGEMGELGILPRHAPLLTGLRPGELRIIHGAETEYLFVN-GG 67

Query: 71 ICDIVPSHCTVLSET 85
          I +I P   TVL+++
Sbjct: 68 ILEIQPDMVTVLADS 82


>gi|225012363|ref|ZP_03702799.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Flavobacteria bacterium MS024-2A]
 gi|225003340|gb|EEG41314.1| H+transporting two-sector ATPase delta/epsilon subunit
          [Flavobacteria bacterium MS024-2A]
          Length = 91

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 33/49 (67%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          ++ E+VSPE  +FSGEV+S+ +P   G   VL  HAP+++T+  G V I
Sbjct: 1  MYLEIVSPEVKLFSGEVESLTVPGASGSFQVLNNHAPIVSTLTKGQVKI 49


>gi|220932615|ref|YP_002509523.1| ATP synthase F1, epsilon subunit [Halothermothrix orenii H 168]
 gi|254809368|sp|B8CZ09|ATPE_HALOH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|219993925|gb|ACL70528.1| ATP synthase F1, epsilon subunit [Halothermothrix orenii H 168]
          Length = 134

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 55/103 (53%), Gaps = 8/103 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  E+V+PEK VFS  V  ++ P+  G+I +L  H P++T +K+G++ +    EE+ +  
Sbjct: 5   IRLEVVTPEKVVFSEPVNILIAPAIDGEIGILPKHTPLVTGLKTGVMRVKKDGEEV-KIS 63

Query: 67  VIGGICDIVPSHCTVLSETI-LPMD------NACLQALEKRID 102
           +  G  ++ P    V+  T  LP +         L+  EKR++
Sbjct: 64  ISEGFMEVKPDEINVIVRTAELPHEIDVERARDALKRAEKRLN 106


>gi|299771941|ref|YP_003733967.1| F0F1 ATP synthase subunit epsilon [Acinetobacter sp. DR1]
 gi|298702029|gb|ADI92594.1| F0F1 ATP synthase subunit epsilon [Acinetobacter sp. DR1]
          Length = 139

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 71/135 (52%), Gaps = 11/135 (8%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVV 67
           ++VS ++ ++SG V  ++     G++ +L GHAP++T ++ G + + L    EEI    V
Sbjct: 7   DVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVQLENGTEEI--VYV 64

Query: 68  IGGICDIVPSHCTVLSETILPMDN----ACLQA---LEKRIDEVCSDLNNICDVDQRFQM 120
            GG+ ++ P   TVL++T +  DN    A L+A    E+ +    SDL++   +    ++
Sbjct: 65  SGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAEQLLANQKSDLDSAAALASLSEI 124

Query: 121 EQLLVDLSCLRRRIQ 135
              L  +  ++ R Q
Sbjct: 125 SGQLETIRKIKNRAQ 139


>gi|1653172|dbj|BAA18088.1| ATP synthase e subunit [Synechocystis sp. PCC 6803]
          Length = 165

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K V+  EVQ ++LPS  G + +L  HAP+LT ++ G++ +    ++     
Sbjct: 32  LTVRVITPDKVVWDEEVQELILPSTTGQLGILSNHAPLLTALEIGVMRVR-PGKDWQNIA 90

Query: 67  VIGGICDIVPSHCTVL 82
           V+GG  ++  +   VL
Sbjct: 91  VMGGFAEVENNEVKVL 106


>gi|229816335|ref|ZP_04446642.1| hypothetical protein COLINT_03385 [Collinsella intestinalis DSM
           13280]
 gi|229808091|gb|EEP43886.1| hypothetical protein COLINT_03385 [Collinsella intestinalis DSM
           13280]
          Length = 134

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 53/117 (45%), Gaps = 2/117 (1%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   +   +V PE+CV+ G V  V +PS +G+  +L  HA  + TI  G + +S +   +
Sbjct: 1   MAKPMQLRIVCPEECVYEGAVAYVAVPSTVGEFGILPHHASEICTIDGGHIRVSETKMGV 60

Query: 63  --HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
             H + V  G   +      VL+E  +  +   +  +  R+      L N+ + D R
Sbjct: 61  VDHVFAVTDGYVQVANDEVIVLAERAIDTEKVDVDEVNARLAGFEDQLGNMAEGDAR 117


>gi|149235065|ref|XP_001523411.1| ATP synthase delta chain, mitochondrial precursor [Lodderomyces
           elongisporus NRRL YB-4239]
 gi|146452820|gb|EDK47076.1| ATP synthase delta chain, mitochondrial precursor [Lodderomyces
           elongisporus NRRL YB-4239]
          Length = 160

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 7   LHFELVSPEKCVFSGE-VQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           L   L  P + ++S + VQ V LPS  GD+ +L  H PV+  ++ G++ + L   E  +Y
Sbjct: 31  LKLSLALPYQTLYSDQDVQQVNLPSVNGDLGILANHIPVVEQLRPGLLEVILKNGESEQY 90

Query: 66  VVIGGICDIVPSHCTVLS--ETILPMD 90
            V GG+  + P +   +S  E   P D
Sbjct: 91  FVSGGLAMVQPGNKLTISAIEAFKPED 117


>gi|291333934|gb|ADD93613.1| ATP synthase F1 epsilon subunit [uncultured marine bacterium
          MedDCM-OCT-S04-C40]
          Length = 137

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 9/95 (9%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + + L  E+V+PE  V+S +V SV LP   G++ +   HAP++  +K+G +      EE 
Sbjct: 1  MASTLKLEIVTPEAKVYSEDVDSVRLPGAEGELGIFPNHAPLMAQVKAGELIARKGGEET 60

Query: 63 HRYVVIG-GICDIVPSHCTVLSETILPMDNACLQA 96
             + +G G  +I   H  +L+      DNA   A
Sbjct: 61 --ILAVGHGFVEITGDHVAILT------DNAADSA 87


>gi|146411981|ref|XP_001481962.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 161

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 7   LHFELVSPEKCVFS-GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           L   L  P + ++S  EVQ V LPS  GD+ +L  H P++  ++ G++ I     E  +Y
Sbjct: 32  LKLSLALPHQTLYSESEVQQVNLPSINGDLGILANHIPIVEQLRPGLLEIISKGGETEQY 91

Query: 66  VVIGGICDIVPSHCTVLS 83
            V GGI  + P +   +S
Sbjct: 92  FVSGGIATVQPGNKLTIS 109


>gi|54301817|ref|YP_131810.1| ATP synthase subunit epsilon [Photobacterium profundum SS9]
 gi|81697236|sp|Q6LKZ5|ATPE2_PHOPR RecName: Full=ATP synthase epsilon chain 2; AltName: Full=ATP
          synthase F1 sector epsilon subunit 2; AltName:
          Full=F-ATPase epsilon subunit 2
 gi|46915237|emb|CAG22010.1| hypothetical gi|26250475|gnl|REF_E.coli|c4657 ATP synthase
          epsilon chain [Photobacterium profundum SS9]
          Length = 147

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
          N     +VS E  +FSG+  ++ +    G++ +  GH+P+L+ IK G+       +    
Sbjct: 8  NTFQLNIVSAEGPLFSGKAHALAISGLDGELGIRPGHSPLLSRIKPGVAYFQTDLKGDDE 67

Query: 65 YVVI-GGICDIVPSHCTVLSETIL 87
           + I GGI ++ PS  TVL++T +
Sbjct: 68 ILYISGGILEVQPSLVTVLADTAM 91


>gi|289577865|ref|YP_003476492.1| ATP synthase F1 subunit epsilon [Thermoanaerobacter italicus Ab9]
 gi|289527578|gb|ADD01930.1| ATP synthase F1, epsilon subunit [Thermoanaerobacter italicus Ab9]
          Length = 137

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 12/130 (9%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
            + H E+++P +  + G+V+ +++    G I +L GH P+   I +G + I    +    
Sbjct: 3   KNFHLEVLTPHRKFYEGDVEEIIVTITTGQIGILKGHIPMTAAIGTGTLQIREDGQWREA 62

Query: 65  YVVIGGICDIVPSHCTVLSETI-LP--MDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           ++  GG  ++     T+LS  +  P  +D A  QA ++R +E            +R + E
Sbjct: 63  FIS-GGFMEVKRDSVTILSSAVEWPEEIDIARAQAAKERAEEKLR--------QRRSKHE 113

Query: 122 QLLVDLSCLR 131
            LL + +  R
Sbjct: 114 HLLAEAALKR 123


>gi|30468213|ref|NP_849100.1| ATP synthase CF1 epsilon subunit [Cyanidioschyzon merolae strain
           10D]
 gi|60389772|sp|Q85FT3|ATPE_CYAME RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|30409313|dbj|BAC76262.1| ATP synthase CF1 epsilon chain [Cyanidioschyzon merolae strain 10D]
          Length = 131

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 61/129 (47%), Gaps = 4/129 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++++P+  V+  E++ V+LPS  G + +L  HAP+LT +  G++  + + +     V
Sbjct: 1   MKMKIITPDGYVWDREIEEVILPSSTGQLGILAHHAPLLTALDIGVMR-AKTAQGWVALV 59

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           + GG  +++ +  T+L           LQ  ++   +    L        + +  Q   +
Sbjct: 60  LFGGFAEVLNNQITILVNGAQEAHEIDLQHAQQEEAKALEQLQQAATPTAQIEARQ---N 116

Query: 127 LSCLRRRIQ 135
           L+  R R+Q
Sbjct: 117 LAKWRARVQ 125


>gi|288939811|ref|YP_003442051.1| ATP synthase F1 subunit epsilon [Allochromatium vinosum DSM 180]
 gi|288895183|gb|ADC61019.1| ATP synthase F1, epsilon subunit [Allochromatium vinosum DSM 180]
          Length = 141

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 52/103 (50%), Gaps = 3/103 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E  + SG+   V   +E+G++ +   H   ++ ++ G V +     E   + 
Sbjct: 5   VHVDIVSAEGAIHSGQAAMVYATAEMGEVGIAPRHTAFISRLRPGDVRVENEQGEQEHFY 64

Query: 67  VIGGICDIVPSHCTVLSETILP---MDNACLQALEKRIDEVCS 106
           V GG+ ++ P   TVL++T +    +D A     ++R ++  S
Sbjct: 65  VSGGMLEVQPHKVTVLADTAIRARDLDEAAALEAKRRAEDALS 107


>gi|172040397|ref|YP_001800111.1| F0F1 ATP synthase subunit epsilon [Corynebacterium urealyticum DSM
           7109]
 gi|226740239|sp|B1VFY8|ATPE_CORU7 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|171851701|emb|CAQ04677.1| ATP synthase epsilon chain [Corynebacterium urealyticum DSM 7109]
          Length = 124

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 1/103 (0%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTT-IKSGIVTISLSCEEIHR 64
           ++  ELV+ EK ++SG   +V+  +  G+I VL GH P+L   +++G+V I  +  E   
Sbjct: 3   EIAAELVAVEKALWSGTATAVIAETTEGEIGVLPGHEPLLGQLVENGVVIIRTTEGEKLV 62

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSD 107
             V GG   +     TVL+++ +  D       E R+ E  S+
Sbjct: 63  AAVQGGFLSVSSKKITVLADSAVWADEVDQADAEARVREASSE 105


>gi|298530315|ref|ZP_07017717.1| ATP synthase F1, epsilon subunit [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509689|gb|EFI33593.1| ATP synthase F1, epsilon subunit [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 142

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 15/127 (11%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + N +  E+V+P++ + S +V+ V  P   G+  VL  H P LT +  G +      +E 
Sbjct: 1   MANLIRLEIVTPDRNLLSEDVEYVGAPGVSGEFGVLHNHTPFLTALSIGSL---FYKKEG 57

Query: 63  HRYVVI--GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120
            +Y V   GG  ++ P+  ++L+E     D   ++   K  +            +QR Q 
Sbjct: 58  RKYFVFVSGGFTEVTPTKVSILAEVAEKADEISIERARKAKER----------AEQRLQQ 107

Query: 121 EQLLVDL 127
           E+  +D 
Sbjct: 108 EKEQIDY 114


>gi|190349051|gb|EDK41627.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 161

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 7   LHFELVSPEKCVFS-GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           L   L  P + ++S  EVQ V LPS  GD+ +L  H P++  ++ G++ I     E  +Y
Sbjct: 32  LKLSLALPHQTLYSESEVQQVNLPSINGDLGILANHIPIVEQLRPGLLEIISKGGETEQY 91

Query: 66  VVIGGICDIVPSHCTVLS 83
            V GGI  + P +   +S
Sbjct: 92  FVSGGIATVQPGNKLTIS 109


>gi|11466708|ref|NP_039304.1| ATP synthase CF1 epsilon subunit [Marchantia polymorpha]
 gi|114600|sp|P06285|ATPE_MARPO RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|11678|emb|CAA28090.1| atpE [Marchantia polymorpha]
          Length = 135

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ ++Q ++L +  G I +L  HA VLT +  GIV I L+ ++     
Sbjct: 2  LNLRIMAPNRIVWNSDIQEIILSTNSGQIGILPNHASVLTALDIGIVKIRLN-DQWSTMA 60

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  ++ T+L
Sbjct: 61 LMGGFAMIDNNNLTIL 76


>gi|91201499|emb|CAJ74559.1| similar to ATP synthase subunit epsilon [Candidatus Kuenenia
          stuttgartiensis]
          Length = 134

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +      E+++P K VF G V+++      G   +L+ HAP +T +++ I+TI    +  
Sbjct: 1  MTKTFDLEIITPMKTVFKGLVKNITAMGTQGSFGILIDHAPFITELQTSILTIKDEKDST 60

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
            + V GG  ++V +   VL+++
Sbjct: 61 VSFAVDGGFFEMVANKAIVLADS 83


>gi|261838459|gb|ACX98225.1| ATP synthase F1 epsilon chain [Helicobacter pylori 51]
          Length = 123

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 7/107 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H  +
Sbjct: 4   LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEHIAI 63

Query: 67  VIGGI------CDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSD 107
             G         DI+      + + +   D+A  +A +K +++  SD
Sbjct: 64  NWGYAEVTKEQVDILADGAVFIKKGLDDRDDAISRA-KKLLEDASSD 109


>gi|108563494|ref|YP_627810.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori HPAG1]
 gi|119367736|sp|Q1CSD6|ATPE_HELPH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|107837267|gb|ABF85136.1| ATP synthase F1, subunit epsilon [Helicobacter pylori HPAG1]
          Length = 123

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G+V I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVVEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 63 INWGYAEVTKERVDILAD 80


>gi|90409884|ref|ZP_01217901.1| hypothetical ATP synthase epsilon chain [Photobacterium profundum
          3TCK]
 gi|90329237|gb|EAS45494.1| hypothetical ATP synthase epsilon chain [Photobacterium profundum
          3TCK]
          Length = 147

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
          N     +VS E  +FSG+  ++ +    G++ +  GH+P+L+ IK G+       +    
Sbjct: 8  NTFQLNIVSAEGPLFSGKAHALAISGLDGELGIRPGHSPLLSRIKPGVAYFQTDLKGDDE 67

Query: 65 YVVI-GGICDIVPSHCTVLSETIL 87
           + I GGI ++ PS  TVL++T +
Sbjct: 68 ILYISGGIVEVQPSLVTVLADTAM 91


>gi|302341730|ref|YP_003806259.1| ATP synthase F1, subunit epsilon [Desulfarculus baarsii DSM 2075]
 gi|301638343|gb|ADK83665.1| ATP synthase F1, epsilon subunit [Desulfarculus baarsii DSM 2075]
          Length = 137

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + N +  E+V+P+K + S EV++VV     G+  VL GH P L T+  G +         
Sbjct: 1  MANKILLEVVTPDKLLLSKEVEAVVATGVDGEFGVLYGHVPFLATLDIGELRFRDGAHTD 60

Query: 63 HRYVVIGGICDIVPSHCTVLSET 85
          +   + GG  ++  S  TVL+E 
Sbjct: 61 Y-AAIAGGFAEVTGSKVTVLAEA 82


>gi|87301229|ref|ZP_01084070.1| ATP synthase subunit epsilon [Synechococcus sp. WH 5701]
 gi|87284197|gb|EAQ76150.1| ATP synthase subunit epsilon [Synechococcus sp. WH 5701]
          Length = 135

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P++ VF G    V+LPS  G + +L GH  +LT +  G++ +  S ++     
Sbjct: 3  LNLRVLAPDQSVFDGTADEVILPSTSGQVGILTGHVSMLTALDVGVMRLR-SGKDWTSIA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG  ++  +  TVL
Sbjct: 62 LMGGFAEVEANEVTVL 77


>gi|71030354|ref|XP_764819.1| ATP synthase F1 subunit delta [Theileria parva strain Muguga]
 gi|68351775|gb|EAN32536.1| ATP synthase F1, delta subunit, putative [Theileria parva]
          Length = 164

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 5  NDLHFELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEEI 62
           DL F L+S  + +++   V+S+ +P   G  TV  GH+P+L+T+K G+V+ SL    E+
Sbjct: 18 KDLVFSLLSSHEALYNKVPVKSLTVPGYDGYFTVTPGHSPMLSTLKPGVVSFSLKDSNEV 77

Query: 63 HRYVVIGGI 71
          H++ +  G 
Sbjct: 78 HKFFISSGF 86


>gi|261378160|ref|ZP_05982733.1| ATP synthase F1, epsilon subunit [Neisseria cinerea ATCC 14685]
 gi|269145623|gb|EEZ72041.1| ATP synthase F1, epsilon subunit [Neisseria cinerea ATCC 14685]
          Length = 140

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|121635589|ref|YP_975834.1| F0F1 ATP synthase subunit epsilon [Neisseria meningitidis FAM18]
 gi|254804252|ref|YP_003082473.1| ATP synthase epsilon chain [Neisseria meningitidis alpha14]
 gi|166222478|sp|A1KW10|ATPE_NEIMF RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|120867295|emb|CAM11066.1| ATP synthase epsilon chain [Neisseria meningitidis FAM18]
 gi|254667794|emb|CBA03756.1| ATP synthase epsilon chain [Neisseria meningitidis alpha14]
 gi|254672594|emb|CBA06290.1| ATP synthase epsilon chain [Neisseria meningitidis alpha275]
 gi|325131656|gb|EGC54362.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis M6190]
 gi|325133394|gb|EGC56058.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis M13399]
 gi|325137519|gb|EGC60102.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis ES14902]
 gi|325143644|gb|EGC65963.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis
          M01-240013]
 gi|325206840|gb|ADZ02293.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis
          M04-240196]
          Length = 140

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|124302912|ref|YP_001023707.1| ATP synthase CF1 epsilon subunit [Angiopteris evecta]
 gi|110628310|gb|ABG79606.1| ATP synthase CF1 epsilon subunit [Angiopteris evecta]
          Length = 136

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ EVQ ++L +  G I +L  HAP+LT +  G++ I     +     
Sbjct: 3  LNLRVMAPNRIVWNSEVQEIILSTNSGQIGILPNHAPLLTALDIGVIRIRRDG-QWSTMA 61

Query: 67 VIGGICDIVPSHCTVL---SETILPMD 90
          ++GG   I  +  T+L   +ET   +D
Sbjct: 62 LMGGFATIENNQMTILVNEAETATEID 88


>gi|325204885|gb|ADZ00339.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis
          M01-240355]
          Length = 137

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 1  MQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 60

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 61 AVSGGVLEVQPDKVTVLAD 79


>gi|325269433|ref|ZP_08136050.1| ATP synthase F1 sector epsilon subunit [Prevotella multiformis
          DSM 16608]
 gi|324988354|gb|EGC20320.1| ATP synthase F1 sector epsilon subunit [Prevotella multiformis
          DSM 16608]
          Length = 79

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSPE+ VF+GEV+SV++P  +G   +L  HAP+++T+  G V  S+   +     
Sbjct: 2  LTLKIVSPERIVFTGEVESVLVPGTVGQFEILNDHAPIISTLVEGKVVYSVKGTK-KELQ 60

Query: 67 VIGGICDI 74
          + GG  ++
Sbjct: 61 IAGGFVEV 68


>gi|254483173|ref|ZP_05096406.1| ATP synthase F1, epsilon subunit [marine gamma proteobacterium
          HTCC2148]
 gi|214036544|gb|EEB77218.1| ATP synthase F1, epsilon subunit [marine gamma proteobacterium
          HTCC2148]
          Length = 142

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E+ +FSG V+ +V     G++ V  GHAP+LT +  G V +     +   Y 
Sbjct: 5  IHCDIVSAEEEIFSGLVEMLVATGGEGELGVSYGHAPLLTALVPGPVRVVTQAGDEEVYY 64

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG  ++ P   ++L++T +
Sbjct: 65 VSGGFLEVQPGVVSILADTAI 85


>gi|290473115|ref|YP_003465976.1| membrane-bound ATP synthase, F1 sector subunit epsilon [Xenorhabdus
           bovienii SS-2004]
 gi|289172409|emb|CBJ79176.1| membrane-bound ATP synthase, F1 sector, epsilon-subunit
           [Xenorhabdus bovienii SS-2004]
          Length = 140

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 60/122 (49%), Gaps = 1/122 (0%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VS EK +F G VQ + +    G++ +   H P+LT IK G++ I     E     + GG
Sbjct: 10  VVSAEKRLFEGLVQKIQVTGSEGELGIYPQHTPLLTAIKPGMIRIVKQFGEEEFIYLSGG 69

Query: 71  ICDIVPSHCTVLSET-ILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSC 129
           + ++ P+   VL++T I   D    +ALE + +      N+  DVD      +L   ++ 
Sbjct: 70  VLEVQPNGVIVLADTAIRGKDLDEAKALEAKREAEEHVRNSHGDVDYAQASAELSKAIAK 129

Query: 130 LR 131
           LR
Sbjct: 130 LR 131


>gi|257454339|ref|ZP_05619602.1| ATP synthase F1, epsilon subunit [Enhydrobacter aerosaccus SK60]
 gi|257448242|gb|EEV23222.1| ATP synthase F1, epsilon subunit [Enhydrobacter aerosaccus SK60]
          Length = 138

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 55/108 (50%), Gaps = 5/108 (4%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +VS ++ ++SGE+  ++     G++ +L GH P +T +K G + I  S        V GG
Sbjct: 8   VVSAKETIYSGEISMLIATGVEGEVGILPGHIPFITLLKPGTMQIKTSNGNDEMVYVSGG 67

Query: 71  ICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
           + ++ P   TVL++T +    +D A +  LE R     S  N   D+D
Sbjct: 68  VLEVQPHLVTVLADTAVRANDLDEAKI--LEARRHAEQSLQNQKADID 113


>gi|87121038|ref|ZP_01076929.1| ATP synthase F1, epsilon subunit [Marinomonas sp. MED121]
 gi|86163530|gb|EAQ64804.1| ATP synthase F1, epsilon subunit [Marinomonas sp. MED121]
          Length = 138

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS E+ +FSG V+++V     GD+ +  GHAP+LT +  G V +     E     
Sbjct: 5   VHCDIVSAEQEIFSGSVETLVAAGSFGDLGIKPGHAPLLTPLLPGPVRVVKQNGEEEIIF 64

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
           V GG  ++ P   TVL++T +    +D A     +K  +E+ +  N+  D+D      QL
Sbjct: 65  VSGGFLEVQPHRVTVLADTAIRAHDLDEAAALEAKKHAEELLNQQNS--DIDFSRATAQL 122

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 123 AEAVARLR 130


>gi|240143396|ref|ZP_04741997.1| ATP synthase F1, epsilon subunit [Roseburia intestinalis L1-82]
 gi|257204665|gb|EEV02950.1| ATP synthase F1, epsilon subunit [Roseburia intestinalis L1-82]
 gi|291537139|emb|CBL10251.1| ATP synthase F1 subcomplex epsilon subunit [Roseburia intestinalis
           M50/1]
 gi|291540379|emb|CBL13490.1| ATP synthase F1 subcomplex epsilon subunit [Roseburia intestinalis
           XB6B4]
          Length = 136

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 60/126 (47%), Gaps = 4/126 (3%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           E+++P++  ++GE   +   +  G+I V   H P+ T +  GIV I  + E+     V  
Sbjct: 11  EIITPDRVFYTGEGDMIEFTTASGEIGVYKKHIPLTTVLAPGIVKIHKTGEDDVIAAVHS 70

Query: 70  GICDIVPSHCTVLSETI-LP--MDNACLQALEKRIDEVCSDLNNICDVDQ-RFQMEQLLV 125
           G  +I+P   T+L+E    P  +D    +A  +R +E  +      DV +  F + + LV
Sbjct: 71  GFAEILPDKVTLLAEIAEWPNEIDKNRAEAARQRAEERLAHRTEAIDVKRAEFALRKALV 130

Query: 126 DLSCLR 131
            +   +
Sbjct: 131 RIDIAK 136


>gi|313204900|ref|YP_004043557.1| ATPase, f1 complex, delta/epsilon subunit [Paludibacter
          propionicigenes WB4]
 gi|312444216|gb|ADQ80572.1| ATPase, F1 complex, delta/epsilon subunit [Paludibacter
          propionicigenes WB4]
          Length = 81

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+++PE+  FSGEV SV LP  +G  TV   HAP+++++  G ++  +  + +    
Sbjct: 1  MKLEIITPEQIFFSGEVTSVTLPGTIGLFTVWENHAPLISSLAKGKLSYEID-KNVTELS 59

Query: 67 VIGGICDIVPSHCTV 81
          V GG  +I  +  TV
Sbjct: 60 VDGGFAEISKNVVTV 74


>gi|284992514|ref|YP_003411068.1| ATP synthase F1 subunit epsilon [Geodermatophilus obscurus DSM
          43160]
 gi|284065759|gb|ADB76697.1| ATP synthase F1, epsilon subunit [Geodermatophilus obscurus DSM
          43160]
          Length = 129

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTI-KSGIVTISLSCEEIHRY 65
          LH ELV+ E+ ++SGE   VV  +  G++ VL GHAP+L  + + GIVT+     E    
Sbjct: 4  LHVELVAVERMIWSGEASMVVARTTEGELGVLPGHAPLLGQLAEGGIVTVRTVEGEDLVV 63

Query: 66 VVIGGICDIVPSHCTVLSET 85
             GG   +     ++L+ET
Sbjct: 64 AAHGGFLSVTDRGVSILAET 83


>gi|187926644|ref|YP_001892989.1| ATP synthase F1, epsilon subunit [Ralstonia pickettii 12J]
 gi|241666156|ref|YP_002984515.1| F0F1 ATP synthase subunit epsilon [Ralstonia pickettii 12D]
 gi|309782787|ref|ZP_07677508.1| ATP synthase F1, epsilon subunit [Ralstonia sp. 5_7_47FAA]
 gi|187728398|gb|ACD29562.1| ATP synthase F1, epsilon subunit [Ralstonia pickettii 12J]
 gi|240868183|gb|ACS65843.1| ATP synthase F1, epsilon subunit [Ralstonia pickettii 12D]
 gi|308918565|gb|EFP64241.1| ATP synthase F1, epsilon subunit [Ralstonia sp. 5_7_47FAA]
          Length = 139

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+ E+ ++ G  + VV+P   G++ +L GH  +LT ++ G V ++    E     
Sbjct: 4  LKVDVVTAEERLYEGNAKFVVIPGTEGELGILPGHERLLTRMRPGSVRVTQENNEEVILF 63

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  D+ P    VL++T
Sbjct: 64 VAGGFVDVQPEQVIVLADT 82


>gi|157163910|ref|YP_001466346.1| F0F1 ATP synthase subunit epsilon [Campylobacter concisus 13826]
 gi|166222442|sp|A7ZC38|ATPE_CAMC1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|112800106|gb|EAT97450.1| ATP synthase F1, epsilon subunit [Campylobacter concisus 13826]
          Length = 129

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 9/114 (7%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           ++ LH E+V+P+  +F+ +V SVVLP   G+  VL  HA +++ +K+GI+ I    ++ H
Sbjct: 1   MDKLHLEIVTPQGQIFNDDVSSVVLPGSEGEFGVLPNHASLISLLKAGIIDIEDKHKK-H 59

Query: 64  RYVVIG-GICDIVPSHCTVLSETILPMDN-------ACLQALEKRIDEVCSDLN 109
             V I  G   I      +L++  + +           L+A    I+ + SD N
Sbjct: 60  DVVAINWGYAKIDEGKVVILADGAVYVSGNSESELANSLEAARNLIESMSSDTN 113


>gi|197124863|ref|YP_002136814.1| F0F1 ATP synthase subunit epsilon [Anaeromyxobacter sp. K]
 gi|226740219|sp|B4UKE9|ATPE_ANASK RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|196174712|gb|ACG75685.1| ATP synthase F1, epsilon subunit [Anaeromyxobacter sp. K]
          Length = 132

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 1/115 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++V+PEK V S +V  V  P   G   V + H P +T ++ G +T      E H Y 
Sbjct: 3   LTLDIVTPEKRVLSVQVDEVRAPGVQGGFGVRLNHEPFMTALEPGRLTYVEGGRE-HHYA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           V GG   +  +   VL++T        +    K  ++  + L  + + D+  Q E
Sbjct: 62  VGGGFLQVADNRVIVLADTAEAAGEIDVDRARKAFEDAQNRLLQLTEQDESHQAE 116


>gi|262281305|ref|ZP_06059086.1| predicted protein [Acinetobacter calcoaceticus RUH2202]
 gi|262257131|gb|EEY75868.1| predicted protein [Acinetobacter calcoaceticus RUH2202]
          Length = 139

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 11/120 (9%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVV 67
           ++VS ++ ++SG V  ++     G++ +L GHAP++T ++ G + + L    EEI    V
Sbjct: 7   DVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVQLENGTEEI--VYV 64

Query: 68  IGGICDIVPSHCTVLSETILPMDN----ACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            GG+ ++ P   TVL++T +  DN    A L+A  K  +++ +  N   D+D    +  L
Sbjct: 65  SGGVLEVQPHVVTVLADTAIRADNLDEAAILEA-RKNAEQLLA--NQKSDLDSAAALASL 121


>gi|108796671|ref|YP_636545.1| ATP synthase CF1 epsilon subunit [Zygnema circumcarinatum]
 gi|122226720|sp|Q32RI1|ATPE_ZYGCR RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|61393655|gb|AAX45797.1| CF1 epsilon subunit of ATP synthase [Zygnema circumcarinatum]
          Length = 133

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ E Q ++L S  G I +L  HAP+LT +  G++ + +  +      
Sbjct: 3  LNLRVMAPNRTVWTSEAQEIILSSNSGQIGILPNHAPLLTALDIGVMKVRIDSKWTA-VA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  T+L
Sbjct: 62 LMGGFAQIENNQMTIL 77


>gi|317182384|dbj|BAJ60168.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori F57]
          Length = 123

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGQVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 63 INWGYAEVTKERVDILAD 80


>gi|91217250|ref|ZP_01254211.1| ATP synthase F1, epsilon subunit [Psychroflexus torquis ATCC
          700755]
 gi|91184593|gb|EAS70975.1| ATP synthase F1, epsilon subunit [Psychroflexus torquis ATCC
          700755]
          Length = 91

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS 58
          +H E+VSPE+ + SGEV++V +P   G+  +L  HAPV++ +K+G + +  S
Sbjct: 1  MHLEIVSPEQIILSGEVKTVSVPGINGEFQMLDNHAPVVSVLKNGSIKLDSS 52


>gi|148975565|ref|ZP_01812436.1| hypothetical ATP synthase epsilon chain [Vibrionales bacterium
           SWAT-3]
 gi|145964993|gb|EDK30244.1| hypothetical ATP synthase epsilon chain [Vibrionales bacterium
           SWAT-3]
          Length = 147

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 2/120 (1%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGI-VTISLSCEEIH 63
           N     +VS E  +FSG   ++ +    G++ +  GH+P+L+ IK G+ V ++    E  
Sbjct: 8   NTFQLNIVSAEGTLFSGPAYALAVSGADGELGIRPGHSPLLSKIKPGVTVFVTDPKTEDE 67

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
              V GG+ ++ P   TVL++T L   +      E+       ++N   +VD  F   QL
Sbjct: 68  VLYVSGGMIEVQPDVVTVLADTALHAKDIDRARAEEAKHAALENINK-GNVDVNFAQAQL 126


>gi|261400611|ref|ZP_05986736.1| ATP synthase F1, epsilon subunit [Neisseria lactamica ATCC 23970]
 gi|269209697|gb|EEZ76152.1| ATP synthase F1, epsilon subunit [Neisseria lactamica ATCC 23970]
          Length = 140

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQNIYSGEAGFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|188997464|ref|YP_001931715.1| ATP synthase F1, epsilon subunit [Sulfurihydrogenibium sp. YO3AOP1]
 gi|226740297|sp|B2V688|ATPE_SULSY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|188932531|gb|ACD67161.1| ATP synthase F1, epsilon subunit [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 134

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%)

Query: 8   HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
             ++V+P   VFSG+V   V+ +  G+I +L  H  +LT I  G + I  +  E+  + V
Sbjct: 3   RLDVVTPTGSVFSGDVYQTVITTADGEIGILENHMLLLTNITPGKLRIEKADGEVKEFAV 62

Query: 68  IGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
             G+ D+       L E +  +D   +   ++ ++E    L N
Sbjct: 63  TYGVLDVRGDKVIALVEEVFELDEINVDNEKQLLEEANQKLQN 105


>gi|332702728|ref|ZP_08422816.1| ATP synthase epsilon chain [Desulfovibrio africanus str. Walvis
          Bay]
 gi|332552877|gb|EGJ49921.1| ATP synthase epsilon chain [Desulfovibrio africanus str. Walvis
          Bay]
          Length = 142

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          + N +  E+V+P++ V S +V  V  P  +G+  VL  H P L+ +  G +   L   + 
Sbjct: 1  MSNQIQLEIVTPDRKVLSEKVDYVGAPGIVGEFGVLPNHIPFLSALGIGNLYYKLGG-KT 59

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
          H   + GG  ++ P   TVL+E
Sbjct: 60 HYVFIAGGFAEVGPDRVTVLAE 81


>gi|254779682|ref|YP_003057788.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori B38]
 gi|254001594|emb|CAX29659.1| ATP synthase F1, subunit epsilon (ATP synthase F1 sector epsilon
          subunit) [Helicobacter pylori B38]
          Length = 124

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G+V I    ++ H   
Sbjct: 5  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVVEIETENQKEH-IA 63

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 64 INWGYAEVTNERVDILAD 81


>gi|317177881|dbj|BAJ55670.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori F16]
          Length = 123

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 62/115 (53%), Gaps = 9/115 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4   LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 62

Query: 67  VIGGICDIVPSHCTVLSETILPM-------DNACLQALEKRIDEVCSDLNNICDV 114
           +  G  ++      +L++  + +       D+A  +A +K +++  SD+  +  V
Sbjct: 63  INWGYAEVTKERVDILADGAVFIKKGSDDRDDAISRA-KKLLEDASSDMLAVSSV 116


>gi|33241041|ref|NP_875983.1| F0F1 ATP synthase subunit epsilon [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|60389732|sp|Q7VA75|ATPE_PROMA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|33238570|gb|AAQ00636.1| ATP synthase epsilon subunit [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 136

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 6/110 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P+K VF   V+ V+LPS  G + +L GH  ++T I  G++ +  S        
Sbjct: 3   LTLRVLAPDKSVFDDTVEEVILPSTTGLLGILPGHISMVTAIDIGVLKLRSSNGNWDSIA 62

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICD 113
           ++GG  ++     TVL   +E    +D A     EK  ++  + LN + D
Sbjct: 63  LMGGFAEVESDDVTVLVNAAELGKSIDKAT---AEKEFEQAKAALNKLED 109


>gi|296313937|ref|ZP_06863878.1| ATP synthase F1, epsilon subunit [Neisseria polysaccharea ATCC
          43768]
 gi|313669151|ref|YP_004049435.1| ATP synthase epsilon chain [Neisseria lactamica ST-640]
 gi|296839475|gb|EFH23413.1| ATP synthase F1, epsilon subunit [Neisseria polysaccharea ATCC
          43768]
 gi|313006613|emb|CBN88079.1| ATP synthase epsilon chain [Neisseria lactamica 020-06]
          Length = 140

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQNIYSGEAGFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|291543825|emb|CBL16934.1| ATP synthase, F1 epsilon subunit (delta in mitochondria)
           [Ruminococcus sp. 18P13]
          Length = 134

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 4/116 (3%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
            ++V+PEK  F G  + VVL +  GD+ +L  H P + ++ SG V I++   +  RY  +
Sbjct: 6   LKIVTPEKIFFDGSAERVVLRTSEGDLCILARHEPFVASLPSGPVRITVDGAD--RYAAL 63

Query: 69  G-GICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
             G+  +     T+L+  I   ++  L A  KR ++   D  N    D   +  +L
Sbjct: 64  STGVVQVEKEGTTILACAIEWAEDIDL-AWAKRSEQQAIDRKNKAKSDAELRRAEL 118


>gi|302558367|ref|ZP_07310709.1| ATP synthase F1, epsilon subunit [Streptomyces griseoflavus Tu4000]
 gi|302475985|gb|EFL39078.1| ATP synthase F1, epsilon subunit [Streptomyces griseoflavus Tu4000]
          Length = 125

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH  LV+ ++ V+SGE   VV  +  GDI V+ GH P+L  ++SG VTI       
Sbjct: 1   MAAELHVALVAADREVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRTREGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRI 101
               V GG         ++L+E     D   +Q+ E+ +
Sbjct: 61  VVAAVHGGFISFADDKLSLLAEIAELSDEIDVQSAEQEL 99


>gi|461577|sp|Q05375|ATPE_SYNP1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|480500|pir||S36973 H+-transporting two-sector ATPase (EC 3.6.3.14) epsilon chain -
           Synechococcus sp
 gi|49228|emb|CAA49883.1| ATP synthase (epsilon) [Synechococcus sp.]
          Length = 138

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +++P+K V+    + V+LPS  G + +L  HAP+LT +++G++ +    E +    ++GG
Sbjct: 7   VIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQEREWVA-IALMGG 65

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDE 103
             ++  +  TVL       D   L+  ++   E
Sbjct: 66  FAEVENNEVTVLVNAAERGDTIDLETAKREFSE 98


>gi|240013281|ref|ZP_04720194.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae DGI18]
 gi|240120353|ref|ZP_04733315.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae PID24-1]
          Length = 140

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   +V+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQKIYSGEATFIVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GGI ++ P   TVL++
Sbjct: 64 AVSGGILEVQPDKVTVLAD 82


>gi|217032682|ref|ZP_03438168.1| hypothetical protein HPB128_202g16 [Helicobacter pylori B128]
 gi|298735866|ref|YP_003728391.1| F-type H+-transporting ATPase epsilon chain [Helicobacter pylori
          B8]
 gi|308183235|ref|YP_003927362.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori PeCan4]
 gi|308184871|ref|YP_003929004.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori SJM180]
 gi|216945612|gb|EEC24263.1| hypothetical protein HPB128_202g16 [Helicobacter pylori B128]
 gi|298355055|emb|CBI65927.1| F-type H+-transporting ATPase epsilon chain [Helicobacter pylori
          B8]
 gi|308060791|gb|ADO02687.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori SJM180]
 gi|308065420|gb|ADO07312.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori PeCan4]
 gi|317012908|gb|ADU83516.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori
          Lithuania75]
          Length = 123

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G+V I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVVEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 63 INWGYAEVTNERVDILAD 80


>gi|160872784|ref|ZP_02062916.1| ATP synthase F1, epsilon subunit [Rickettsiella grylli]
 gi|159121583|gb|EDP46921.1| ATP synthase F1, epsilon subunit [Rickettsiella grylli]
          Length = 143

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 69/139 (49%), Gaps = 7/139 (5%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           ++  +  E+VS E  +FSGE   ++    LG++ +  GH  +LT +K G V I     E 
Sbjct: 1   MMKTMQIEIVSAEVEIFSGEATHIIAVGLLGELGIYPGHTQLLTALKPGSVRIVKPEGED 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDN----ACLQA---LEKRIDEVCSDLNNICDVD 115
               + GGI ++ P   ++L++T +   +    A L+A    EK +++  SD++      
Sbjct: 61  EILYISGGILEVQPQMVSILADTAIRAADLDELAVLEAKEHAEKILNDKQSDIDYAKATA 120

Query: 116 QRFQMEQLLVDLSCLRRRI 134
           +  Q    L  +S L++++
Sbjct: 121 ELAQAVAQLQVISKLKKKL 139


>gi|134102715|ref|YP_001108376.1| F0F1 ATP synthase subunit epsilon [Saccharopolyspora erythraea NRRL
           2338]
 gi|291007828|ref|ZP_06565801.1| F0F1 ATP synthase subunit epsilon [Saccharopolyspora erythraea NRRL
           2338]
 gi|166222492|sp|A4FN26|ATPE_SACEN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|133915338|emb|CAM05451.1| ATP synthase epsilon chain [Saccharopolyspora erythraea NRRL 2338]
          Length = 121

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 4/102 (3%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTT-IKSGIVTISLSCEEIHR 64
           ++  +LV+ E+ ++SGE  +VV  +  G+I +L GH PVL   ++ G+V I+   +E   
Sbjct: 3   NMSVQLVAVERRLWSGEATAVVAQTTEGEIGILSGHEPVLGQLVEGGVVKITTPEKETVT 62

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDN-ACLQALE--KRIDE 103
             V GG   +     +VL+E+    D     QA E  KR DE
Sbjct: 63  AAVHGGFLSVTADGVSVLAESAELADEIDVAQAREDVKRGDE 104


>gi|123969173|ref|YP_001010031.1| F0F1 ATP synthase subunit epsilon [Prochlorococcus marinus str.
           AS9601]
 gi|166222486|sp|A2BT13|ATPE_PROMS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|123199283|gb|ABM70924.1| ATP synthase, Epsilon subunit [Prochlorococcus marinus str. AS9601]
          Length = 134

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 62/129 (48%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++++P K V+ GE + V+LPS  G + +L GH  ++T I  G++ + ++  +     
Sbjct: 3   ISLKVLAPNKNVYQGEAEEVILPSTTGQLGILPGHISLVTAIDIGVLRLRMNS-QWKSIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  +I      VL           +Q  E+ + E    ++   + ++  +  + L +
Sbjct: 62  LMGGFAEIESDEVIVLVNNAEIGSEINVQNAEQDLKEAKLAISKFSENEKNPEKIKALKE 121

Query: 127 LSCLRRRIQ 135
           +S    RIQ
Sbjct: 122 ISKAEARIQ 130


>gi|300866627|ref|ZP_07111315.1| ATP synthase epsilon chain [Oscillatoria sp. PCC 6506]
 gi|300335399|emb|CBN56475.1| ATP synthase epsilon chain [Oscillatoria sp. PCC 6506]
          Length = 135

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++P++ V+      V+LPS  G + +L GHAP+LT + +G++ +      +    
Sbjct: 3  LKVRVIAPDRTVWDSSADEVILPSTTGQLGILSGHAPLLTALDTGVMRVRPGKNWVA-IA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG  ++  +  T+L
Sbjct: 62 LMGGFAEVEENEVTIL 77


>gi|242310683|ref|ZP_04809838.1| H/-transporting two-sector ATPase [Helicobacter pullorum MIT
          98-5489]
 gi|239523081|gb|EEQ62947.1| H/-transporting two-sector ATPase [Helicobacter pullorum MIT
          98-5489]
          Length = 130

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++V+PE  +FS +V+SV LP   G+  VL GH  ++TT+ SG++ I     +     
Sbjct: 4  LKLDIVTPEGKIFSNDVKSVTLPGSEGEFGVLPGHIGIVTTLNSGVIEIEKKDGKREIVA 63

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G   +  +   VL+E
Sbjct: 64 INWGYAKVDETSVDVLAE 81


>gi|254443043|ref|ZP_05056519.1| ATP synthase F1, epsilon subunit [Verrucomicrobiae bacterium
           DG1235]
 gi|198257351|gb|EDY81659.1| ATP synthase F1, epsilon subunit [Verrucomicrobiae bacterium
           DG1235]
          Length = 134

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 63/127 (49%), Gaps = 2/127 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+V+P   V+   V+SVV+P+  G++ ++ GH P+LT I+ G + ++     +    
Sbjct: 3   LQLEIVTPHGKVYDETVESVVMPTTSGEVGIMTGHIPLLTEIQPGDIAVTKEG-GVDHLA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDV-DQRFQMEQLLV 125
           V  G    +    ++L+E  +  D+  +  +E  +    S L N  ++ ++   M +  V
Sbjct: 62  VSKGFAQCIGDKVSILAENAISEDDIDVNEVEAAMLRAQSALKNAKEMSEEEINMLETTV 121

Query: 126 DLSCLRR 132
             + +++
Sbjct: 122 QYASIQQ 128


>gi|326332920|ref|ZP_08199177.1| ATP synthase F1, epsilon subunit [Nocardioidaceae bacterium
           Broad-1]
 gi|325949278|gb|EGD41361.1| ATP synthase F1, epsilon subunit [Nocardioidaceae bacterium
           Broad-1]
          Length = 130

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           + + L  ELV+ ++ V+SG    V+  +  GD+ +L GHAPVL+ +   +V I  + EE 
Sbjct: 1   MTDALQVELVAADRVVWSGGATMVIARTVDGDVGILRGHAPVLSALTEAVVEI--TPEEG 58

Query: 63  HRYV--VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQ 119
              +  V GG   +     ++LSE +L      L   +  ++E    L    D ++R +
Sbjct: 59  TEVIATVDGGFLSVANDRVSILSEHVLLAHEIDLNKAQVELEEARRLLGTNNDAEKRIR 117


>gi|293611146|ref|ZP_06693444.1| H+-transporting two-sector ATPase [Acinetobacter sp. SH024]
 gi|292826397|gb|EFF84764.1| H+-transporting two-sector ATPase [Acinetobacter sp. SH024]
 gi|325124142|gb|ADY83665.1| membrane-bound ATP synthase , F1 sector, epsilon-subunit
          [Acinetobacter calcoaceticus PHEA-2]
          Length = 139

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 4/84 (4%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVV 67
          ++VS ++ ++SG V  ++     G++ +L GHAP++T ++ G + + L    EEI    V
Sbjct: 7  DVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVQLENGTEEI--VYV 64

Query: 68 IGGICDIVPSHCTVLSETILPMDN 91
           GG+ ++ P   TVL++T +  DN
Sbjct: 65 SGGVLEVQPHVVTVLADTAIRADN 88


>gi|208435028|ref|YP_002266694.1| ATP synthase F1, subunit epsilon [Helicobacter pylori G27]
 gi|226740262|sp|B5Z8C9|ATPE_HELPG RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|208432957|gb|ACI27828.1| ATP synthase F1, subunit epsilon [Helicobacter pylori G27]
          Length = 123

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 63 INWGYAEVTKERVDILAD 80


>gi|325201428|gb|ADY96882.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis
          M01-240149]
          Length = 137

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 1  MQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 60

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   T+L++
Sbjct: 61 AVSGGVLEVQPDKVTILAD 79


>gi|325107764|ref|YP_004268832.1| ATP synthase epsilon chain [Planctomyces brasiliensis DSM 5305]
 gi|324968032|gb|ADY58810.1| ATP synthase epsilon chain [Planctomyces brasiliensis DSM 5305]
          Length = 135

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 2/115 (1%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           M   N L   +V+PE  + S     V  P E G I VL   AP++  + +G + ++ +  
Sbjct: 1   MIAANSLQLTVVTPETTLLSETALQVQFPLEDGQIGVLPNRAPLVGRMGTGELLVTTASG 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVD 115
           +   Y V GG   +     T+L+   L +DN     ++K+ +E  S    I D D
Sbjct: 61  KTS-YFVDGGFAQVKGDTVTLLTNDALKLDNIKRDDIQKQYEEASS-RKAITDTD 113


>gi|297157184|gb|ADI06896.1| F0F1 ATP synthase subunit epsilon [Streptomyces bingchenggensis
           BCW-1]
          Length = 125

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH E+V+ ++ V+SG+   V+  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVEMVAADRSVWSGKATLVIARTTSGDIGVMPGHQPLLGVLESGPVTIRTSEGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCS 106
               V GG         ++L+E     D   ++  E+ ++   S
Sbjct: 61  VIAAVHGGFISFSDDKLSLLAEIAELSDEIDVKRAERALERAKS 104


>gi|15612124|ref|NP_223776.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori J99]
 gi|210135290|ref|YP_002301729.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori P12]
 gi|9910639|sp|Q9ZK82|ATPE_HELPJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226740261|sp|B6JMX1|ATPE_HELP2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|4155650|gb|AAD06638.1| ATP synthase F1, subunit epsilon [Helicobacter pylori J99]
 gi|210133258|gb|ACJ08249.1| ATP synthase F1 subunit epsilon [Helicobacter pylori P12]
          Length = 123

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (64%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G+V I    ++ H
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVVEIETENQKEH 60


>gi|260911874|ref|ZP_05918440.1| ATP synthase [Prevotella sp. oral taxon 472 str. F0295]
 gi|260633990|gb|EEX52114.1| ATP synthase [Prevotella sp. oral taxon 472 str. F0295]
          Length = 80

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +VSPEK ++ G+ QSV +P  LG+  +L  HAP+++++  G V       E    V
Sbjct: 2  LKLIIVSPEKQLYQGDAQSVKVPGSLGEFEILDNHAPIISSLDVGKVVYVTGNGERQECV 61

Query: 67 VIGGICDI 74
          ++GG  ++
Sbjct: 62 IVGGFVEV 69


>gi|323148836|ref|YP_004221929.1| ATP synthase CF1 epsilon subunit [Erodium carvifolium]
 gi|316926300|gb|ADU58153.1| ATP synthase CF1 epsilon subunit [Erodium carvifolium]
          Length = 133

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P++ ++  EV+ ++L ++ G+I VL  H P++T +  GI+ I L+ ++     
Sbjct: 3  LNLRVLTPKRILWDSEVKEIILSTDSGEIGVLPNHIPIVTGLDIGILKIRLN-DQWFTMA 61

Query: 67 VIGGICDIVPSHCTVLS 83
          ++GG   IV +  TV +
Sbjct: 62 LMGGFARIVNNEITVFA 78


>gi|308390031|gb|ADO32351.1| ATP synthase epsilon chain [Neisseria meningitidis alpha710]
 gi|325129471|gb|EGC52301.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis
          OX99.30304]
          Length = 140

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   T+L++
Sbjct: 64 AVSGGVLEVQPDKVTILAD 82


>gi|197132368|gb|ACH47702.1| ATP synthase CF1 epsilon subunit [Pelargonium cotyledonis]
          Length = 133

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + ++  EV+ ++LP+  G I VL  HA + TT+  GI+ I L+ ++    V++GG
Sbjct: 7  VLTPNRILWDSEVKEIILPTNSGQIGVLPNHASIATTLDIGILKIRLN-DQWFTIVLMGG 65

Query: 71 ICDIVPSHCTVLS 83
             I  +  TVL+
Sbjct: 66 FARIGNNEITVLA 78


>gi|84385784|ref|ZP_00988814.1| hypothetical ATP synthase epsilon chain [Vibrio splendidus 12B01]
 gi|86145155|ref|ZP_01063486.1| hypothetical ATP synthase epsilon chain protein [Vibrio sp. MED222]
 gi|84379100|gb|EAP95953.1| hypothetical ATP synthase epsilon chain [Vibrio splendidus 12B01]
 gi|85836732|gb|EAQ54852.1| hypothetical ATP synthase epsilon chain protein [Vibrio sp. MED222]
          Length = 147

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 2/120 (1%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGI-VTISLSCEEIH 63
           N     +VS E  +FSG   ++ +    G++ +  GH+P+L+ IK G+ V ++    E  
Sbjct: 8   NTFQLNIVSAEGTLFSGPAYALAVSGADGELGIRPGHSPLLSKIKPGVTVFVTDPKSEGQ 67

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
              V GG+ ++ P   TVL++T L   +      E+       ++N   +VD  F   QL
Sbjct: 68  VLYVSGGMLEVQPDVVTVLADTALHGQDIDRARAEEAKYAALENINK-GNVDINFAQAQL 126


>gi|317009743|gb|ADU80323.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori India7]
          Length = 123

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 63 INWGYAEVTKERVDILAD 80


>gi|11467385|ref|NP_043242.1| ATP synthase CF1 epsilon subunit [Cyanophora paradoxa]
 gi|1352037|sp|P48083|ATPE_CYAPA RecName: Full=ATP synthase epsilon chain, cyanelle; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|1016186|gb|AAA81273.1| epsilon subunit of the F1 portion of ATP synthase [Cyanophora
           paradoxa]
          Length = 132

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 57/118 (48%), Gaps = 1/118 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   +++P K +++   + V+LPS+ G + +L  HAP+ T + +G++ I          V
Sbjct: 3   LDVRVIAPNKVIWAKNAEEVILPSQSGMLGILTSHAPLYTALNTGVMKIRNET-GWTSIV 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
           V+GG  ++  +   VL      +D   L A +K +++     N+     ++ +  + L
Sbjct: 62  VMGGFVEVEKNEVLVLVNAGEYVDEIDLSAAKKDVEKALETFNSAEAPKEKEEAAEFL 119


>gi|307637800|gb|ADN80250.1| ATP synthase epsilon chain [Helicobacter pylori 908]
 gi|317014517|gb|ADU81953.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori
          Gambia94/24]
 gi|325996398|gb|ADZ51803.1| ATP synthase epsilon chain [Helicobacter pylori 2018]
 gi|325997986|gb|ADZ50194.1| ATP synthase epsilon subunit [Helicobacter pylori 2017]
          Length = 123

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (64%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G+V I    ++ H
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNLITLLQAGVVEIETENQKEH 60


>gi|78777599|ref|YP_393914.1| F0F1 ATP synthase subunit epsilon [Sulfurimonas denitrificans DSM
           1251]
 gi|119367807|sp|Q30QQ2|ATPE_SULDN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|78498139|gb|ABB44679.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Sulfurimonas denitrificans DSM 1251]
          Length = 130

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 55/107 (51%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  E+++P   +++GE  SV LP E G+  VL  H+ ++T +++G++ I    + +   +
Sbjct: 4   LKLEILTPNGVIYNGEALSVTLPGEEGEFGVLAEHSSLITLLEAGVIDIEKEDKSVESVL 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
           +  G+ ++      VL E  + +      A+ K +++    + +I D
Sbjct: 64  INWGVVEVDEKKVIVLVEGAVAIRGDSESAVAKALNDAKELIESIKD 110


>gi|153007331|ref|YP_001381656.1| F0F1 ATP synthase subunit epsilon [Anaeromyxobacter sp. Fw109-5]
 gi|166222430|sp|A7HIX6|ATPE_ANADF RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|152030904|gb|ABS28672.1| ATP synthase F1, epsilon subunit [Anaeromyxobacter sp. Fw109-5]
          Length = 132

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 53/125 (42%), Gaps = 1/125 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++V+PE+ V S  V  V  P   G   + V H P +T ++ G +T      E H Y 
Sbjct: 3   LTLDIVTPERRVLSVTVDEVRAPGAAGGFGIRVNHEPFMTALEPGRLTYVEGGRE-HHYA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           + GG   +  +   VL++T     +  ++  ++   +    L  + + D+    E   V 
Sbjct: 62  IGGGFLQVAENRVIVLADTAEAAGDIDVERAKRAFQDAQDRLLRMTEQDEHHPAESARVK 121

Query: 127 LSCLR 131
            +  R
Sbjct: 122 RAAAR 126


>gi|148654680|ref|YP_001274885.1| F0F1 ATP synthase subunit epsilon [Roseiflexus sp. RS-1]
 gi|254809380|sp|A5UQN2|ATPE_ROSS1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|148566790|gb|ABQ88935.1| ATP synthase F1, epsilon subunit [Roseiflexus sp. RS-1]
          Length = 139

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 48/82 (58%), Gaps = 7/82 (8%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSG---IVTISLSCEEIH 63
          +H E+V+ E+ V S +V  +  P++ G + +L  HAP+LT ++ G   IV   ++     
Sbjct: 3  IHLEIVTAERVVLSDDVDMINAPTKDGRVGILPRHAPLLTILEVGELDIVKDGVTTP--- 59

Query: 64 RYVVIGGICDIVPSHCTVLSET 85
           + + GG  +++P+  T+L++T
Sbjct: 60 -FAISGGFMEVLPNRVTILADT 80


>gi|59802448|ref|YP_209160.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae FA 1090]
 gi|239998100|ref|ZP_04718024.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae 35/02]
 gi|240015729|ref|ZP_04722269.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae FA6140]
 gi|240079863|ref|ZP_04724406.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae FA19]
 gi|240114818|ref|ZP_04728880.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae PID18]
 gi|240117020|ref|ZP_04731082.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae PID1]
 gi|240124845|ref|ZP_04737731.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae
          SK-92-679]
 gi|240127360|ref|ZP_04740021.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae
          SK-93-1035]
 gi|254492882|ref|ZP_05106053.1| predicted protein [Neisseria gonorrhoeae 1291]
 gi|268593952|ref|ZP_06128119.1| predicted protein [Neisseria gonorrhoeae 35/02]
 gi|268596008|ref|ZP_06130175.1| predicted protein [Neisseria gonorrhoeae FA19]
 gi|268600474|ref|ZP_06134641.1| predicted protein [Neisseria gonorrhoeae PID18]
 gi|268602706|ref|ZP_06136873.1| predicted protein [Neisseria gonorrhoeae PID1]
 gi|268683426|ref|ZP_06150288.1| predicted protein [Neisseria gonorrhoeae SK-92-679]
 gi|268685733|ref|ZP_06152595.1| predicted protein [Neisseria gonorrhoeae SK-93-1035]
 gi|293397824|ref|ZP_06642030.1| ATP synthase F1, epsilon subunit [Neisseria gonorrhoeae F62]
 gi|75507264|sp|Q5F4Y9|ATPE_NEIG1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|59719343|gb|AAW90748.1| putative ATP synthase epsilon chain [Neisseria gonorrhoeae FA
          1090]
 gi|226511922|gb|EEH61267.1| predicted protein [Neisseria gonorrhoeae 1291]
 gi|268547341|gb|EEZ42759.1| predicted protein [Neisseria gonorrhoeae 35/02]
 gi|268549796|gb|EEZ44815.1| predicted protein [Neisseria gonorrhoeae FA19]
 gi|268584605|gb|EEZ49281.1| predicted protein [Neisseria gonorrhoeae PID18]
 gi|268586837|gb|EEZ51513.1| predicted protein [Neisseria gonorrhoeae PID1]
 gi|268623710|gb|EEZ56110.1| predicted protein [Neisseria gonorrhoeae SK-92-679]
 gi|268626017|gb|EEZ58417.1| predicted protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291611770|gb|EFF40839.1| ATP synthase F1, epsilon subunit [Neisseria gonorrhoeae F62]
          Length = 140

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   +V+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSGEQKIYSGEATFIVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GGI ++ P   TVL++
Sbjct: 64 AVSGGILEVQPDKVTVLAD 82


>gi|188527914|ref|YP_001910601.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori Shi470]
 gi|226740263|sp|B2UUN9|ATPE_HELPS RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|188144154|gb|ACD48571.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori Shi470]
 gi|308062407|gb|ADO04295.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori Cuz20]
 gi|308063916|gb|ADO05803.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori Sat464]
 gi|315587019|gb|ADU41400.1| ATP synthase F1 sector epsilon subunit [Helicobacter pylori 35A]
 gi|317178567|dbj|BAJ56355.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori F30]
 gi|332673929|gb|AEE70746.1| ATP synthase F1 sector epsilon subunit [Helicobacter pylori 83]
          Length = 123

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 63 INWGYAEVTKERVDILAD 80


>gi|326797426|ref|YP_004315246.1| ATP synthase epsilon chain [Marinomonas mediterranea MMB-1]
 gi|326548190|gb|ADZ93410.1| ATP synthase epsilon chain [Marinomonas mediterranea MMB-1]
          Length = 139

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +VS  + +FSG+V+ +VL  + G++ V  GHAP+LTT+  G   +     E     + GG
Sbjct: 9  IVSLHETLFSGQVRYLVLTGDYGELGVHAGHAPLLTTLPPGPARLMKENGEEEILFLSGG 68

Query: 71 ICDIVPSHCTVLSE 84
            ++ P    VL++
Sbjct: 69 FLEVQPDQAIVLAD 82


>gi|332184760|gb|AEE27014.1| ATP synthase epsilon chain [Francisella cf. novicida 3523]
          Length = 145

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSP   VF GE   V L    G++ +  GH  +L+T+ +G+V I    E      
Sbjct: 6  LKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNIR-KDEHTDVLY 64

Query: 67 VIGGICDIVPSHCTVL 82
          V GGI ++ P+  T++
Sbjct: 65 VSGGIVEVTPTRVTIM 80


>gi|28261723|ref|NP_783238.1| ATP synthase CF1 epsilon subunit [Atropa belladonna]
 gi|68052217|sp|Q8S8W9|ATPE_ATRBE RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|20068337|emb|CAC88050.1| ATPase epsilon subunit [Atropa belladonna]
          Length = 133

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V+  EV+ +VL +  G I +L  HAP+ T +  GI+ I L+ + +    
Sbjct: 3  LNLSVLTPNRIVWDSEVEEIVLSTNSGQIGILSNHAPIATAVDIGILRIRLNDQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  TVL
Sbjct: 62 LMGGFARIGNNEITVL 77


>gi|57101494|ref|XP_533962.1| PREDICTED: similar to ATP synthase delta chain, mitochondrial
           precursor isoform 1 [Canis familiaris]
 gi|73987345|ref|XP_868608.1| PREDICTED: similar to ATP synthase delta chain, mitochondrial
           precursor isoform 2 [Canis familiaris]
          Length = 168

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 56/119 (47%), Gaps = 2/119 (1%)

Query: 5   NDLHFELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
             + F   SP +  F+G  V+ V +P++ G   +L  H P L  ++ G+V +      I 
Sbjct: 36  GQMSFTFASPTQVFFNGANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTIS 95

Query: 64  RYVVIGGICDI-VPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           +Y V  G   +   S   +L+E  + +D   + A +  +++  S+L+   D   R +++
Sbjct: 96  KYFVSSGSVTVNADSSVQLLAEEAVTLDMLDVGAAKMNLEKAQSELSGAADEASRAEIQ 154


>gi|224418196|ref|ZP_03656202.1| F0F1 ATP synthase subunit epsilon [Helicobacter canadensis MIT
          98-5491]
 gi|253827523|ref|ZP_04870408.1| ATP synthase subunit epsilon [Helicobacter canadensis MIT
          98-5491]
 gi|313141731|ref|ZP_07803924.1| H/-transporting two-sector ATPase [Helicobacter canadensis MIT
          98-5491]
 gi|253510929|gb|EES89588.1| ATP synthase subunit epsilon [Helicobacter canadensis MIT
          98-5491]
 gi|313130762|gb|EFR48379.1| H/-transporting two-sector ATPase [Helicobacter canadensis MIT
          98-5491]
          Length = 130

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          L  ++V+PE  +FS  V+SV LP   G+  VL GH  ++TT+ SG++ I
Sbjct: 4  LKLDIVTPEGKIFSNNVKSVTLPGSEGEFGVLPGHVGIVTTLDSGVIEI 52


>gi|126696967|ref|YP_001091853.1| F0F1 ATP synthase subunit epsilon [Prochlorococcus marinus str. MIT
           9301]
 gi|166222482|sp|A3PES7|ATPE_PROM0 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|126544010|gb|ABO18252.1| ATP synthase, Epsilon subunit [Prochlorococcus marinus str. MIT
           9301]
          Length = 134

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 62/129 (48%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++++P K V+ GE + V+LPS  G + +L GH  ++T I  G++ + ++  +     
Sbjct: 3   ISLKVLAPNKNVYQGEAEEVILPSTTGQLGILPGHISLVTAIDIGVLRVRINS-QWKSIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  +I      VL           +Q  E+ + E    ++   + ++  +  + L +
Sbjct: 62  LMGGFAEIESDEVIVLVNNAEIGSEINVQNAEQDLKEAKLAISKFSENEKNPEKIKALKE 121

Query: 127 LSCLRRRIQ 135
           +S    RIQ
Sbjct: 122 VSKAEARIQ 130


>gi|255067773|ref|ZP_05319628.1| ATP synthase F1, epsilon subunit [Neisseria sicca ATCC 29256]
 gi|261364178|ref|ZP_05977061.1| ATP synthase F1, epsilon subunit [Neisseria mucosa ATCC 25996]
 gi|255047984|gb|EET43448.1| ATP synthase F1, epsilon subunit [Neisseria sicca ATCC 29256]
 gi|288567785|gb|EFC89345.1| ATP synthase F1, epsilon subunit [Neisseria mucosa ATCC 25996]
          Length = 141

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E     V
Sbjct: 4  MRVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEAEEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P+  TVL++
Sbjct: 64 AVSGGVLEVQPNQLTVLAD 82


>gi|15645745|ref|NP_207922.1| F0F1 ATP synthase subunit epsilon [Helicobacter pylori 26695]
 gi|2314282|gb|AAD08173.1| ATP synthase F1, subunit epsilon (atpC) [Helicobacter pylori
          26695]
          Length = 124

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 5  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 63

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 64 INWGYAEVTNERVDILAD 81


>gi|153951408|ref|YP_001397362.1| F0F1 ATP synthase subunit epsilon [Campylobacter jejuni subsp.
          doylei 269.97]
 gi|166222446|sp|A7H1I2|ATPE_CAMJD RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|152938854|gb|ABS43595.1| ATP synthase F1, epsilon subunit [Campylobacter jejuni subsp.
          doylei 269.97]
          Length = 129

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 32/47 (68%)

Query: 9  FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
           E+V+P   ++ GEV+SV LP   G+  VL GHA ++ ++KSG++ I
Sbjct: 7  LEIVTPLGMIYQGEVKSVTLPGSEGEFGVLRGHASLVASLKSGVIDI 53


>gi|166362834|ref|YP_001655107.1| F0F1 ATP synthase subunit epsilon [Microcystis aeruginosa NIES-843]
 gi|226740267|sp|B0JFM8|ATPE_MICAN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166085207|dbj|BAF99914.1| ATP synthase F1 sector epsilon subunit [Microcystis aeruginosa
           NIES-843]
          Length = 138

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 7/128 (5%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +++P++ V+    + V+LPS  G + +L GHAP+LT +  G++ I    ++     V+GG
Sbjct: 7   VITPDRIVWDNVAEEVILPSSTGQLGILSGHAPLLTALNIGVMRIR-PGKDWENIAVLGG 65

Query: 71  ICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDL 127
             ++  +   VL   +E    +D    +A  +R     + L+ +   D R +  Q     
Sbjct: 66  FAEVENNEIKVLVNGAELGSKIDKEKARAEYER---AQTRLDEVSKGDDRRKTIQAQQSW 122

Query: 128 SCLRRRIQ 135
              R R Q
Sbjct: 123 RKARARYQ 130


>gi|18860317|ref|NP_569635.1| ATP synthase CF1 epsilon subunit [Psilotum nudum]
 gi|22653658|sp|Q8WI12|ATPE_PSINU RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|18389470|dbj|BAB84222.1| ATP synthase epsilon subunit [Psilotum nudum]
          Length = 133

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V++ EV+ ++L +  G + +L  HAP+LT +  G++ I +  E      
Sbjct: 2  LNLRVIAPNRIVWNSEVREIILSTNNGQMGILPNHAPLLTALDIGVMKIRID-ERWSNMA 60

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  T+L
Sbjct: 61 LMGGFATIDNNQITIL 76


>gi|163753473|ref|ZP_02160597.1| H+-transporting two-sector ATPase, epsilon subunit [Kordia
          algicida OT-1]
 gi|161327205|gb|EDP98530.1| H+-transporting two-sector ATPase, epsilon subunit [Kordia
          algicida OT-1]
          Length = 97

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 6/67 (8%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI------SLSCE 60
          ++ E+VSPE  +FS EV SV +P   G+  +L  HAP+++ +K G+V I       L  +
Sbjct: 1  MYLEIVSPEATLFSSEVDSVTVPGINGEFQMLNNHAPIVSLLKEGMVKIHTHTKTHLVFD 60

Query: 61 EIHRYVV 67
          E+H  +V
Sbjct: 61 ELHASIV 67


>gi|94676815|ref|YP_588609.1| ATP synthase F1, epsilon subunit [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|119361412|sp|Q1LTV5|ATPE_BAUCH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|94219965|gb|ABF14124.1| ATP synthase F1, epsilon subunit [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 140

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 8/103 (7%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +   H  +VS EK +FSG V+ + +    GD+ +   H P+LT IK G++ +     +  
Sbjct: 3   IKTYHLYVVSAEKQIFSGLVEKIQVTGIEGDLGIFPRHTPLLTQIKPGLIYLVTEDGKTE 62

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMD--------NACLQALE 98
              + GGI ++  +  TVL++T +  +        N+ LQA E
Sbjct: 63  YIYISGGILEVQLNIVTVLADTAIRGEDLDEKRAINSKLQAQE 105


>gi|307566498|ref|ZP_07628928.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella amnii CRIS 21A-A]
 gi|307344780|gb|EFN90187.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella amnii CRIS 21A-A]
          Length = 79

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 36/55 (65%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
          L  +++SPE  VF+G +  +++P E GD  +L  HAP+++T+  G V  +++ E+
Sbjct: 2  LTLKIISPEHIVFNGLIDRILVPGEKGDFEILTNHAPIISTLVGGKVVYTVNGEQ 56


>gi|159900586|ref|YP_001546833.1| F0F1 ATP synthase subunit epsilon [Herpetosiphon aurantiacus ATCC
           23779]
 gi|254809369|sp|A9AVV5|ATPE_HERA2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|159893625|gb|ABX06705.1| ATP synthase F1, epsilon subunit [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 136

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 23/123 (18%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSG---IVTISLSCEEIH 63
           +  E+V+ E+ V S EV  V  PS  G + +L  H P+LT ++ G    V   +S     
Sbjct: 3   IQLEIVTAERVVLSEEVDMVSAPSVEGRVGILPRHEPLLTVLQPGELHYVKNGVSMP--- 59

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
            Y + GG  +++P+  T+L++T    D          IDE  ++         R Q EQ 
Sbjct: 60  -YAISGGFMEVLPNRVTILADTAERADE---------IDETRAE-------QARLQAEQA 102

Query: 124 LVD 126
           + D
Sbjct: 103 MRD 105


>gi|9911061|sp|P56084|ATPE_HELPY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
          Length = 123

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 63 INWGYAEVTNERVDILAD 80


>gi|298370406|ref|ZP_06981722.1| ATP synthase F1, epsilon subunit [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281866|gb|EFI23355.1| ATP synthase F1, epsilon subunit [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 141

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 56/101 (55%), Gaps = 6/101 (5%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGI--VTISLSCEE 61
           +N +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G   +T+    EE
Sbjct: 1   MNVMQVEVVSNEQNIYSGEATFVVIPTVQGELGIYPRHEPIMSLVRPGALRLTVPDQTEE 60

Query: 62  IHRYVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEK 99
           +    V GG+ ++ P   T+L++  +    MD A  +  +K
Sbjct: 61  VL-VAVSGGLLEVQPEKITILADVAVRSGEMDQARAEEAKK 100


>gi|84995484|ref|XP_952464.1| ATP synthase delta chain, mitochondrial [Theileria annulata]
 gi|65302625|emb|CAI74732.1| ATP synthase delta chain, mitochondrial [Theileria annulata]
          Length = 154

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 6/109 (5%)

Query: 5   NDLHFELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS-CEEI 62
            DL F L+S  + +++   V+++ +P   G  TV  GH+P+L+T+K G+V+ SL    E+
Sbjct: 18  KDLVFSLLSSHESLYNKVPVKNLTVPGYDGYFTVTPGHSPMLSTLKPGVVSFSLKDSNEV 77

Query: 63  HRYVVIGGIC---DIVPSHCT-VLSETILPMDNACLQALEKRIDEVCSD 107
           H++ +  G         SH   V+   I+P+D    +     + EV S+
Sbjct: 78  HKFFISSGFFVYRQSDDSHTADVMGVEIVPLDQLDKERATSVLQEVLSE 126


>gi|261839862|gb|ACX99627.1| ATP synthase F1, epsilon subunit [Helicobacter pylori 52]
          Length = 123

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 37/57 (64%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          L   +V PE  V++GEV+SVVLP   G+  VL GH+ ++T +++G++ I    ++ H
Sbjct: 4  LKISVVVPEGEVYTGEVKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH 60


>gi|304388485|ref|ZP_07370588.1| ATP synthase F1 sector epsilon subunit [Neisseria meningitidis
          ATCC 13091]
 gi|254670876|emb|CBA07381.1| ATP synthase epsilon chain [Neisseria meningitidis alpha153]
 gi|261393263|emb|CAX50889.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon
          subunit) [Neisseria meningitidis 8013]
 gi|304337482|gb|EFM03648.1| ATP synthase F1 sector epsilon subunit [Neisseria meningitidis
          ATCC 13091]
 gi|319409758|emb|CBY90064.1| ATP synthase epsilon chain (ATP synthase F1 sector epsilon
          subunit) [Neisseria meningitidis WUE 2594]
 gi|325127448|gb|EGC50378.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis N1568]
 gi|325135526|gb|EGC58144.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis M0579]
 gi|325141527|gb|EGC63997.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis
          961-5945]
 gi|325199024|gb|ADY94480.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis G2136]
          Length = 140

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   +V+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQKIYSGEATFIVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|256390421|ref|YP_003111985.1| ATP synthase F1 subunit epsilon [Catenulispora acidiphila DSM
          44928]
 gi|256356647|gb|ACU70144.1| ATP synthase F1, epsilon subunit [Catenulispora acidiphila DSM
          44928]
          Length = 150

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 45/81 (55%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  LV+ ++ V+ G  + V+  +  GD  VL GH P+L+ +   +V++  + E +   V
Sbjct: 11 LNVSLVAADRKVWQGTAEMVIARTTEGDTGVLPGHQPILSILAPSVVSVRGTEEGLREVV 70

Query: 67 VIGGICDIVPSHCTVLSETIL 87
          V GG   +     ++L+E+IL
Sbjct: 71 VSGGFLSVARDDVSILAESIL 91


>gi|78779916|ref|YP_398028.1| F0F1 ATP synthase subunit epsilon [Prochlorococcus marinus str. MIT
           9312]
 gi|119367756|sp|Q318V3|ATPE_PROM9 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|78713415|gb|ABB50592.1| ATP synthase F1 subcomplex epsilon subunit [Prochlorococcus marinus
           str. MIT 9312]
          Length = 134

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 62/129 (48%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++++P K V+ GE + V+LPS  G + VL GH  ++T I  G++ + ++  +     
Sbjct: 3   ISLKVLAPNKNVYQGEAEEVILPSTTGQLGVLPGHISLVTAIDIGVLRLRMNS-QWQSIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  +I      VL        +  +Q  E+ + E    +    + ++  +  + L +
Sbjct: 62  LMGGFAEIESDEVIVLVNNAEIGSDIDVQNAEQDLKEAKLVMTKFPENEKNSEKIKALQE 121

Query: 127 LSCLRRRIQ 135
           +S    RIQ
Sbjct: 122 ISKAEARIQ 130


>gi|325855000|ref|ZP_08171716.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Prevotella denticola CRIS 18C-A]
 gi|325483978|gb|EGC86918.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Prevotella denticola CRIS 18C-A]
          Length = 79

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +VSPE+ VF+GEV SV++P  +G   +L  HAP+++T+  G V  S+   +     
Sbjct: 2  LTLRIVSPERVVFTGEVDSVLVPGTVGQFEILNDHAPIISTLVEGKVVYSVKGIK-KELR 60

Query: 67 VIGGICDI 74
          ++GG  ++
Sbjct: 61 IVGGFVEV 68


>gi|260770078|ref|ZP_05879011.1| ATP synthase epsilon chain [Vibrio furnissii CIP 102972]
 gi|260615416|gb|EEX40602.1| ATP synthase epsilon chain [Vibrio furnissii CIP 102972]
 gi|315182595|gb|ADT89508.1| F0F1-type ATP synthase, epsilon subunit [Vibrio furnissii NCTC
           11218]
          Length = 146

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 53/106 (50%), Gaps = 10/106 (9%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
           N     +VS E  ++SG    + +    G++ +  GH+P+++ IK G+  I     ++H+
Sbjct: 8   NTFQLNVVSAEGTLYSGPAHGLAIAGADGELGIRPGHSPLISKIKPGVARI---VGDLHK 64

Query: 65  ----YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDE 103
                 V GG+ ++ P   TVL++T L    +D A  ++  K  +E
Sbjct: 65  PEEIIYVSGGLVEVQPDAVTVLADTALHGKDIDRARAESARKAAEE 110


>gi|330996919|ref|ZP_08320784.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Paraprevotella xylaniphila YIT 11841]
 gi|329571993|gb|EGG53664.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Paraprevotella xylaniphila YIT 11841]
          Length = 86

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
          + +H  +VSPEK +F G V+ V LP   G   V   HAP+++++ +G V +  S ++ +R
Sbjct: 4  DKIHLLIVSPEKTLFEGLVKYVRLPGSAGQFAVFYNHAPLISSLDAGEV-VYRSGKDKNR 62

Query: 65 YVVIGGICDI 74
            + GG  ++
Sbjct: 63 VNISGGFVEV 72


>gi|302542479|ref|ZP_07294821.1| ATP synthase F1, epsilon subunit [Streptomyces hygroscopicus ATCC
           53653]
 gi|302460097|gb|EFL23190.1| ATP synthase F1, epsilon subunit [Streptomyces himastatinicus ATCC
           53653]
          Length = 125

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +  +LH E+V+ ++ V+SG    V+  +  GDI V+ GH P+L  ++SG VTI  S    
Sbjct: 1   MAAELHVEMVAADRSVWSGTATLVIARTTSGDIGVMPGHQPLLGVLESGPVTIRTSDGGT 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCS 106
               V GG         ++L+E     D   ++  E+ ++   S
Sbjct: 61  VVAAVHGGFISFSDDKLSLLAEVAELSDEIDVKRAERALERAKS 104


>gi|327313277|ref|YP_004328714.1| ATP synthase subunit delta/epsilon [Prevotella denticola F0289]
 gi|326945944|gb|AEA21829.1| ATP synthase, delta/epsilon subunit, beta-sandwich domain protein
          [Prevotella denticola F0289]
          Length = 79

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 43/70 (61%), Gaps = 5/70 (7%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSC--EEIHR 64
          L   +VSPE+ VF+GEV SV++P  +G   +L  HAP+++T+  G V  S+    +E+  
Sbjct: 2  LTLRIVSPERVVFTGEVDSVLVPGTVGQFEILNDHAPIISTLVEGKVVYSVKGIKKELQ- 60

Query: 65 YVVIGGICDI 74
            ++GG  ++
Sbjct: 61 --IVGGFVEV 68


>gi|260590641|ref|ZP_05856099.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella veroralis F0319]
 gi|260537382|gb|EEX19999.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella veroralis F0319]
          Length = 79

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSPE+ V++GEV SV++P  +G   +L  HAP+++T+  G V  S    + +   
Sbjct: 2  LTLKIVSPERIVYTGEVDSVLVPGTVGQFEILNDHAPIISTLVEGKVVYSTKGTK-NELQ 60

Query: 67 VIGGICDI 74
          ++GG  ++
Sbjct: 61 IVGGFVEV 68


>gi|91214127|ref|YP_538749.1| ATP synthase CF1 epsilon subunit [Glycine max]
 gi|122238710|sp|Q2PMU9|ATPE_SOYBN RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|83595728|gb|ABC25109.1| ATP synthase CF1 epsilon subunit [Glycine max]
          Length = 134

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L  ++     ++GG
Sbjct: 7  VLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLLKDQWLTMALMGG 66

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 67 FARINNNEITVL 78


>gi|126276303|ref|XP_001386981.1| ATP synthase delta subunit [Scheffersomyces stipitis CBS 6054]
 gi|126212850|gb|EAZ62958.1| ATP synthase delta subunit [Pichia stipitis CBS 6054]
          Length = 161

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 7   LHFELVSPEKCVFS-GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           L   L  P + ++S  EV+ V LPS  GD+ +L  H P++  ++ G++ I     E  +Y
Sbjct: 32  LKLSLALPHQTLYSESEVEQVNLPSVNGDLGILANHIPIVEQLRPGLLEIISKGGETEQY 91

Query: 66  VVIGGICDIVPSHCTVLS 83
            V GGI  + P +   +S
Sbjct: 92  FVSGGIATVQPGNKLTIS 109


>gi|11465963|ref|NP_054505.1| ATP synthase CF1 epsilon subunit [Nicotiana tabacum]
 gi|78102541|ref|YP_358682.1| ATP synthase CF1 epsilon subunit [Nicotiana sylvestris]
 gi|114610|sp|P00834|ATPE_TOBAC RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|122233178|sp|Q3C1J6|ATPE_NICSY RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|11839|emb|CAA77359.1| ATPase epsilon subunit [Nicotiana tabacum]
 gi|552955|gb|AAA84677.1| ATPase epsilon subunit [Nicotiana tabacum]
 gi|77799568|dbj|BAE46657.1| ATPase epsilon subunit [Nicotiana sylvestris]
 gi|225207|prf||1211235AM ATPase epsilon
          Length = 133

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V+  EV+ +VL +  G I +L  HAP+ T +  GI+ I L+ + +    
Sbjct: 3  LNLSVLTPNRIVWDSEVEEIVLSTNSGQIGILPNHAPIATAVDIGILRIRLNDQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  TVL
Sbjct: 62 LMGGFARIGNNEITVL 77


>gi|297569850|ref|YP_003691194.1| ATP synthase F1, epsilon subunit [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925765|gb|ADH86575.1| ATP synthase F1, epsilon subunit [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 138

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 61/139 (43%), Gaps = 8/139 (5%)

Query: 3   LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
           +   +  E+V+P+  V S +V  V  P   G   VL  HAP+L+TIK G +      ++ 
Sbjct: 1   MATQIQLEVVTPKGAVISEQVDMVTAPGYAGVFGVLANHAPLLSTIKIGTLVYKKDGQDA 60

Query: 63  HRYVVIGGICDIVPSHCTVLSETI-----LPMDNA--CLQALEKRIDEVCSDLNNICDVD 115
              +V GG C++  +  T L E+      +  + A    +  EKR+ E  +    I    
Sbjct: 61  T-LMVSGGFCEVSNNKVTFLVESAERGAEIDTERALRAKERAEKRLAEAIAQQEKIDRAR 119

Query: 116 QRFQMEQLLVDLSCLRRRI 134
               +++ L  L    +++
Sbjct: 120 AEAALQRALARLKAAGQQV 138


>gi|153833292|ref|ZP_01985959.1| ATP synthase F1, epsilon subunit [Vibrio harveyi HY01]
 gi|156977317|ref|YP_001448223.1| F0F1-type ATP synthase, epsilon subunit [Vibrio harveyi ATCC
          BAA-1116]
 gi|269961116|ref|ZP_06175484.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|148870428|gb|EDL69349.1| ATP synthase F1, epsilon subunit [Vibrio harveyi HY01]
 gi|156528911|gb|ABU73996.1| hypothetical protein VIBHAR_06103 [Vibrio harveyi ATCC BAA-1116]
 gi|269834067|gb|EEZ88158.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 145

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 3/85 (3%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTIS--LSCEEI 62
          N     +VS E  ++SG   ++ +    G++ +  GH+P+++ IK G+  I+  LS  E 
Sbjct: 8  NTFQLNVVSAEGTLYSGPAHAIAVAGADGELGIRPGHSPLISKIKPGVARITGDLSKPEE 67

Query: 63 HRYVVIGGICDIVPSHCTVLSETIL 87
            YV  GG+ ++ P   TVL++T L
Sbjct: 68 ILYVS-GGLVEVQPDVVTVLADTAL 91


>gi|81301572|ref|YP_398869.1| ATP synthase CF1 epsilon subunit [Nicotiana tomentosiformis]
 gi|122226809|sp|Q33C28|ATPE_NICTO RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|80750931|dbj|BAE48007.1| ATPase epsilon subunit [Nicotiana tomentosiformis]
          Length = 133

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V+  EV+ +VL +  G I +L  HAP+ T +  GI+ I L+ + +    
Sbjct: 3  LNLSVLTPNRIVWDSEVEEIVLSTNSGQIGILPNHAPIATAVDIGILRIRLNDQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  TVL
Sbjct: 62 LMGGFARIGNNEITVL 77


>gi|83591193|ref|YP_431202.1| ATP synthase F1, epsilon subunit [Moorella thermoacetica ATCC
          39073]
 gi|20137253|sp|O05434|ATPE_MOOTA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|1929514|gb|AAB51467.1| ATP synthase subunit epsilon [Moorella thermoacetica]
 gi|83574107|gb|ABC20659.1| ATP synthase F1 subcomplex epsilon subunit [Moorella
          thermoacetica ATCC 39073]
          Length = 134

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+ E+++PE+ V   E  SV+ P   G + VL  HAP++T +++G+VT         R  
Sbjct: 4  LNLEIITPERVVLQAEAASVIAPGIQGYLGVLPEHAPLITPLQAGVVTCRRRERAEERVA 63

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  +  P    +L++T
Sbjct: 64 VSGGFLEAGPDQVIILADT 82


>gi|217034728|ref|ZP_03440129.1| hypothetical protein HP9810_3g13 [Helicobacter pylori 98-10]
 gi|216942811|gb|EEC22310.1| hypothetical protein HP9810_3g13 [Helicobacter pylori 98-10]
          Length = 123

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +V PE  V++GE++SVVLP   G+  VL GH+ ++T +++G++ I    ++ H   
Sbjct: 4  LKISVVVPEGEVYTGEIKSVVLPGVEGEFGVLYGHSNMITLLQAGVIEIETENQKEH-IA 62

Query: 67 VIGGICDIVPSHCTVLSE 84
          +  G  ++      +L++
Sbjct: 63 INWGYAEVTKERVDILAD 80


>gi|114777384|ref|ZP_01452381.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Mariprofundus ferrooxydans PV-1]
 gi|114552166|gb|EAU54668.1| H+-transporting two-sector ATPase, delta/epsilon subunit
           [Mariprofundus ferrooxydans PV-1]
          Length = 137

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 3/107 (2%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           + + E+ V+ GE   +V P   G++ ++  H P++  + +G + I+   +EI    V GG
Sbjct: 9   VATAEREVYRGECSFLVAPGAAGELGIMPKHTPLIAQLCAGELRITKGVDEIDEVFVSGG 68

Query: 71  ICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDV 114
             ++ P   TVL   +E  + +D A     E++  EV        DV
Sbjct: 69  FVEVQPDMVTVLADSAERAIDIDEAQALEAERKAKEVLEGREGDADV 115


>gi|240112072|ref|ZP_04726562.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae MS11]
 gi|240122657|ref|ZP_04735613.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae PID332]
 gi|260441368|ref|ZP_05795184.1| F0F1 ATP synthase subunit epsilon [Neisseria gonorrhoeae DGI2]
 gi|268598131|ref|ZP_06132298.1| predicted protein [Neisseria gonorrhoeae MS11]
 gi|268681256|ref|ZP_06148118.1| predicted protein [Neisseria gonorrhoeae PID332]
 gi|291044725|ref|ZP_06570434.1| predicted protein [Neisseria gonorrhoeae DGI2]
 gi|268582262|gb|EEZ46938.1| predicted protein [Neisseria gonorrhoeae MS11]
 gi|268621540|gb|EEZ53940.1| predicted protein [Neisseria gonorrhoeae PID332]
 gi|291011619|gb|EFE03615.1| predicted protein [Neisseria gonorrhoeae DGI2]
          Length = 140

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   +V+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSGEQKIYSGEATFIVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|89280641|ref|YP_514858.1| ATP synthase CF1 epsilon subunit [Solanum lycopersicum]
 gi|91208994|ref|YP_538854.1| ATP synthase CF1 epsilon subunit [Solanum bulbocastanum]
 gi|108773136|ref|YP_635645.1| ATP synthase CF1 epsilon subunit [Solanum tuberosum]
 gi|122225931|sp|Q27S44|ATPE_SOLTU RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|122238667|sp|Q2MII1|ATPE_SOLBU RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|122248446|sp|Q2MI94|ATPE_SOLLC RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|84371901|gb|ABC56219.1| ATP synthase CF1 epsilon subunit [Solanum bulbocastanum]
 gi|84371989|gb|ABC56306.1| ATP synthase CF1 epsilon subunit [Solanum lycopersicum]
 gi|88656810|gb|ABD47063.1| ATP synthase CF1 epsilon subunit [Solanum tuberosum]
 gi|89241677|emb|CAJ32399.1| ATP synthase CF1 epsilon chain [Solanum lycopersicum]
          Length = 133

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V+  EV+ +VL +  G I +L  HAP+ T +  GI+ I L+ + +    
Sbjct: 3  LNLSVLTPNRIVWDSEVEEIVLSTNSGQIGILPNHAPIATAVDIGILRIRLNDQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  TVL
Sbjct: 62 LMGGFARIGNNEITVL 77


>gi|326200287|gb|ADZ52326.1| ATP synthase F0 complex c subunit [Asclepias syriaca]
          Length = 132

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LH  +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    
Sbjct: 3  LHLCVLTPNRIVWDSEVKEIILSTNNGQIGVLPDHAPIATAVDIGILKIRLNGQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  TVL
Sbjct: 62 LMGGFARIGNNEITVL 77


>gi|295136335|ref|YP_003587011.1| ATP synthase subunit epsilon [Zunongwangia profunda SM-A87]
 gi|294984350|gb|ADF54815.1| ATP synthase subunit epsilon [Zunongwangia profunda SM-A87]
          Length = 94

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 35/53 (66%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSC 59
          ++ E+V+PE  VF  E+ +V +P   G+  +L  HAP+++T+ SG V I+L+ 
Sbjct: 1  MYLEIVTPEAVVFQAEIDAVKVPGIEGEFQMLNNHAPIVSTLTSGTVKINLTT 53


>gi|291280258|ref|YP_003497093.1| F0F1-type ATP synthase subunit epsilon [Deferribacter
          desulfuricans SSM1]
 gi|290754960|dbj|BAI81337.1| F0F1-type ATP synthase, epsilon subunit [Deferribacter
          desulfuricans SSM1]
          Length = 138

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   L F LVSPE+ + + EV  V+ P   GD  +L GH P LT ++ G +       E 
Sbjct: 1  MAEKLRFILVSPERELLNDEVDEVIAPGVEGDFGILPGHTPFLTALRVGELIYKKDGNE- 59

Query: 63 HRYVVIG-GICDIVPSHCTVLSET 85
            YV +  G  ++     TVL+E+
Sbjct: 60 -EYVALDRGFLEVSDDVVTVLAES 82


>gi|158430157|pdb|2QE7|H Chain H, Crystal Structure Of The F1-Atpase From The
           Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1
 gi|33329388|gb|AAQ10091.1| ATP synthase subunit epsilon [Bacillus sp. TA2.A1]
          Length = 135

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++V+PE+ VF GE   V+     G++ V+ GH P++T +K+  V I    +E     
Sbjct: 4   VQVDIVTPERKVFQGEADIVIARGVEGELGVMAGHIPLVTPLKTAPVRIKQGDKETL-IA 62

Query: 67  VIGGICDIVPSHCTVLSETI-LPMD---------NACLQALEKRIDEVCSD 107
           V GG  ++ P    +L++T  LP +          A  + + KR+D+   D
Sbjct: 63  VSGGFLEVRPDKVNILADTAELPEEIDVERAKKAKARHETILKRLDKTDKD 113


>gi|57505326|ref|ZP_00371255.1| ATP synthase F1, epsilon subunit [Campylobacter upsaliensis
          RM3195]
 gi|57016462|gb|EAL53247.1| ATP synthase F1, epsilon subunit [Campylobacter upsaliensis
          RM3195]
          Length = 130

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 33/49 (67%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          +  E+V+P   ++ GEV+SV LP   G+  VL GHA ++ ++KSG++ +
Sbjct: 5  ISLEIVTPLGMIYQGEVKSVTLPGSEGEFGVLRGHASLVASLKSGVIDV 53


>gi|120437868|ref|YP_863554.1| ATP synthase subunit epsilon [Gramella forsetii KT0803]
 gi|117580018|emb|CAL68487.1| ATP synthase subunit epsilon [Gramella forsetii KT0803]
          Length = 98

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 20/98 (20%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSC---EEIH 63
          ++ E+V+PE  VF  EV +V +P   G+  +L  HAP+++T+  G + I+L+     EI 
Sbjct: 1  MYLEIVTPEAVVFRAEVDAVKVPGHDGEFQMLNNHAPIVSTLSEGELKINLTSGSENEIK 60

Query: 64 R-----------------YVVIGGICDIVPSHCTVLSE 84
          R                 Y + GG+ ++  +   +L++
Sbjct: 61 RKDQSGFRTEGAETNVVYYTIKGGVLEMKDNKAIILAD 98


>gi|187931021|ref|YP_001891005.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|226740257|sp|B2SEY2|ATPE_FRATM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|187711930|gb|ACD30227.1| ATP synthase, F1 sector, subunit epsilon [Francisella tularensis
           subsp. mediasiatica FSC147]
          Length = 145

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 8/106 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++VSP   VF GE   V L    G++ +  GH  +L+T+ +G+V +    ++ H  V
Sbjct: 6   LKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVR---KDQHTDV 62

Query: 67  --VIGGICDIVPSHCTVLSETILPMDNACLQALEK---RIDEVCSD 107
             V GGI ++ P+  T++ + +   +N      EK   R  EV  +
Sbjct: 63  LYVSGGIVEVTPTRVTIMVDDMERAENLNQAEAEKARVRAKEVLKN 108


>gi|311070199|ref|YP_003975122.1| F0F1 ATP synthase subunit epsilon [Bacillus atrophaeus 1942]
 gi|310870716|gb|ADP34191.1| F0F1 ATP synthase subunit epsilon [Bacillus atrophaeus 1942]
          Length = 132

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 55/107 (51%), Gaps = 4/107 (3%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +V+P+  V+  +++ V + +E G++ +L GH P +  +K G V +     +     V GG
Sbjct: 8   IVTPDGPVYDADIEMVSVRAESGELGILPGHIPTVAPLKIGAVRLKKDG-QTELVAVSGG 66

Query: 71  ICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDV 114
             ++ P H T+L   +ET   +D    QA ++R  +  +  ++  D+
Sbjct: 67  FVEVRPDHVTILAQSAETAEGIDTERAQAAKQRAQDRLNTRSDDTDI 113


>gi|319638952|ref|ZP_07993710.1| ATP synthase F1 [Neisseria mucosa C102]
 gi|317399856|gb|EFV80519.1| ATP synthase F1 [Neisseria mucosa C102]
          Length = 141

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E     V
Sbjct: 4  MQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEAEEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKITVLAD 82


>gi|7525039|ref|NP_051065.1| ATP synthase CF1 epsilon subunit [Arabidopsis thaliana]
 gi|332278159|sp|P09468|ATPE_ARATH RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|5881700|dbj|BAA84391.1| ATPase epsilon subunit [Arabidopsis thaliana]
          Length = 132

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 7  VLTPNRIVWDSEVKEIILSTNSGQIGVLANHAPIATAVDIGILKIRLANQWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 66 FARIGNNEITIL 77


>gi|325280170|ref|YP_004252712.1| ATPase, F1 complex, delta/epsilon subunit [Odoribacter
          splanchnicus DSM 20712]
 gi|324311979|gb|ADY32532.1| ATPase, F1 complex, delta/epsilon subunit [Odoribacter
          splanchnicus DSM 20712]
          Length = 77

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEE 61
          +  E++S EK +F G VQ V LP  LG  T+L  HAP+++T+  G V       E
Sbjct: 1  MRLEIISAEKVLFKGNVQRVTLPGSLGTFTILEQHAPLISTLTHGNVVYDTGGGE 55


>gi|50410163|ref|XP_456939.1| DEHA2A14014p [Debaryomyces hansenii CBS767]
 gi|49652603|emb|CAG84917.1| DEHA2A14014p [Debaryomyces hansenii]
          Length = 160

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 7   LHFELVSPEKCVFS-GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           L   L  P + ++S  EV+ V LPS  GD+ +L  H P++  ++ G++ I     E  +Y
Sbjct: 31  LKLSLALPHQTLYSESEVEQVNLPSINGDLGILANHIPIVEQLRPGLLEIISKGGETEQY 90

Query: 66  VVIGGICDIVPSHCTVLS 83
            V GGI  + P +   +S
Sbjct: 91  FVSGGIATVQPGNKLTIS 108


>gi|313673546|ref|YP_004051657.1| ATP synthase f1 subcomplex epsilon subunit [Calditerrivibrio
          nitroreducens DSM 19672]
 gi|312940302|gb|ADR19494.1| ATP synthase F1 subcomplex epsilon subunit [Calditerrivibrio
          nitroreducens DSM 19672]
          Length = 138

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   L  ELVSPEK + S +V  VV P   G+  VL GH   LT ++ G +   ++ +E 
Sbjct: 1  MAEKLRLELVSPEKQLLSIDVDEVVAPGVEGEFGVLPGHTAFLTALRIGELVYKVNGKE- 59

Query: 63 HRYVVI-GGICDIVPSHCTVLSE 84
            YV I  G  ++     TVL+E
Sbjct: 60 -EYVAIEKGFFEVSNDKVTVLAE 81


>gi|161869280|ref|YP_001598447.1| F0F1 ATP synthase subunit epsilon [Neisseria meningitidis 053442]
 gi|189081370|sp|A9M124|ATPE_NEIM0 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|161594833|gb|ABX72493.1| ATP synthase epsilon chain [Neisseria meningitidis 053442]
 gi|325207409|gb|ADZ02861.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis
          NZ-05/33]
          Length = 140

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   +V+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MEVEVVSSEQKIYSGEATFIVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|115605028|ref|YP_784479.1| ATP synthase CF1 epsilon subunit [Piper cenocladum]
 gi|122164356|sp|Q06GQ4|ATPE_PIPCE RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|112253757|gb|ABI14478.1| ATP synthase CF1 epsilon subunit [Piper cenocladum]
          Length = 133

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + ++  EV+ ++LP+  G I VL  HAP+ T +  GI+ I L  + +    ++GG
Sbjct: 7  VLTPNRIIWDSEVKEIILPTNSGQIGVLPNHAPIATAVDIGILRIRLDDQWVT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 66 FARIGNNEITIL 77


>gi|15677763|ref|NP_274927.1| F0F1 ATP synthase subunit epsilon [Neisseria meningitidis MC58]
 gi|20137497|sp|Q9JXQ3|ATPE_NEIMB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|7227191|gb|AAF42262.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis MC58]
 gi|316985555|gb|EFV64502.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis H44/76]
 gi|325139586|gb|EGC62126.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis CU385]
 gi|325200984|gb|ADY96439.1| ATP synthase F1, epsilon subunit [Neisseria meningitidis H44/76]
          Length = 140

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   +V+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQKIYSGEATFIVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|261379444|ref|ZP_05984017.1| ATP synthase F1, epsilon subunit [Neisseria subflava NJ9703]
 gi|284797898|gb|EFC53245.1| ATP synthase F1, epsilon subunit [Neisseria subflava NJ9703]
          Length = 141

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E     V
Sbjct: 4  MQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEAEEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKITVLAD 82


>gi|321313230|ref|YP_004205517.1| F0F1 ATP synthase subunit epsilon [Bacillus subtilis BSn5]
 gi|291486263|dbj|BAI87338.1| F0F1 ATP synthase subunit epsilon [Bacillus subtilis subsp. natto
           BEST195]
 gi|320019504|gb|ADV94490.1| F0F1 ATP synthase subunit epsilon [Bacillus subtilis BSn5]
          Length = 132

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +   +V+P+  V+  +++ V + +E GD+ +L GH P +  +K G V +     +     
Sbjct: 4   VKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDG-QTEMVA 62

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDV 114
           V GG  ++ P   T+L   +ET   +D    +A  +R  E  +  ++  D+
Sbjct: 63  VSGGFVEVRPDQVTILAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDI 113


>gi|241758907|ref|ZP_04757019.1| ATP synthase F1, epsilon subunit [Neisseria flavescens SK114]
 gi|241320728|gb|EER56961.1| ATP synthase F1, epsilon subunit [Neisseria flavescens SK114]
          Length = 141

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
          ++ +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E   
Sbjct: 1  MSTMQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEAEE 60

Query: 64 RYVVI-GGICDIVPSHCTVLSE 84
            V + GG+ ++ P   TVL++
Sbjct: 61 VLVAVSGGVLEVQPDKITVLAD 82


>gi|261338635|ref|ZP_05966519.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bifidobacterium gallicum DSM 20093]
 gi|270276354|gb|EFA22208.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bifidobacterium gallicum DSM 20093]
          Length = 99

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H  +V+ +  V+SG+ +SV +P+  G + +L GH PVLT I+ G + +       H + 
Sbjct: 6  MHVNIVASDHPVWSGDAKSVTIPAYSGGMGILPGHEPVLTVIREGDLVVVDPSGARHSFE 65

Query: 67 VIGGICDIVPSHCTVLSETILPMDNACL 94
          V  G      +  TV+ E+   + N  L
Sbjct: 66 VTDGFISFDSNKLTVVIESARSISNQKL 93


>gi|89257057|ref|YP_514419.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          holarctica LVS]
 gi|115315413|ref|YP_764136.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          holarctica OSU18]
 gi|156503267|ref|YP_001429332.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|167009444|ref|ZP_02274375.1| ATP synthase F1, epsilon subunit [Francisella tularensis subsp.
          holarctica FSC200]
 gi|254368296|ref|ZP_04984315.1| ATP synthase epsilon chain [Francisella tularensis subsp.
          holarctica 257]
 gi|290953660|ref|ZP_06558281.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295312977|ref|ZP_06803686.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          holarctica URFT1]
 gi|119361434|sp|Q2A1I3|ATPE_FRATH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|119361435|sp|Q0BK85|ATPE_FRATO RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|166222458|sp|A7NEH3|ATPE_FRATF RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|89144888|emb|CAJ80233.1| ATP synthase epsilon chain [Francisella tularensis subsp.
          holarctica LVS]
 gi|115130312|gb|ABI83499.1| H(+)-transporting two-sector ATPase [Francisella tularensis
          subsp. holarctica OSU18]
 gi|134254105|gb|EBA53199.1| ATP synthase epsilon chain [Francisella tularensis subsp.
          holarctica 257]
 gi|156253870|gb|ABU62376.1| ATP synthase F1, epsilon subunit [Francisella tularensis subsp.
          holarctica FTNF002-00]
          Length = 145

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSP   VF GE   V L    G++ ++ GH  +L+T+ +G+V +    +      
Sbjct: 6  LKVDVVSPLGSVFKGEADMVSLRGSAGEMGIVYGHTELLSTLPAGVVNVR-KGQHTDVLY 64

Query: 67 VIGGICDIVPSHCTVL 82
          V GGI ++ P+  T++
Sbjct: 65 VSGGIVEVTPTRVTIM 80


>gi|218676678|ref|YP_002395497.1| hypothetical protein VS_II0915 [Vibrio splendidus LGP32]
 gi|218324946|emb|CAV26769.1| Conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 147

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 2/120 (1%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEEIH 63
           N     +VS E  +FSG   ++ +    G++ +  GH+P+L+ IK G+   ++    E  
Sbjct: 8   NTFQLNIVSAEGTLFSGPAYALAVSGADGELGIRPGHSPLLSKIKPGVTQFVTDPKSEGQ 67

Query: 64  RYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123
              V GG+ ++ P   TVL++T L   +      E+       ++N   +VD  F   QL
Sbjct: 68  VLYVSGGMLEVQPDVVTVLADTALHGQDIDRARAEEAKYAALENINK-GNVDINFAQAQL 126


>gi|213963317|ref|ZP_03391573.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain
          [Capnocytophaga sputigena Capno]
 gi|213953985|gb|EEB65311.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain
          [Capnocytophaga sputigena Capno]
          Length = 83

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 38/64 (59%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E++SPE  +F GEV +V +P   G   +L  HAP+++ + +G VT+    +E+  + + G
Sbjct: 9  EILSPEALLFKGEVTAVNVPGAKGPFVILDHHAPIISMLTAGEVTLFEGKKELKSFTISG 68

Query: 70 GICD 73
          G  +
Sbjct: 69 GTLE 72


>gi|116617114|ref|YP_817488.1| ATP synthase CF1 epsilon subunit [Coffea arabica]
 gi|122153627|sp|A0A341|ATPE_COFAR RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|116242170|gb|ABJ89685.1| ATP synthase CF1 epsilon subunit [Coffea arabica]
          Length = 132

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++LP+  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 7  VLTPNRIVWDSEVKEIILPTNSGQIGVLPNHAPIATAVDIGILRIRLNGQWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +   VL
Sbjct: 66 FAKIGSNEIIVL 77


>gi|227495030|ref|ZP_03925346.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Actinomyces coleocanis DSM 15436]
 gi|226831482|gb|EEH63865.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Actinomyces coleocanis DSM 15436]
          Length = 89

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%)

Query: 1  MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
          M   N L  E+V+ +  ++SG   SVV+P+  GD+ +L    P+L  +++G + +    E
Sbjct: 1  MKTANMLQVEVVTRKAQLWSGNATSVVVPAADGDLGILPKREPILAVLRAGTIRLDSESE 60

Query: 61 EIHRYVVIGGICDIVPSHCTVLSE 84
              + V GG   +     TV++E
Sbjct: 61 GRLEFQVTGGFVSVDADFVTVVAE 84


>gi|289066812|ref|YP_003434330.1| ATP synthase CF1 epsilon subunit [Vigna radiata]
 gi|259019999|gb|ACV90197.1| ATP synthase CF1 epsilon subunit [Vigna radiata]
          Length = 133

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++LP+  G I VL  HAP+ + +  GI+ I L  + +    ++GG
Sbjct: 7  VLTPNRIVWDSEVKEIILPTNSGQIGVLPNHAPIASAVDIGILRIRLKDQWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 66 FARINNNEITVL 77


>gi|71891802|ref|YP_277531.1| ATP synthase, F1 sector, epsilon-subunit [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|119361413|sp|Q494C2|ATPE_BLOPB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|71795908|gb|AAZ40659.1| ATP synthase, F1 sector, epsilon-subunit [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 144

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            +  +VS E+ +FSG V+ + +    G++ V  GH P+LT+IK G++ I  S +      
Sbjct: 6   YYLTVVSVEREIFSGVVRKIQVTGIEGEMGVFPGHTPLLTSIKPGVLRIVKSHDNEEYIY 65

Query: 67  VIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDEVCSDLNNICDVD 115
           + GGI ++  +  T+L++T +    +D    +  +   ++   +  +  D+D
Sbjct: 66  ISGGILEVQRNIVTILADTAIRAEELDEKKAKEAKHEAEKHIKNYRHSSDID 117


>gi|22795915|emb|CAD23942.1| ATP synthase epsilon subunit [Acanthus longifolius]
          Length = 132

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          LH  +++P + V+  +V  ++L +  G I VL+ HAP+ T +  GI+ I L+ + +    
Sbjct: 2  LHLCVLTPNRVVWDSDVNEIILSTNSGQIGVLLNHAPIATAVDIGILRIRLTDQWLT-MA 60

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  TVL
Sbjct: 61 LLGGFARIGNNEITVL 76


>gi|157414040|ref|YP_001484906.1| F0F1 ATP synthase subunit epsilon [Prochlorococcus marinus str. MIT
           9215]
 gi|254526223|ref|ZP_05138275.1| ATP synthase F1, epsilon subunit [Prochlorococcus marinus str. MIT
           9202]
 gi|166990384|sp|A8G6T9|ATPE_PROM2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|157388615|gb|ABV51320.1| ATP synthase, Epsilon subunit [Prochlorococcus marinus str. MIT
           9215]
 gi|221537647|gb|EEE40100.1| ATP synthase F1, epsilon subunit [Prochlorococcus marinus str. MIT
           9202]
          Length = 134

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++++P K V+ GE + V+LPS  G + +L GH  ++T I  G++ + ++  +     
Sbjct: 3   ISLKVLAPNKNVYQGEAEEVILPSTTGQLGILPGHISLVTAIDIGVLRLRMNS-QWKSIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  +I      VL           +Q  E+ + E    ++   + ++  +  + L  
Sbjct: 62  LMGGFAEIESDEVIVLVNNAEIGSEINVQNAEQDLKEAKLAISKFSENEKNPEKIKALKQ 121

Query: 127 LSCLRRRIQ 135
           +S    RIQ
Sbjct: 122 VSKAEARIQ 130


>gi|258544336|ref|ZP_05704570.1| ATP synthase F1, epsilon subunit [Cardiobacterium hominis ATCC
          15826]
 gi|258520416|gb|EEV89275.1| ATP synthase F1, epsilon subunit [Cardiobacterium hominis ATCC
          15826]
          Length = 138

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 44/82 (53%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +    H  +VS ++ ++ GE + +V  ++ G++ +L GHAP+L  +K+G V ++    + 
Sbjct: 1  MAKTFHVNMVSADRQLYCGEAERIVATADHGELGILAGHAPLLAVLKAGQVRLTQEGGKE 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
              + GG  ++      +L++
Sbjct: 61 EVIYISGGFIEVQHEQTIILAD 82


>gi|255021564|ref|ZP_05293607.1| ATP synthase epsilon chain [Acidithiobacillus caldus ATCC 51756]
 gi|254968952|gb|EET26471.1| ATP synthase epsilon chain [Acidithiobacillus caldus ATCC 51756]
          Length = 165

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 69/137 (50%), Gaps = 17/137 (12%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           V D+H E       VF+G V+ VV+P  LG++ +L GHAP+++ +++G   + ++  E H
Sbjct: 5   VADVHGE-------VFTGLVEFVVVPGMLGELGILPGHAPLISILRAG--ELRITPVEGH 55

Query: 64  RYVVI--GGICDIVPSHCTVLSETILPMDNACLQALEKRI---DEVCSDLNNICDVD--- 115
             ++   GG+ ++ P+  TVL++  L + +   +  E RI        D     ++D   
Sbjct: 56  PQILFLEGGMVEVQPAVVTVLADNSLRVTDIDPKLSESRIAAAQRALKDHRGHSEMDFAK 115

Query: 116 QRFQMEQLLVDLSCLRR 132
              ++++ L  L    R
Sbjct: 116 AELELQRELAKLGAFER 132


>gi|293375574|ref|ZP_06621848.1| ATP synthase F1, epsilon subunit [Turicibacter sanguinis PC909]
 gi|292645791|gb|EFF63827.1| ATP synthase F1, epsilon subunit [Turicibacter sanguinis PC909]
          Length = 135

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI-G 69
          +V+P+K VF GE + +      GD  VL  H P++T +  G + I ++ E    Y+ I  
Sbjct: 8  VVTPDKLVFDGEAERIFARGIDGDFAVLYNHIPMMTPLGVGELRIDMNGE--SSYIAIDN 65

Query: 70 GICDIVPSHCTVLS 83
          GI ++  +H  VLS
Sbjct: 66 GIFEVSNNHVNVLS 79


>gi|309379542|emb|CBX21908.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 140

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E  ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEHNIYSGEAGFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|139387438|ref|YP_001122792.1| ATP synthase CF1 epsilon subunit [Phaseolus vulgaris]
 gi|112030960|gb|ABH88072.1| ATP synthase CF1 epsilon subunit [Phaseolus vulgaris]
 gi|158187163|gb|ABW22796.1| ATP synthase CF1 epsilon subunit [Phaseolus vulgaris]
          Length = 133

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++LP+  G I VL  HAP+ + +  GI+ I L  + +    ++GG
Sbjct: 7  VLTPNRIVWDSEVKEIILPTNSGQIGVLPNHAPIASAVDIGILRIRLKDQWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 66 FARINNNEITVL 77


>gi|161616984|ref|YP_001590949.1| hypothetical protein SPAB_04805 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161366348|gb|ABX70116.1| hypothetical protein SPAB_04805 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 124

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 58/118 (49%), Gaps = 7/118 (5%)

Query: 18  VFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPS 77
           +FSG V+ + +    G++ +  GHAP+LT IK G++ I           + GGI ++ P 
Sbjct: 1   MFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPG 60

Query: 78  HCTVLSETIL---PMDNA-CLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLR 131
             TVL++T +    +D A  L+A  K  + + S      DVD      +L   ++ LR
Sbjct: 61  SVTVLADTAIRGQDLDEARALEAKRKAEEHIKSSHG---DVDYAQASAELAKAIAKLR 115


>gi|156598362|gb|ABU85441.1| ATP synthase CF1 epsilon subunit [Musa acuminata]
          Length = 134

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 41/73 (56%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + ++  EV+ ++L +  G I VL  HAP+ T +  G++ I L+ ++     ++GG
Sbjct: 7  VLTPNRIIWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGLLRIRLNNDQWLTVALMGG 66

Query: 71 ICDIVPSHCTVLS 83
             I  +  T+L 
Sbjct: 67 FARIGNNEITILG 79


>gi|22298069|ref|NP_681316.1| F0F1 ATP synthase subunit epsilon [Thermosynechococcus elongatus
          BP-1]
 gi|60389780|sp|Q8DLG7|ATPE_THEEB RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|283806760|pdb|2RQ6|A Chain A, Solution Structure Of The Epsilon Subunit Of The
          F1-Atpase From Thermosynechococcus Elongatus Bp-1
 gi|22294247|dbj|BAC08078.1| ATP synthase epsilon subunit [Thermosynechococcus elongatus BP-1]
          Length = 138

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P+K V+    + V+LPS  G + +L  HAP+LT +++G++ +    E +    ++GG
Sbjct: 7  VIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVA-IALMGG 65

Query: 71 ICDIVPSHCTVL 82
            ++  +  T+L
Sbjct: 66 FAEVENNEVTIL 77


>gi|169797643|ref|YP_001715436.1| F0F1 ATP synthase subunit epsilon [Acinetobacter baumannii AYE]
 gi|184156499|ref|YP_001844838.1| F0F1 ATP synthase subunit epsilon [Acinetobacter baumannii ACICU]
 gi|213155563|ref|YP_002317608.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii AB0057]
 gi|215484997|ref|YP_002327238.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii
          AB307-0294]
 gi|239503041|ref|ZP_04662351.1| F0F1 ATP synthase subunit epsilon [Acinetobacter baumannii AB900]
 gi|260557586|ref|ZP_05829800.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii ATCC
          19606]
 gi|301345729|ref|ZP_07226470.1| F0F1 ATP synthase subunit epsilon [Acinetobacter baumannii AB056]
 gi|301512771|ref|ZP_07238008.1| F0F1 ATP synthase subunit epsilon [Acinetobacter baumannii AB058]
 gi|301594500|ref|ZP_07239508.1| F0F1 ATP synthase subunit epsilon [Acinetobacter baumannii AB059]
 gi|332852655|ref|ZP_08434309.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii
          6013150]
 gi|332869371|ref|ZP_08438749.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii
          6013113]
 gi|332875633|ref|ZP_08443445.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii
          6014059]
 gi|226740216|sp|B0VBP2|ATPE_ACIBY RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226740698|sp|B7H293|ATPE_ACIB3 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226740699|sp|B7I1W5|ATPE_ACIB5 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226740700|sp|B2I103|ATPE_ACIBC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|226740702|sp|A3M145|ATPE_ACIBT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|169150570|emb|CAM88479.1| membrane-bound ATP synthase , F1 sector, epsilon-subunit
          [Acinetobacter baumannii AYE]
 gi|183208093|gb|ACC55491.1| F0F1-type ATP synthase, epsilon subunit [Acinetobacter baumannii
          ACICU]
 gi|193076047|gb|ABO10639.2| membrane-bound ATP synthase F1 sector, epsilon-subunit
          [Acinetobacter baumannii ATCC 17978]
 gi|213054723|gb|ACJ39625.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii AB0057]
 gi|213988033|gb|ACJ58332.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii
          AB307-0294]
 gi|260408759|gb|EEX02063.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii ATCC
          19606]
 gi|322506368|gb|ADX01822.1| atpC [Acinetobacter baumannii 1656-2]
 gi|323516236|gb|ADX90617.1| F0F1 ATP synthase subunit epsilon [Acinetobacter baumannii
          TCDC-AB0715]
 gi|332729123|gb|EGJ60470.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii
          6013150]
 gi|332732789|gb|EGJ64005.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii
          6013113]
 gi|332736206|gb|EGJ67221.1| ATP synthase F1, epsilon subunit [Acinetobacter baumannii
          6014059]
          Length = 139

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 4/84 (4%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVV 67
          ++VS ++ ++SG V  ++     G++ +L GHAP++T ++ G + + L    EEI    V
Sbjct: 7  DVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVLLENGTEEI--VYV 64

Query: 68 IGGICDIVPSHCTVLSETILPMDN 91
           GG+ ++ P   TVL++T +  DN
Sbjct: 65 SGGVLEVQPHVVTVLADTAIRADN 88


>gi|254369894|ref|ZP_04985903.1| ATP synthase epsilon chain [Francisella tularensis subsp.
          holarctica FSC022]
 gi|157122864|gb|EDO66981.1| ATP synthase epsilon chain [Francisella tularensis subsp.
          holarctica FSC022]
          Length = 145

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSP   VF GE   V L    G++ ++ GH  +L+T+ +G+V +    ++ H  V
Sbjct: 6  LKVDVVSPLGSVFKGEADMVSLRGSAGEMGIVYGHTELLSTLPAGVVNVR---KDQHTDV 62

Query: 67 --VIGGICDIVPSHCTVL 82
            V GGI ++ P+  T++
Sbjct: 63 LYVSGGIVEVTPTRVTIM 80


>gi|261856898|ref|YP_003264181.1| ATP synthase F1 subunit epsilon [Halothiobacillus neapolitanus c2]
 gi|261837367|gb|ACX97134.1| ATP synthase F1, epsilon subunit [Halothiobacillus neapolitanus c2]
          Length = 148

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 6/118 (5%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++VS EK +FSGE   V +P+E G++ V   H   L+ ++ G V +      + RY 
Sbjct: 5   IRVDIVSMEKPIFSGEATFVSIPTEAGEMGVTPMHTQTLSILRPGEVRVHQPDGTVVRYF 64

Query: 67  VIGGICDIVPSHCTVLSETILPMDNAC---LQALEKRIDEVCSDLNNICDVDQRFQME 121
           V  G+ ++ P   +++++  L   +A       LE ++ E  +    I D +QR Q++
Sbjct: 65  VGFGVLEVQPMVVSIIADWALTEADAQGIDAAELEAKLSEESA---MIADYEQRGQLD 119


>gi|159028801|emb|CAO89972.1| atpC [Microcystis aeruginosa PCC 7806]
          Length = 138

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P++ V+    + V+LPS  G + +L GHAP+LT +  G++ I    ++     V+GG
Sbjct: 7  VITPDRIVWDNVAEEVILPSSTGQLGILSGHAPLLTALNIGVMRIR-PGKDWENIAVLGG 65

Query: 71 ICDIVPSHCTVL 82
            ++  +   VL
Sbjct: 66 FAEVENNEIKVL 77


>gi|22797145|emb|CAD23961.1| ATP synthase epsilon subunit [Myoporum montanum]
          Length = 132

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EVQ ++L +  G I VL  HAP+ T +  GI+ I L  + +    ++GG
Sbjct: 6  VLTPNRIVWDSEVQEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLKDQWVT-MALMGG 64

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 65 FARIGNNEITVL 76


>gi|22795899|emb|CAD23905.1| ATP synthase epsilon subunit [Diospyros kaki]
          Length = 132

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L  ++  R  ++GG
Sbjct: 6  VLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLK-DQWLRMALMGG 64

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 65 FARIGNNDITIL 76


>gi|302035756|ref|YP_003796078.1| ATP synthase F1 subunit epsilon [Candidatus Nitrospira defluvii]
 gi|300603820|emb|CBK40152.1| ATP synthase F1, epsilon subunit [Candidatus Nitrospira defluvii]
          Length = 140

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   +  E+V+PEK + S EV  V+ P   G+  VL GH  +L++++ G +    + +  
Sbjct: 1  MAGKILLEVVTPEKLLLSQEVDEVIAPGSEGEFGVLPGHCHLLSSLRIGELRYK-TQDAW 59

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
          H   ++ G  ++ P+  TV++E
Sbjct: 60 HYMSILWGYAEVTPAKVTVMAE 81


>gi|86371638|gb|ABC94888.1| AtpE [Leucophyllum pringlei]
 gi|86371642|gb|ABC94890.1| AtpE [Leucophyllum candidum]
          Length = 134

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EVQ ++L +  G I VL  HAP+ T +  GI+ I L  + +    ++GG
Sbjct: 8  VLTPNRIVWDSEVQEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLKDQWVT-MALMGG 66

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 67 FARIGNNEITVL 78


>gi|86371636|gb|ABC94887.1| AtpE [Leucophyllum frutescens]
 gi|86371640|gb|ABC94889.1| AtpE [Leucophyllum pruinosum]
 gi|86371644|gb|ABC94891.1| AtpE [Leucophyllum laevigatum]
          Length = 135

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EVQ ++L +  G I VL  HAP+ T +  GI+ I L  + +    ++GG
Sbjct: 9  VLTPNRIVWDSEVQEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLKDQWVT-MALMGG 67

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 68 FARIGNNEITVL 79


>gi|225075915|ref|ZP_03719114.1| hypothetical protein NEIFLAOT_00939 [Neisseria flavescens
          NRL30031/H210]
 gi|224952771|gb|EEG33980.1| hypothetical protein NEIFLAOT_00939 [Neisseria flavescens
          NRL30031/H210]
          Length = 141

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + +++  E     V
Sbjct: 4  MQVEVVSSEQNIYSGEAGFVVVPTVQGELGIYPRHEPIMSLVRPGALRLTVPGEAEEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKITVLAD 82


>gi|325836757|ref|ZP_08166224.1| ATP synthase F1, epsilon subunit [Turicibacter sp. HGF1]
 gi|325491135|gb|EGC93424.1| ATP synthase F1, epsilon subunit [Turicibacter sp. HGF1]
          Length = 136

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI-G 69
          +V+P+K VF GE + +      GD  VL  H P++T +  G + I ++ E    Y+ I  
Sbjct: 8  VVTPDKLVFDGEAERIFARGIDGDFAVLYNHIPMMTPLGVGELRIDMNGE--SSYIAIDN 65

Query: 70 GICDIVPSHCTVLS 83
          GI ++  +H  VLS
Sbjct: 66 GIFEVSNNHVNVLS 79


>gi|149375665|ref|ZP_01893434.1| F0F1-type ATP synthase, epsilon subunit [Marinobacter algicola
          DG893]
 gi|149360067|gb|EDM48522.1| F0F1-type ATP synthase, epsilon subunit [Marinobacter algicola
          DG893]
          Length = 140

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  ++SG V+ ++     GD+ +  GH P+LT +K G + I     E     
Sbjct: 5  VHCDVVSAETKIYSGLVEMLIAAGSEGDLGIAPGHTPLLTQLKPGPIRIIKQGGEEEILY 64

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  ++ P+  T+L++T
Sbjct: 65 VSGGYLEVQPNLVTLLADT 83


>gi|46579187|ref|YP_009995.1| F0F1 ATP synthase subunit epsilon [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603239|ref|YP_967639.1| F0F1 ATP synthase subunit epsilon [Desulfovibrio vulgaris DP4]
 gi|60389679|sp|Q72E05|ATPE_DESVH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|166222455|sp|A1VFJ6|ATPE_DESVV RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|46448600|gb|AAS95254.1| ATP synthase, F1 epsilon subunit [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563468|gb|ABM29212.1| ATP synthase F1 subcomplex epsilon subunit [Desulfovibrio vulgaris
           DP4]
 gi|311233025|gb|ADP85879.1| ATP synthase F1, epsilon subunit [Desulfovibrio vulgaris RCH1]
          Length = 134

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 1/107 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           LH E+V+P+K V S +V  V  P   G+  VL  H P L+ +  G +    +  + H   
Sbjct: 5   LHLEIVTPDKLVLSEQVDYVGAPGFEGEFGVLPSHIPFLSALAIGSLYYKANG-KTHHVF 63

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICD 113
           V GG  ++  +  TVL+E+    ++  +    K  D     L  I +
Sbjct: 64  VSGGFAEVSDNKVTVLAESAERAEDIDIDRARKAKDRAEQRLAQIKE 110


>gi|22796294|emb|CAD23967.1| ATP synthase epsilon subunit [Grevea sp. Thulin et al. s.n.]
          Length = 132

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + ++  EV+ ++LPS  G I +L  HAP+ T +  GI+ I L+   +    ++GG
Sbjct: 6  VLTPNRIIWDSEVKEIILPSTSGQIGILPNHAPIATAVDIGILRIRLNDRWLT-MALMGG 64

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 65 FARIGNNEITIL 76


>gi|313199632|ref|YP_004021248.1| ATP synthase CF1 epsilon subunit [Isoetes flaccida]
 gi|291575361|gb|ADE18074.1| ATP synthase CF1 epsilon subunit [Isoetes flaccida]
          Length = 138

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V + EVQ ++L +  G I VL  HAP+LT +  GI+ + L+  +     
Sbjct: 3  LNLRVMAPNRTVRNSEVQEIILSTNSGQIGVLPNHAPLLTALDIGIMKVRLNG-QWSTMA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   +  +  T+L
Sbjct: 62 LMGGFAMMDNNQITIL 77


>gi|311696569|gb|ADP99442.1| ATP synthase epsilon chain [marine bacterium HP15]
          Length = 140

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  ++SG V+ ++     GD+ +  GH P+LT +K G + I     E     
Sbjct: 5  VHCDVVSAETKIYSGLVEMLIAAGSEGDLGIAPGHTPLLTQLKPGPIRIIKQGGEEEILY 64

Query: 67 VIGGICDIVPSHCTVLSET 85
          V GG  ++ P+  T+L++T
Sbjct: 65 VSGGYLEVQPNLVTLLADT 83


>gi|156741250|ref|YP_001431379.1| F0F1 ATP synthase subunit epsilon [Roseiflexus castenholzii DSM
          13941]
 gi|156232578|gb|ABU57361.1| ATP synthase F1, epsilon subunit [Roseiflexus castenholzii DSM
          13941]
          Length = 139

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 47/82 (57%), Gaps = 7/82 (8%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSG---IVTISLSCEEIH 63
          +H E+V+ E+ V S +V  +  P++ G + +L  HAP+LT ++ G   IV   ++     
Sbjct: 3  IHLEIVTAERVVLSDDVDMINAPTKDGRVGILPRHAPLLTILEIGELDIVKDGVTTP--- 59

Query: 64 RYVVIGGICDIVPSHCTVLSET 85
           + + GG  +++P   T+L++T
Sbjct: 60 -FAISGGFMEVLPHRVTILADT 80


>gi|227481125|emb|CAP62504.1| ATPase epsilon subunit [Ceratophyllum demersum]
          Length = 133

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + ++  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    
Sbjct: 3  LNLSVLTPNRIIWDSEVKEIILSTNSGKIGVLPNHAPIATAVDIGILRIRLNDQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  T+L
Sbjct: 62 LMGGFARIGNNEITIL 77


>gi|118603004|ref|YP_904219.1| F0F1 ATP synthase subunit epsilon [Candidatus Ruthia magnifica
          str. Cm (Calyptogena magnifica)]
 gi|166222491|sp|A1AXU1|ATPE_RUTMC RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|118567943|gb|ABL02748.1| ATP synthase F1 subcomplex epsilon subunit [Candidatus Ruthia
          magnifica str. Cm (Calyptogena magnifica)]
          Length = 138

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS  + ++SGEV  V  P+  G++ +   H  +L+ +K G V +  + + +    
Sbjct: 4  IHVDVVSATESLYSGEVSCVFAPASTGELGIYPKHTALLSILKPGEVRVE-TDKGVESIY 62

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          + GGI ++ P   T+ S+T +  DN
Sbjct: 63 ISGGIIEVQPDVVTIFSDTAIRADN 87


>gi|71842250|ref|YP_277338.1| ATP synthase CF1 epsilon subunit [Emiliania huxleyi]
 gi|122233606|sp|Q4G3C9|ATPE_EMIHU RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
           Full=ATP synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|60101493|gb|AAX13837.1| ATP synthase CF1 epsilon subunit [Emiliania huxleyi]
          Length = 130

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 8/112 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L+  +++P++ V+    + ++LPS  G + +L  HAP+LT +  G++ +      I  +V
Sbjct: 3   LNVRVITPDRIVWDANAEELILPSSTGQLGILTDHAPLLTALDIGVMRLKTGGNWIS-FV 61

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNACLQ-ALEK---RIDEVCSDLNNI 111
           ++ G  ++  +  T+L   +E    +D +  Q ALEK    +DE  +    I
Sbjct: 62  LMEGFAEVEDNKITILCNGAEEGASIDASTAQAALEKVTLLVDEAATKKEKI 113


>gi|159161166|ref|YP_001542453.1| ATP synthase CF1 epsilon subunit [Ceratophyllum demersum]
 gi|148508449|gb|ABQ81456.1| ATP synthase CF1 epsilon subunit [Ceratophyllum demersum]
          Length = 133

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + ++  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    
Sbjct: 3  LNLSVLTPNRIIWDSEVKEIILSTNSGKIGVLPNHAPIATAVDIGILRIRLNDQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  T+L
Sbjct: 62 LMGGFARIGNNEITIL 77


>gi|294668639|ref|ZP_06733735.1| ATP synthase F1, epsilon subunit [Neisseria elongata subsp.
          glycolytica ATCC 29315]
 gi|291309401|gb|EFE50644.1| ATP synthase F1, epsilon subunit [Neisseria elongata subsp.
          glycolytica ATCC 29315]
          Length = 165

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E  ++SGE   VV+P+  G++ +   H P+++ ++ G + + +  E+    V
Sbjct: 4  MRVEVVSNEYNIYSGEASFVVVPTVQGELGIYPRHEPIMSLVRPGALRLQIPGEKEEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKLTVLAD 82


>gi|260654861|ref|ZP_05860349.1| ATP synthase F1, epsilon subunit [Jonquetella anthropi E3_33 E1]
 gi|260630363|gb|EEX48557.1| ATP synthase F1, epsilon subunit [Jonquetella anthropi E3_33 E1]
          Length = 135

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 7/135 (5%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           +     ++V+P +  +SG  + +   S  G   VL GH P LT +  G V+  +  E   
Sbjct: 1   MKTFQLDIVTPRQLFYSGPAEQLSFQSVDGSYGVLPGHEPTLTALSEGEVSFVVDGE--W 58

Query: 64  RYVVIG-GICDIVPSHCTVLS-ETILP--MDNACLQALEKRIDEVCSDLNNICDV-DQRF 118
           RY V   G  +I+P +  +L+   + P  +D    Q  ++R  E      N  D    + 
Sbjct: 59  RYAVTSDGFVEIMPGYVRMLTMAAVRPEDIDAQRAQRAKERAQEQLKHQQNQQDYFRSQA 118

Query: 119 QMEQLLVDLSCLRRR 133
            + + L  L   RR+
Sbjct: 119 ALARALTRLKYARRK 133


>gi|160942704|ref|ZP_02089946.1| hypothetical protein FAEPRAM212_00180 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445978|gb|EDP22981.1| hypothetical protein FAEPRAM212_00180 [Faecalibacterium prausnitzii
           M21/2]
 gi|295104090|emb|CBL01634.1| ATP synthase F1 subcomplex epsilon subunit [Faecalibacterium
           prausnitzii SL3/3]
          Length = 132

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 61/129 (47%), Gaps = 8/129 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H  +V+P+ C F G+ + +V  +  GDI +L  H    T +  G   I  +  +  R  
Sbjct: 4   FHLTVVTPDGCAFEGQAERIVCRAIDGDIAILAKHGDYCTALGMGEAHIVDADGQRRRAA 63

Query: 67  VIGGICDIVPSHCTVLS---ETILPMDNACLQALEKRIDEVCSDLN-NICDVDQRFQMEQ 122
            +GG+  ++     +++   E    +D A  +A +KR +E+ +  N N    D+ +++ Q
Sbjct: 64  CMGGLLSVLDGDVRLVATTWEWAEDIDQARAEASKKRAEEILARKNLN----DREYELAQ 119

Query: 123 LLVDLSCLR 131
             +  + +R
Sbjct: 120 ARLKRALVR 128


>gi|56707244|ref|YP_169140.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110669714|ref|YP_666271.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          tularensis FSC198]
 gi|118498207|ref|YP_899257.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          novicida U112]
 gi|134301279|ref|YP_001121247.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|194324391|ref|ZP_03058164.1| ATP synthase F1, epsilon subunit [Francisella tularensis subsp.
          novicida FTE]
 gi|208780234|ref|ZP_03247576.1| ATP synthase F1, epsilon subunit [Francisella novicida FTG]
 gi|224456303|ref|ZP_03664776.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254369929|ref|ZP_04985937.1| ATP synthase [Francisella tularensis subsp. tularensis FSC033]
 gi|254375016|ref|ZP_04990496.1| hypothetical protein FTDG_01203 [Francisella novicida GA99-3548]
 gi|254874082|ref|ZP_05246792.1| atpC, ATP synthase epsilon chain [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|81677141|sp|Q5NIK2|ATPE_FRATT RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|119361433|sp|Q14K05|ATPE_FRAT1 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|166222459|sp|A0Q8D8|ATPE_FRATN RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|166222460|sp|A4IW25|ATPE_FRATW RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|56603736|emb|CAG44698.1| ATP synthase epsilon chain [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110320047|emb|CAL08081.1| ATP synthase epsilon chain [Francisella tularensis subsp.
          tularensis FSC198]
 gi|118424113|gb|ABK90503.1| ATP synthase, F1 sector, subunit epsilon [Francisella novicida
          U112]
 gi|134049056|gb|ABO46127.1| ATP synthase F1, epsilon subunit [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|151568175|gb|EDN33829.1| ATP synthase [Francisella tularensis subsp. tularensis FSC033]
 gi|151572734|gb|EDN38388.1| hypothetical protein FTDG_01203 [Francisella novicida GA99-3548]
 gi|194321456|gb|EDX18941.1| ATP synthase F1, epsilon subunit [Francisella tularensis subsp.
          novicida FTE]
 gi|208743883|gb|EDZ90185.1| ATP synthase F1, epsilon subunit [Francisella novicida FTG]
 gi|254840081|gb|EET18517.1| atpC, ATP synthase epsilon chain [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|282158353|gb|ADA77744.1| F0F1 ATP synthase subunit epsilon [Francisella tularensis subsp.
          tularensis NE061598]
 gi|332678942|gb|AEE88071.1| ATP synthase epsilon chain [Francisella cf. novicida Fx1]
          Length = 145

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSP   VF GE   V L    G++ +  GH  +L+T+ +G+V +    ++ H  V
Sbjct: 6  LKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVR---KDQHTDV 62

Query: 67 --VIGGICDIVPSHCTVL 82
            V GGI ++ P+  T++
Sbjct: 63 LYVSGGIVEVTPTRVTIM 80


>gi|115531921|ref|YP_784077.1| ATP synthase CF1 epsilon subunit [Pelargonium x hortorum]
 gi|122164273|sp|Q06FV4|ATPE_PELHO RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|112382075|gb|ABI17268.1| ATP synthase CF1 epsilon subunit [Pelargonium x hortorum]
          Length = 134

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 42/73 (57%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + ++  EV+ ++LP+  G I VL  HA ++TTI  G++ I    ++     ++GG
Sbjct: 7  VLTPNRILWDSEVKEIILPTNSGQIGVLPNHASIVTTIDIGVLRIRHFNDQWFTIALMGG 66

Query: 71 ICDIVPSHCTVLS 83
             I  +  T+L+
Sbjct: 67 FTRIRNNEITILA 79


>gi|33861995|ref|NP_893556.1| F0F1 ATP synthase subunit epsilon [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|60389723|sp|Q7TU42|ATPE_PROMP RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|33640363|emb|CAE19898.1| ATP synthase, Epsilon subunit [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 134

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 63/129 (48%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++++P + V+ G+ + V+LPS  G I VL GH  ++T I  G++ + ++  +     
Sbjct: 3   ISLKVLAPNQNVYEGDAEEVILPSTTGQIGVLPGHISLVTAIDIGVLRLRMNS-KWKSIA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  +I      VL  +        +Q  E  + +  S ++   + ++  +  + L +
Sbjct: 62  LMGGFAEIESDEVIVLVNSAEIGSEINIQNAEDALKKAKSAISKFPENEKSSEKIKALNE 121

Query: 127 LSCLRRRIQ 135
           +S    RIQ
Sbjct: 122 VSKAEARIQ 130


>gi|298373452|ref|ZP_06983441.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroidetes oral taxon 274 str. F0058]
 gi|298274504|gb|EFI16056.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Bacteroidetes oral taxon 274 str. F0058]
          Length = 79

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 31/47 (65%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIV 53
          +  E++SPEK +F GE ++V LP  +G  T++  HAP+++ +  G +
Sbjct: 1  MKIEIISPEKVLFRGEAEAVTLPGVMGSFTIMHNHAPIISILTKGTI 47


>gi|237751194|ref|ZP_04581674.1| H+transporting two-sector ATPase [Helicobacter bilis ATCC 43879]
 gi|229372560|gb|EEO22951.1| H+transporting two-sector ATPase [Helicobacter bilis ATCC 43879]
          Length = 124

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 63/123 (51%), Gaps = 9/123 (7%)

Query: 4   VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           + D   ++V+P   +F+G+V SV LP + G+  VL GH  +L  +++G++ I    E  H
Sbjct: 1   MQDFQLDIVTPYGEIFNGKVNSVYLPGKEGEFGVLPGHCDMLALLQTGVIDI--RSESGH 58

Query: 64  RYVVIG-GICDIVPSHCTVLSET---ILPMDNACLQALE---KRIDEVCSDLNNICDVDQ 116
             V I  G   I  +  +VL++    +   D+   +ALE   K +++  SD + I    +
Sbjct: 59  DLVAINWGHVSISNNKVSVLADGAVCVRGGDSKLSKALEQAKKLLEDASSDTSMIAGALR 118

Query: 117 RFQ 119
           + +
Sbjct: 119 KLE 121


>gi|295107519|emb|CBL05062.1| ATP synthase, F1 epsilon subunit (delta in mitochondria)
           [Gordonibacter pamelaeae 7-10-1-b]
          Length = 144

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHRYVVI 68
           + +P + +FSGE+    +P   G+  VL GH  ++     G++T+ +  +  E  R+ + 
Sbjct: 2   VATPTRELFSGEIAYADVPGSEGNYGVLSGHEMLVAKNSPGVLTLWMDAAGNEKRRFALY 61

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRID 102
            G   +     TVL+   + +DN   +A+ K+ D
Sbjct: 62  EGATQVYADRLTVLARFGVDVDNIDAEAVRKKAD 95


>gi|121720619|ref|YP_001001540.1| ATP synthase CF1 epsilon subunit [Nuphar advena]
 gi|69215464|gb|AAZ03837.1| ATP synthase CF1 epsilon chain [Nuphar advena]
 gi|84682210|gb|ABC60464.1| ATP synthase CF1 epsilon subunit [Nuphar advena]
          Length = 134

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + ++  EV+ ++L +  G I VL  HAPV T +  GI+ I L  + +    
Sbjct: 3  LNLSVLTPNRIIWDSEVKEIILSTNSGQIGVLPNHAPVATAVDIGILRIRLDDQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  T+L
Sbjct: 62 LMGGFARIGNNEITIL 77


>gi|305672559|gb|ADM63656.1| ATP synthase CF1 epsilon subunit [Grisollea myrianthea]
          Length = 129

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ +VL +  G I VL  HAP+ T +  GI+ I L+ ++     ++GG
Sbjct: 3  VLTPNRIVWDSEVKEIVLSTNSGKIGVLPNHAPIATAVDIGILRIRLN-DQWETLALMGG 61

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 62 FARIGNNEITVL 73


>gi|167627187|ref|YP_001677687.1| F0F1 ATP synthase subunit epsilon [Francisella philomiragia
          subsp. philomiragia ATCC 25017]
 gi|241667749|ref|ZP_04755327.1| F0F1 ATP synthase subunit epsilon [Francisella philomiragia
          subsp. philomiragia ATCC 25015]
 gi|254876293|ref|ZP_05249003.1| ATP synthase epsilon chain atpC [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|189081364|sp|B0TWS8|ATPE_FRAP2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|167597188|gb|ABZ87186.1| ATP synthase, F1 sector, subunit epsilon [Francisella
          philomiragia subsp. philomiragia ATCC 25017]
 gi|254842314|gb|EET20728.1| ATP synthase epsilon chain atpC [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 145

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSP   VF GE   V L    G++ +  GH  +L+T+ +G+V +    E      
Sbjct: 6  LKVDVVSPLGSVFKGEADIVSLRGSAGEMGIAYGHTELLSTLPAGVVNVR-KDEHTDVLY 64

Query: 67 VIGGICDIVPSHCTVLSETILPMDN 91
          V GGI ++ P+  T++ + +   +N
Sbjct: 65 VSGGIVEVTPTRVTIMVDDMERAEN 89


>gi|297493580|gb|ADI40512.1| mitochondrial H+-transporting ATP synthase F1 complex delta subunit
           [Miniopterus schreibersii]
          Length = 116

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 2/115 (1%)

Query: 9   FELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           F   SP +  F+G  V+ V +P++ G   +L  H P L  ++ G+V +        +Y V
Sbjct: 2   FTFASPTQVFFNGANVRQVDVPTQTGAFGILASHVPTLQVLRPGLVVVHAEDGTTSKYFV 61

Query: 68  IGGICDI-VPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
             G   +   S   +L+E  + +D   L A +  +++  S+L+   D   R +++
Sbjct: 62  SSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAHSELSGAADEAARAEIQ 116


>gi|22796599|emb|CAD23904.1| ATP synthase epsilon subunit [Impatiens capensis]
          Length = 133

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V++ EV  ++L +  G I VL  HAP+ T +  GI+ I L  + +   V++GG
Sbjct: 6  VLTPNRSVWNSEVNEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLKDQWLM-MVLMGG 64

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 65 FARIGNNEITVL 76


>gi|300858268|ref|YP_003783251.1| ATP synthase subunit epsilon [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300685722|gb|ADK28644.1| ATP synthase epsilon chain [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302205989|gb|ADL10331.1| F0F1 ATP synthase subunit epsilon [Corynebacterium
           pseudotuberculosis C231]
 gi|302330542|gb|ADL20736.1| F0F1 ATP synthase subunit epsilon [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276224|gb|ADO26123.1| F0F1 ATP synthase subunit epsilon [Corynebacterium
           pseudotuberculosis I19]
          Length = 123

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 6   DLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTT-IKSGIVTISLSCEEIHR 64
           D+  ELVS E+ ++SG+   V   +  G+I VL GH P+L   + +G+VTI     +   
Sbjct: 3   DITVELVSVERMLWSGQASIVTAQTTEGEIGVLPGHEPMLGQLVDNGVVTIRPVSGDKLV 62

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
             V GG   I     T+L+E  +  D       E    E  S L +    D   +  +  
Sbjct: 63  AAVQGGFLSISKEKVTILAEYAVWAD-------EVNASESESHLQD----DDAIEKARAQ 111

Query: 125 VDLSCLRRRIQ 135
            +L  LRR+ Q
Sbjct: 112 AELKALRRKEQ 122


>gi|254373551|ref|ZP_04989038.1| H(+)-transporting two-sector ATPase [Francisella tularensis
          subsp. novicida GA99-3549]
 gi|151571276|gb|EDN36930.1| H(+)-transporting two-sector ATPase [Francisella novicida
          GA99-3549]
          Length = 145

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSP   VF GE   V L    G++ +  GH  +L+T+ +G+V +    ++ H  V
Sbjct: 6  LKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVR---KDQHTDV 62

Query: 67 --VIGGICDIVPSHCTVL 82
            V GGI ++ P+  T++
Sbjct: 63 LYVSGGIVEVTPTRVTIM 80


>gi|288818389|ref|YP_003432737.1| ATP synthase F1 epsilon subunit [Hydrogenobacter thermophilus
          TK-6]
 gi|288787789|dbj|BAI69536.1| ATP synthase F1 epsilon subunit [Hydrogenobacter thermophilus
          TK-6]
 gi|308751982|gb|ADO45465.1| ATP synthase F1, epsilon subunit [Hydrogenobacter thermophilus
          TK-6]
          Length = 132

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          E+V+P+  VFS +V SV +P++ G+I VL  H  ++T +K G+  I     +     V  
Sbjct: 5  EIVTPQGVVFSRQVNSVNIPTQEGEIGVLERHMYLMTLLKPGL--IYFDGNQKDGIAVTY 62

Query: 70 GICDIVPSHCTVLSE 84
          G  DI P    +L+E
Sbjct: 63 GFVDITPERVIILAE 77


>gi|225848650|ref|YP_002728813.1| ATP synthase F1 subunit epsilon [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643273|gb|ACN98323.1| ATP synthase F1, epsilon subunit [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 134

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%)

Query: 9   FELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVI 68
            ++V+P   VF+GEV   V+ +  G+I +L  H  +LT I  G + I  +  E+    V 
Sbjct: 4   LDVVTPLGNVFNGEVYQTVITTADGEIGILENHMLLLTNITPGKLRIEKANGEVKEMAVT 63

Query: 69  GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDL 108
            GI D+       L E +  +D   ++  ++ ++E  S L
Sbjct: 64  YGILDVAGDKVIALVEEVYNLDEIDVENEKRLLEEANSKL 103


>gi|54113611|gb|AAV29439.1| NT02FT1773 [synthetic construct]
          Length = 145

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSP   VF GE   V L    G++ +  GH  +L+T+ +G+V +    ++ H  V
Sbjct: 6  LKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVR---KDQHTDV 62

Query: 67 --VIGGICDIVPSHCTVL 82
            V GGI ++ P+  T++
Sbjct: 63 LYVSGGIVEVTPTRVTIM 80


>gi|163782705|ref|ZP_02177701.1| ATP synthase F1 epsilon subunit [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881826|gb|EDP75334.1| ATP synthase F1 epsilon subunit [Hydrogenivirga sp. 128-5-R1-1]
          Length = 131

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 2/102 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  E+V+P+   FS EV SV +P+  G+I VL  H  ++T +K G+V       E     
Sbjct: 2   IRVEIVTPQGLSFSREVNSVNIPTAEGEIGVLQEHMYLMTLLKPGLV--YFDGNEKEGMA 59

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDL 108
           V  G+ D+ P    +L+E    + +  +   ++  +E    L
Sbjct: 60  VTYGVVDVTPEKVLILAEEAYEVGDIDVGKAKQEFEEAVKKL 101


>gi|225544130|ref|YP_002720118.1| atpE [Jatropha curcas]
 gi|224979571|gb|ACN72698.1| atpE [Jatropha curcas]
          Length = 133

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 7  VLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLNAKWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 66 FARIGNNEITVL 77


>gi|82754633|gb|ABB90047.1| ATP synthase CF1 epsilon chain [Solanum tuberosum]
          Length = 133

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+  +++P + V+  EV+ +VL +  G I +L  HAP+ T +  GI+ I L+ + +    
Sbjct: 3  LNLSVLTPNRIVWDSEVEEIVLFTNSGQIGILPNHAPIATAVDIGILRIRLNDQWLT-MA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG   I  +  TVL
Sbjct: 62 LMGGFARIGNNEITVL 77


>gi|22796629|emb|CAD23986.1| ATP synthase epsilon subunit [Helwingia japonica]
          Length = 129

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I LS + +    ++GG
Sbjct: 3  VLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLSDQWVT-MALMGG 61

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 62 FARIGNNEITVL 73


>gi|156618962|gb|ABU88158.1| ATP synthase CF1 epsilon subunit [Oedogonium cardiacum]
 gi|186968884|gb|ACC97207.1| CF1 epsilon subunit of ATP synthase [Oedogonium cardiacum]
          Length = 159

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 47/86 (54%), Gaps = 7/86 (8%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +++PE+  ++GE   ++LP+  G++ VL  HAP++T +  G + I  + +  + + ++GG
Sbjct: 31  IMTPERLFWNGESDEIILPTNTGEMGVLKNHAPIITGLDVGAMLIR-TAQGWNSFAIMGG 89

Query: 71  ICDIVPSHCTVL------SETILPMD 90
              I  +   +L       ETI P +
Sbjct: 90  FGIIGQNRVILLVNEAEFPETIDPQE 115


>gi|312142788|ref|YP_003994234.1| ATP synthase F1, epsilon subunit [Halanaerobium sp.
          'sapolanicus']
 gi|311903439|gb|ADQ13880.1| ATP synthase F1, epsilon subunit [Halanaerobium sp.
          'sapolanicus']
          Length = 143

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 1  MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
          M+    +  ++V+P+K +FSG++  +  P+  G I +L  HAP++T +K G+V IS   E
Sbjct: 1  MAEAPKIQLDVVTPQKLIFSGKIDKLEGPAIDGLIGILPRHAPLVTAMKIGVVRISKDEE 60

Query: 61 EIHRYVVIGGICDIVPSHCTVLSET 85
          E  +  +  G  ++ P    ++  T
Sbjct: 61 ET-QIAISDGFMEVQPDQINLVVRT 84


>gi|313112898|ref|ZP_07798544.1| ATP synthase F1, epsilon subunit [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310624803|gb|EFQ08112.1| ATP synthase F1, epsilon subunit [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 132

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 62/129 (48%), Gaps = 8/129 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H  +V+P+ C F G+ + +V  +  GD+ +L  H    T +  G   I  +  +  R  
Sbjct: 4   FHLTVVTPDGCAFDGQAERIVCRAIDGDLAILAKHGDYCTALGMGEAHIVDAEGQRRRAA 63

Query: 67  VIGGICDIVPSHCTVLS---ETILPMDNACLQALEKRIDEVCSDLNNICDVDQR-FQMEQ 122
            +GG+  ++     +++   E    +D A  +A +KR +E+ +  N    +D+R +++ Q
Sbjct: 64  CMGGLLSVLDGEVRLVATTWEWAEEIDQARAEASKKRAEEILAQKN----LDKRDYELAQ 119

Query: 123 LLVDLSCLR 131
             +  + +R
Sbjct: 120 ARLKRALVR 128


>gi|291234865|ref|XP_002737363.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F1 complex,
           delta subunit-like [Saccoglossus kowalevskii]
          Length = 170

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 7   LHFELVSPEKCVFS-GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           + F   +P +  ++  +V+ V +PS  GD  +L  H PVL+ ++ G V +  +     +Y
Sbjct: 39  MSFTFATPSEVYYNEADVKQVDVPSTTGDFGILAQHVPVLSVLRPGCVVVYDNDGNTEKY 98

Query: 66  VVIGGICDIV-PSHCTVLSETILPMDNACLQALEKRIDEVCSDLNN 110
            V  G   +   S   +L+E   P+D    QA E  + +   DL +
Sbjct: 99  FVSSGTITVNDDSSVQLLAEEATPIDQIDRQAAETGLSKAQQDLQS 144


>gi|154687795|ref|YP_001422956.1| F0F1 ATP synthase subunit epsilon [Bacillus amyloliquefaciens
           FZB42]
 gi|166222432|sp|A7Z9P9|ATPE_BACA2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|154353646|gb|ABS75725.1| AtpC [Bacillus amyloliquefaciens FZB42]
          Length = 132

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +   +V+P+  V+  +++ V + +E GD+ +L GH P +  +K G V +     +     
Sbjct: 4   VKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDG-QTELAA 62

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDV 114
           V GG  ++ P   T+L   +ET   +D     A +KR ++  +  ++  D+
Sbjct: 63  VSGGFLEVRPDQVTILAQAAETAESIDKERALAAKKRAEDRLNKRSDDTDI 113


>gi|183602789|ref|ZP_02964152.1| ATP synthase epsilon chain [Bifidobacterium animalis subsp.
          lactis HN019]
 gi|219683115|ref|YP_002469498.1| ATP synthase subunit epsilon [Bifidobacterium animalis subsp.
          lactis AD011]
 gi|241191444|ref|YP_002968838.1| F0F1 ATP synthase subunit epsilon [Bifidobacterium animalis
          subsp. lactis Bl-04]
 gi|241196850|ref|YP_002970405.1| F0F1 ATP synthase subunit epsilon [Bifidobacterium animalis
          subsp. lactis DSM 10140]
 gi|45593083|gb|AAS68127.1| ATP synthase epsilon subunit [Bifidobacterium animalis subsp.
          lactis DSM 10140]
 gi|183218027|gb|EDT88675.1| ATP synthase epsilon chain [Bifidobacterium animalis subsp.
          lactis HN019]
 gi|219620765|gb|ACL28922.1| ATP synthase epsilon subunit [Bifidobacterium animalis subsp.
          lactis AD011]
 gi|240249836|gb|ACS46776.1| F0F1 ATP synthase subunit epsilon [Bifidobacterium animalis
          subsp. lactis Bl-04]
 gi|240251404|gb|ACS48343.1| F0F1 ATP synthase subunit epsilon [Bifidobacterium animalis
          subsp. lactis DSM 10140]
 gi|289177570|gb|ADC84816.1| ATP synthase epsilon chain [Bifidobacterium animalis subsp.
          lactis BB-12]
 gi|295794437|gb|ADG33972.1| F0F1 ATP synthase subunit epsilon [Bifidobacterium animalis
          subsp. lactis V9]
          Length = 102

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +VS E+ V+SGE + VV+P+  G + +L GH PVL+ I+ G + ++    +   + V GG
Sbjct: 10 IVSSERPVWSGEAKQVVVPAYAGGMGILPGHEPVLSVIEEGRLDVTDPNGKKFSFEVTGG 69

Query: 71 ICDIVPSHCTVLSET 85
                +  TV  E 
Sbjct: 70 FISFDSNKLTVAVEN 84


>gi|57339740|gb|AAW49857.1| hypothetical protein FTT0065 [synthetic construct]
          Length = 180

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++VSP   VF GE   V L    G++ +  GH  +L+T+ +G+V +         YV
Sbjct: 32  LKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYV 91

Query: 67  VIGGICDIVPSHCTVL 82
             GGI ++ P+  T++
Sbjct: 92  S-GGIVEVTPTRVTIM 106


>gi|88797166|ref|ZP_01112756.1| F0F1-type ATP synthase, epsilon subunit [Reinekea sp. MED297]
 gi|88780035|gb|EAR11220.1| F0F1-type ATP synthase, epsilon subunit [Reinekea sp. MED297]
          Length = 139

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 50/80 (62%), Gaps = 2/80 (2%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCEEIHRY 65
          +H ++VS E+ VFSG V+ +V   E G++ +  GHAP+LT +  G V  I+ + +E   Y
Sbjct: 3  VHCDIVSAEEKVFSGLVEILVCTGEQGELGIKPGHAPLLTRLNPGPVHLITQNGKEEFIY 62

Query: 66 VVIGGICDIVPSHCTVLSET 85
           V GG  ++ P+  TVL++T
Sbjct: 63 -VDGGYLEVQPNVVTVLADT 81


>gi|330447621|ref|ZP_08311269.1| ATP synthase F1, epsilon subunit [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
 gi|328491812|dbj|GAA05766.1| ATP synthase F1, epsilon subunit [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
          Length = 147

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
              +VS E  +FSG   ++ +    G++ +  GH+P+L+ +K G+ +     ++    +
Sbjct: 10 FQLNIVSAEGPLFSGPAHALAISGSDGELGIRPGHSPLLSRLKPGVASFVTGLKDPEEIL 69

Query: 67 VI-GGICDIVPSHCTVLSETIL 87
           I GG+ ++ PS  TVL++T +
Sbjct: 70 YISGGLVEVQPSVVTVLADTAM 91


>gi|291561954|emb|CBL40762.1| ATP synthase F1 subcomplex epsilon subunit [butyrate-producing
           bacterium SS3/4]
          Length = 134

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 5/126 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +  ++V+P++  F GEV  V L +  G+  +   H P++  +  G++ I    + + +  
Sbjct: 5   MRLQIVTPDEAFFDGEVSMVELNTADGEAGIYPKHIPMVVAVAPGVLKIH-GADGVKKAA 63

Query: 67  VIGGICDIVPSHCTVLSET-ILPMDNACLQALEKRI--DEVCSDLNNICDVDQ-RFQMEQ 122
           ++ G   I+P   T+L+E    P +    +A E RI  +   ++ N   D+D+    +++
Sbjct: 64  LLSGFLQILPEKVTILAEACEWPENIDGKRANEARIRAERRLAEKNPQTDIDRAEAALKR 123

Query: 123 LLVDLS 128
            LV LS
Sbjct: 124 ALVRLS 129


>gi|294673900|ref|YP_003574516.1| ATP synthase F1 subunit epsilon [Prevotella ruminicola 23]
 gi|294472521|gb|ADE81910.1| ATP synthase F1, epsilon subunit [Prevotella ruminicola 23]
          Length = 80

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  ++VSPEK  F G V+SV++P  +G   +L  HAP+++T++ G V  + + E   +  
Sbjct: 2  LQLKIVSPEKIEFCGAVESVLVPGTMGQFEILQDHAPIISTLQCGTVEYT-TAEGKAQLE 60

Query: 67 VIGGICDI 74
          + GG  ++
Sbjct: 61 IQGGFVEV 68


>gi|254282564|ref|ZP_04957532.1| ATP synthase F1, epsilon subunit [gamma proteobacterium NOR51-B]
 gi|219678767|gb|EED35116.1| ATP synthase F1, epsilon subunit [gamma proteobacterium NOR51-B]
          Length = 142

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +H ++VS E  +FSG V+ +V     G++ +  GH P+LT +  G V +     E H Y 
Sbjct: 5  IHCDIVSAEAQIFSGMVEMLVATGAEGELGIHYGHTPLLTRLIPGPVRVVDQTGEEHIYY 64

Query: 67 VIGGICDIVPSHCTVLSET 85
            GG  ++  +  TVL++T
Sbjct: 65 ASGGFLEVQGNVVTVLADT 83


>gi|22796621|emb|CAD23966.1| ATP synthase epsilon subunit [Hydrolea ovata]
          Length = 132

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L+   ++P + V + EV+ ++L +  G I VL  HAP+ T +  GI+ I L    +    
Sbjct: 2  LNLXXLTPNRIVSNSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILKIRLKDRWLT-IA 60

Query: 67 VIGGICDIVPSHCTVL 82
          V+GGI  IV +   VL
Sbjct: 61 VMGGIARIVNNEIIVL 76


>gi|282892278|ref|ZP_06300674.1| hypothetical protein pah_c221o007 [Parachlamydia acanthamoebae
          str. Hall's coccus]
 gi|281497869|gb|EFB40220.1| hypothetical protein pah_c221o007 [Parachlamydia acanthamoebae
          str. Hall's coccus]
          Length = 83

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 43/76 (56%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +V+PEK V+ G+V S+  P E G   +L  HA ++ +++ G + I     E   + V GG
Sbjct: 6  IVTPEKKVYEGQVYSIKAPGEEGSFQILSHHASMIISLRKGEMIIEDPNHEKITFKVTGG 65

Query: 71 ICDIVPSHCTVLSETI 86
            ++  +  +VL+++I
Sbjct: 66 FLEVSHNKVSVLADSI 81


>gi|126662938|ref|ZP_01733936.1| H+-transporting two-sector ATPase, epsilon subunit [Flavobacteria
           bacterium BAL38]
 gi|126624596|gb|EAZ95286.1| H+-transporting two-sector ATPase, epsilon subunit [Flavobacteria
           bacterium BAL38]
          Length = 93

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 9/93 (9%)

Query: 10  ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
           E+VSPE  +F GEV SV +P   G+  +L  HAP+++ +  G V I+    +I +     
Sbjct: 4   EIVSPEATLFKGEVTSVSVPGVNGEFQMLNNHAPIVSLLTKGNVKINAQNIKIEK----- 58

Query: 70  GICDIVPSHCTVLSETI-LPMDNACLQALEKRI 101
              + V     V  +T  LP+++  L+  E +I
Sbjct: 59  ---EFVSKFNKVNEQTYWLPVNSGTLEMNENKI 88


>gi|332665056|ref|YP_004447844.1| ATPase, F1 complex, delta/epsilon subunit [Haliscomenobacter
          hydrossis DSM 1100]
 gi|332333870|gb|AEE50971.1| ATPase, F1 complex, delta/epsilon subunit [Haliscomenobacter
          hydrossis DSM 1100]
          Length = 101

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          ++  +++P++ +F+G ++S+ +P   G+  VL  HAP+++ + +G VTI  S  E +RY 
Sbjct: 1  MNITVLTPDREIFAGPIKSIKVPGVKGEFQVLQNHAPIVSALSAGKVTIVTSAGE-YRYY 59

Query: 67 VIG 69
           +G
Sbjct: 60 DLG 62


>gi|305672541|gb|ADM63647.1| ATP synthase CF1 epsilon subunit [Centranthus ruber]
          Length = 125

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 13 SPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGIC 72
          +P + V+  EV+ +VL +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG  
Sbjct: 1  TPNRTVWDSEVKEIVLATNSGQIGVLPNHAPIATAVDIGILRIRLNDQWVT-MALMGGFA 59

Query: 73 DIVPSHCTVL 82
           I  +  TVL
Sbjct: 60 RIGNNEITVL 69


>gi|269101118|ref|YP_003289266.1| ATP synthase CF1, subunit epsilon [Ectocarpus siliculosus]
 gi|266631626|emb|CAV31297.1| ATP synthase CF1, subunit epsilon [Ectocarpus siliculosus]
 gi|270118756|emb|CAT18847.1| ATP synthase CF1, subunit epsilon [Ectocarpus siliculosus]
          Length = 132

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 61/121 (50%), Gaps = 9/121 (7%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L+  +++P+  ++    + +VLPS  G + +L GHAP++T+++ GI+ I ++ +     +
Sbjct: 3   LNIRVIAPDGLIWDTTAEGIVLPSLTGQLGILTGHAPLITSLEIGILRIKVNSKWTP-II 61

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNA----CLQALEKRIDEVCSDLNNICDVDQRFQ 119
           V+GG   I+     VL    E ++  D A     L   +K +D +      I D  Q  +
Sbjct: 62  VLGGFAVIMNDEVQVLISGVEEVIKEDYAKAKDILSKAKKDLD-LAKTTKEIIDASQELK 120

Query: 120 M 120
           +
Sbjct: 121 I 121


>gi|268531582|ref|XP_002630918.1| Hypothetical protein CBG02643 [Caenorhabditis briggsae]
          Length = 164

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 5   NDLHFELVSPEKCVFSGEV-QSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
           ++L     SP+  VFS  V + V +P+  G + VL  H P +  +K G+VT++ +   + 
Sbjct: 30  DELRLTFASPDTAVFSNAVVKQVDVPTLAGMVGVLANHVPTIGVLKPGVVTVTTNEGTVQ 89

Query: 64  RYVVIGGICDI-VPSHCTVLSETILPMD 90
           R  V  G   + +   C VL+E +L ++
Sbjct: 90  RLFVSSGTLSVNIDGSCQVLAEEVLKVE 117


>gi|290490126|gb|ADD31470.1| ATP synthase CF1 epsilon subunit protein [Gunnera manicata]
          Length = 133

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P K V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 7  VLTPNKIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLNDQWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 66 FARIGNNEITVL 77


>gi|262376923|ref|ZP_06070150.1| ATP synthase F1, epsilon subunit [Acinetobacter lwoffii SH145]
 gi|262308268|gb|EEY89404.1| ATP synthase F1, epsilon subunit [Acinetobacter lwoffii SH145]
          Length = 139

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 47/82 (57%)

Query: 10 ELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIG 69
          ++VS ++ ++SG V  ++     G++ ++ GHAP++T ++ G + + L         V G
Sbjct: 7  DVVSVQESLYSGTVTMLIAKGAGGELGIMPGHAPLVTLLQPGAIRVILENGTEELIYVSG 66

Query: 70 GICDIVPSHCTVLSETILPMDN 91
          G+ ++ P   TVL++T +  DN
Sbjct: 67 GVLEVQPHVVTVLADTAIRADN 88


>gi|294055642|ref|YP_003549300.1| ATP synthase F1, epsilon subunit [Coraliomargarita akajimensis
          DSM 45221]
 gi|293614975|gb|ADE55130.1| ATP synthase F1, epsilon subunit [Coraliomargarita akajimensis
          DSM 45221]
          Length = 137

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  E+++P+  V S E   VVLP+E G+  +L GH P++T + +G + + +         
Sbjct: 3  LTLEIITPDDKVLSTEADQVVLPTESGETGILTGHIPLVTKLVAGELKV-IKGAGTEYIA 61

Query: 67 VIGGICDIVPSHCTVLSETILPMDNACLQALE 98
          V  G   ++ +  +VL+E  + +D   L  +E
Sbjct: 62 VSSGFAKVIGNTISVLTEAAVDVDEIDLSEVE 93


>gi|281423289|ref|ZP_06254202.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella oris F0302]
 gi|281402625|gb|EFB33456.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella oris F0302]
          Length = 80

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 38/67 (56%)

Query: 8  HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
          H  +VSPE+ VF GEV  V +P  +G+  +L  HAP++++++ G +       +     +
Sbjct: 3  HLRVVSPERVVFDGEVMCVTVPGAMGEFEILEHHAPIISSLEKGHIVYQPLDSQKETLDI 62

Query: 68 IGGICDI 74
          +GG  ++
Sbjct: 63 LGGFVEV 69


>gi|256831127|ref|YP_003159855.1| ATP synthase F1 subunit epsilon [Desulfomicrobium baculatum DSM
          4028]
 gi|256580303|gb|ACU91439.1| ATP synthase F1, epsilon subunit [Desulfomicrobium baculatum DSM
          4028]
          Length = 142

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +   +  E+V+P+K V   EV  V  P   G+  VL  H P L+ +  G +   L+ ++ 
Sbjct: 1  MAKTITLEIVTPDKMVLKEEVDYVGAPGINGEFGVLPNHIPFLSALGIGSLYYKLNGKKY 60

Query: 63 HRYVVIGGICDIVPSHCTVLSE 84
            +V  GG  ++ P+  TVL+E
Sbjct: 61 FVFVA-GGFAEVSPAKVTVLAE 81


>gi|261253520|ref|ZP_05946093.1| ATP synthase epsilon chain [Vibrio orientalis CIP 102891]
 gi|260936911|gb|EEX92900.1| ATP synthase epsilon chain [Vibrio orientalis CIP 102891]
          Length = 148

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 3/87 (3%)

Query: 4  VNDLHFEL--VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVT-ISLSCE 60
          VN+  FEL  VS E  +FSG   ++ +    G++ +   H+P+++ IK GI + +S   +
Sbjct: 5  VNENTFELQIVSAEGTLFSGPAHALAISGASGELGIRPQHSPLISKIKPGIASFVSDIKK 64

Query: 61 EIHRYVVIGGICDIVPSHCTVLSETIL 87
          E     + GG+ ++ P   TVL++T+L
Sbjct: 65 EPSILYISGGMLEVQPDVVTVLADTVL 91


>gi|222151999|ref|YP_002561159.1| ATP synthase F1 epsilon subunit [Macrococcus caseolyticus
          JCSC5402]
 gi|254809372|sp|B9E8E5|ATPE_MACCJ RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|222121128|dbj|BAH18463.1| ATP synthase F1 epsilon subunit [Macrococcus caseolyticus
          JCSC5402]
          Length = 136

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 4  VNDLHFELVSPEKCVFS-GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62
          +N L  E+V+P   ++S  E + +VL +E G++ V+ GH P +  +K G V ++    + 
Sbjct: 1  MNKLAIEIVTPNGSIYSETEAELIVLQTESGEMGVMAGHIPTVAPLKIGAVRVTKPGNDK 60

Query: 63 HRYVVIGGICDIVPSHCTVL 82
              V  G  +I P   +VL
Sbjct: 61 DYIAVTEGFAEIRPQQVSVL 80


>gi|210634565|ref|ZP_03298161.1| hypothetical protein COLSTE_02083 [Collinsella stercoris DSM 13279]
 gi|210158750|gb|EEA89721.1| hypothetical protein COLSTE_02083 [Collinsella stercoris DSM 13279]
          Length = 132

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI--HR 64
           +   +VSPE+CVF G V  V +PS  G+  +L  HA  + TI+SG + +S     +    
Sbjct: 3   MKLRVVSPEECVFEGMVAYVAVPSTAGEFGILPHHASEICTIESGRIRVSEQQMGVTDRV 62

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQR 117
           + V  G   +      VL+   +      ++ +  R+ ++ S +  + + D R
Sbjct: 63  FAVEDGYVQVANDEVIVLATRAIDTSKVDVEEVAARLSDLESQMGKMSENDGR 115


>gi|307327920|ref|ZP_07607102.1| ATP synthase F1, epsilon subunit [Streptomyces violaceusniger Tu
          4113]
 gi|306886438|gb|EFN17442.1| ATP synthase F1, epsilon subunit [Streptomyces violaceusniger Tu
          4113]
          Length = 125

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          +  +LH ELV+ ++ V+SG    V+  +  GDI V+ GH P+L  ++SG VTI
Sbjct: 1  MAAELHVELVAADRSVWSGAATLVIARTTSGDIGVMPGHQPLLGVLESGPVTI 53


>gi|262277908|ref|ZP_06055701.1| ATP synthase F1, epsilon subunit [alpha proteobacterium HIMB114]
 gi|262225011|gb|EEY75470.1| ATP synthase F1, epsilon subunit [alpha proteobacterium HIMB114]
          Length = 127

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 55/107 (51%), Gaps = 6/107 (5%)

Query: 7   LHFELVSPEKCVFS-GEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRY 65
           +  ++V+PEK +FS  ++  V +P   G + +L  H PV+T +K G++ I  S  E   +
Sbjct: 1   MQVDIVTPEKVLFSEKDISMVTIPGIEGQMGILDNHLPVVTFLKPGVINIEKS--ENKYF 58

Query: 66  VVIGGICDIVPSHCTVLSETILPMDNAC---LQALEKRIDEVCSDLN 109
              GG+ D   +  ++L + +  + +     +  L++R ++   D N
Sbjct: 59  FTTGGVVDFKNNSLSILCQEVFDVKDFSDKQINNLKERANKKLEDTN 105


>gi|305672489|gb|ADM63621.1| ATP synthase CF1 epsilon subunit [Dampiera diversifolia]
          Length = 129

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P K V+  EV+ ++L +  G I +L  HAP+ T +  GI+ I L+ ++     ++GG
Sbjct: 3  VLTPNKIVWDSEVKEIILSTNSGQIGILPNHAPIATAVDIGILRIRLN-DQWSTMALMGG 61

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 62 FARIGNNEITVL 73


>gi|116071286|ref|ZP_01468555.1| ATP synthase subunit epsilon [Synechococcus sp. BL107]
 gi|116066691|gb|EAU72448.1| ATP synthase subunit epsilon [Synechococcus sp. BL107]
          Length = 136

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++P++ VF G    V+LPS  G + +L GH  +LT I  G++ +  +    +   
Sbjct: 3  LTLRVLAPDQNVFDGSADEVILPSTTGQLGILTGHISMLTAIDVGVLRVRANG-SWNSIA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG  ++     TVL
Sbjct: 62 LMGGFAEVDSDEVTVL 77


>gi|295101399|emb|CBK98944.1| ATP synthase F1 subcomplex epsilon subunit [Faecalibacterium
           prausnitzii L2-6]
          Length = 133

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
            H  +V+P+ C F G+ + VV  +  GD+ +L  H    T +  G   I  +     R  
Sbjct: 4   FHLTVVTPDGCAFEGQAERVVCRAIDGDLAILAKHGDYCTALGMGEAHIVDAEGSRRRAA 63

Query: 67  VIGGICDIVPSHCTVLS---ETILPMDNACLQALEKRIDEVCSDLNNICDVDQR-FQMEQ 122
            +GG+  ++     +++   E    +D+   +A +KR +E+ +  N    +D+R ++M Q
Sbjct: 64  CMGGMLTVLDGEVRLVATTWEWAEQIDHTRAEAAKKRAEEILARKN----LDRREYEMAQ 119

Query: 123 LLVDLSCLRRRIQ 135
             +  + +R  I+
Sbjct: 120 ARLKRALVRTSIK 132


>gi|22797523|emb|CAD23932.1| ATP synthase epsilon subunit [Pyrenacantha grandifolia]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ +VL +  G I +L  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 6  VLTPNRIVWDSEVKEIVLSTNNGQIGILPNHAPIATAVDIGILKIRLNSQWLT-MALMGG 64

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 65 FARIGKNEITIL 76


>gi|22797515|emb|CAD23920.1| ATP synthase epsilon subunit [Styrax officinalis]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V++ EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 6  VLTPNRIVWNSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLNDQWLT-MALMGG 64

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 65 FARIGNNEITVL 76


>gi|251771543|gb|EES52120.1| ATP synthase F1, epsilon subunit [Leptospirillum ferrodiazotrophum]
          Length = 144

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 63/129 (48%), Gaps = 9/129 (6%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           L++ E+ + + EV  V      G+  VL GH P +T +  G + +    E ++ Y V GG
Sbjct: 7   LLTQERVLVTEEVDFVKAKGVDGEFGVLTGHTPFITLLDPGELVVR-KGETLYSYYVSGG 65

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALE---KRIDEVCSDLNNICDVDQR---FQMEQLL 124
           + +++P    VL+ T+   D   +Q  +   K  +E  S    I ++++R    ++++  
Sbjct: 66  VAEVLPKSMIVLANTVERADEIDMQMAQTARKNAEEALS--KPISEIERRTYLLELKREN 123

Query: 125 VDLSCLRRR 133
           V LS   RR
Sbjct: 124 VRLSIAARR 132


>gi|139388916|ref|YP_001123643.1| ATP synthase CF1 epsilon subunit [Lepidium virginicum]
 gi|134286846|dbj|BAF50467.1| ATPase epsilon subunit [Lepidium virginicum]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 7  VLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILKIRLNNQWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 66 FARIGNNEITIL 77


>gi|116750007|ref|YP_846694.1| ATP synthase F1 subunit epsilon [Syntrophobacter fumaroxidans
          MPOB]
 gi|166222503|sp|A0LLF7|ATPE_SYNFM RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|116699071|gb|ABK18259.1| ATP synthase F1, epsilon subunit [Syntrophobacter fumaroxidans
          MPOB]
          Length = 134

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 9/85 (10%)

Query: 3  LVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI----SLS 58
          +   +  E+V+PEK V S  V  VV P + G+  VL  H P L+ +K G +      +L 
Sbjct: 1  MAEKIKLEIVTPEKKVLSEMVDIVVAPGQEGEFGVLPHHIPFLSKLKVGELRYRIGQTLR 60

Query: 59 CEEIHRYVVIGGICDIVPSHCTVLS 83
          C       ++GG  +++P   T+L+
Sbjct: 61 C-----VAIMGGYAEVLPDQVTILA 80


>gi|299140471|ref|ZP_07033609.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella oris C735]
 gi|298577437|gb|EFI49305.1| ATP synthase, Delta/Epsilon chain, beta-sandwich domain protein
          [Prevotella oris C735]
          Length = 80

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 8  HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
          H  +VSPE+ VF GEV  V +P  +G+  +L  HAP++++++ G +       +     V
Sbjct: 3  HLRVVSPERVVFDGEVMCVTVPGAMGEFEILEHHAPIISSLEKGHIVYQPLDGQKETLDV 62

Query: 68 IGGICDI 74
          +GG  ++
Sbjct: 63 LGGFVEV 69


>gi|239905120|ref|YP_002951859.1| ATP synthase epsilon chain [Desulfovibrio magneticus RS-1]
 gi|239794984|dbj|BAH73973.1| ATP synthase epsilon chain [Desulfovibrio magneticus RS-1]
          Length = 134

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L  E+V+P+K V S +V  V  P  LG+  V+  H P L+ +  GI ++         YV
Sbjct: 4  LRLEIVTPDKLVLSQDVDYVGAPGLLGEFGVMANHIPFLSAL--GIGSLMYKVGGKANYV 61

Query: 67 -VIGGICDIVPSHCTVLSE 84
           V GG  ++  +  T+L+E
Sbjct: 62 FVAGGFAEVSGNKVTILAE 80


>gi|218767496|ref|YP_002342008.1| F0F1 ATP synthase subunit epsilon [Neisseria meningitidis Z2491]
 gi|20137496|sp|Q9JW69|ATPE_NEIMA RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|121051504|emb|CAM07797.1| ATP synthase epsilon chain [Neisseria meningitidis Z2491]
          Length = 140

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          +  E+VS E+ ++SGE   +V+P+  G++ +   H P+++ ++ G + +++  E+    V
Sbjct: 4  MQVEVVSSEQKIYSGEATFIVVPTVQGELGIYPRHEPIMSLVRLGALRLTVLGEDKEVLV 63

Query: 67 VI-GGICDIVPSHCTVLSE 84
           + GG+ ++ P   TVL++
Sbjct: 64 AVSGGVLEVQPDKVTVLAD 82


>gi|319956204|ref|YP_004167467.1| ATP synthase f1 subcomplex epsilon subunit [Nitratifractor
          salsuginis DSM 16511]
 gi|319418608|gb|ADV45718.1| ATP synthase F1 subcomplex epsilon subunit [Nitratifractor
          salsuginis DSM 16511]
          Length = 129

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 35/52 (67%)

Query: 4  VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          +N +  E+V+P   ++ G+V+ V LP + G+  VL GHA +++ + +G++TI
Sbjct: 1  MNTMKLEIVTPNGLIYEGDVKMVTLPGKEGEFGVLPGHASLVSLLDTGVITI 52


>gi|148245073|ref|YP_001219767.1| F0F1 ATP synthase subunit epsilon [Candidatus Vesicomyosocius
           okutanii HA]
 gi|166222508|sp|A5CVI5|ATPE_VESOH RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|146326900|dbj|BAF62043.1| F0F1-type ATP synthase epsilon subunit [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 138

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 58/108 (53%), Gaps = 5/108 (4%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +H ++VS  + ++SGEV  V  P+  G++ +   H  +L+ +K G V I  + + I    
Sbjct: 4   IHVDVVSATESLYSGEVLCVFAPASTGELGIYPKHTALLSILKPGEVRIE-TDKGIESIY 62

Query: 67  VIGGICDIVPSHCTVLSETILPMDN----ACLQALEKRIDEVCSDLNN 110
           V GGI ++ P   T+ S+T +  ++      L+A ++  DE+ + ++ 
Sbjct: 63  VSGGIVEVQPDVVTIFSDTAIRANDLDEFKVLEAKQRAQDEMDNSIDT 110


>gi|220919581|ref|YP_002494885.1| ATP synthase F1, epsilon subunit [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|254809342|sp|B8JCU9|ATPE_ANAD2 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
           synthase F1 sector epsilon subunit; AltName:
           Full=F-ATPase epsilon subunit
 gi|219957435|gb|ACL67819.1| ATP synthase F1, epsilon subunit [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 1/115 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L  ++V+PEK V S +V  V  P   G   V + H P +T ++ G +T      E H Y 
Sbjct: 3   LTLDIVTPEKRVLSVQVDEVRAPGVQGGFGVRLNHEPFMTALEPGRLTYVEGGRE-HHYA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
           V GG   +  +   VL++T        +    K  ++  + L  + + D+    E
Sbjct: 62  VGGGFLQVADNRVIVLADTAEAAGEIDVDRARKAFEDAQNRLLQLTEQDESHSAE 116


>gi|139387258|ref|YP_001123379.1| ATP synthase CF1 epsilon subunit [Capsella bursa-pastoris]
 gi|139388100|ref|YP_001123292.1| ATPase epsilon subunit [Barbarea verna]
 gi|139389102|ref|YP_001123820.1| ATP synthase CF1 epsilon subunit [Nasturtium officinale]
 gi|139389424|ref|YP_001123121.1| ATP synthase CF1 epsilon subunit [Olimarabidopsis pumila]
 gi|139389648|ref|YP_001123205.1| ATPase epsilon subunit [Arabis hirsuta]
 gi|139389807|ref|YP_001123468.1| ATP synthase CF1 epsilon subunit [Crucihimalaya wallichii]
 gi|139389956|ref|YP_001123556.1| ATPase epsilon subunit [Draba nemorosa]
 gi|139390158|ref|YP_001123731.1| ATP synthase CF1 epsilon subunit [Lobularia maritima]
 gi|134286318|dbj|BAF49945.1| ATPase epsilon subunit [Olimarabidopsis pumila]
 gi|134286403|dbj|BAF50029.1| ATPase epsilon subunit [Arabis hirsuta]
 gi|134286491|dbj|BAF50116.1| ATPase epsilon subunit [Barbarea verna]
 gi|134286579|dbj|BAF50203.1| ATPase epsilon subunit [Capsella bursa-pastoris]
 gi|134286669|dbj|BAF50292.1| ATPase epsilon subunit [Crucihimalaya wallichii]
 gi|134286758|dbj|BAF50380.1| ATPase epsilon subunit [Draba nemorosa]
 gi|134286935|dbj|BAF50555.1| ATPase epsilon subunit [Lobularia maritima]
 gi|134287025|dbj|BAF50644.1| ATPase epsilon subunit [Nasturtium officinale]
 gi|262400758|gb|ACY66247.1| ATP synthase CF1 epsilon subunit [Brassica napus]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 7  VLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILKIRLNNQWLT-MALMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 66 FARIGNNEITIL 77


>gi|32480849|ref|NP_862760.1| ATP synthase CF1 epsilon subunit [Calycanthus floridus var.
          glaucus]
 gi|60389749|sp|Q7YJW6|ATPE_CALFG RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|32399385|emb|CAD28727.1| ATPase epsilon subunit [Calycanthus floridus var. glaucus]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + ++  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    V+GG
Sbjct: 7  VLTPNRIIWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLNGQWLM-MAVMGG 65

Query: 71 ICDIVPSHCTVL 82
             I  +  T+L
Sbjct: 66 FARIGNNEITIL 77


>gi|22796296|emb|CAD23982.1| ATP synthase epsilon subunit [Griselinia littoralis]
          Length = 126

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 12 VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGI 71
          ++P + V+  EV+ ++L +  G I VL  HAP+ T I  GI+ I L+ + +    ++GG 
Sbjct: 1  LTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAIDIGILRIRLNDQWLT-MALMGGF 59

Query: 72 CDIVPSHCTVL 82
            I  +  TVL
Sbjct: 60 ARIGNNEITVL 70


>gi|270267292|ref|YP_002000404.2| ATP synthase CF1 epsilon subunit [Oedogonium cardiacum]
          Length = 135

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 47/86 (54%), Gaps = 7/86 (8%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++PE+  ++GE   ++LP+  G++ VL  HAP++T +  G + I  + +  + + ++GG
Sbjct: 7  IMTPERLFWNGESDEIILPTNTGEMGVLKNHAPIITGLDVGAMLIR-TAQGWNSFAIMGG 65

Query: 71 ICDIVPSHCTVL------SETILPMD 90
             I  +   +L       ETI P +
Sbjct: 66 FGIIGQNRVILLVNEAEFPETIDPQE 91


>gi|305672519|gb|ADM63636.1| ATP synthase CF1 epsilon subunit [Gomphandra javanica]
          Length = 129

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ +VL +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 3  VLTPNRIVWDSEVKEIVLSTNSGKIGVLPNHAPIATAVDIGILRIRLNDQWVT-MALMGG 61

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 62 FARIGNNEITVL 73


>gi|299136423|ref|ZP_07029606.1| ATP synthase F1, epsilon subunit [Acidobacterium sp. MP5ACTX8]
 gi|298600938|gb|EFI57093.1| ATP synthase F1, epsilon subunit [Acidobacterium sp. MP5ACTX8]
          Length = 144

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 1/110 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           L   LV+P++ +      +V LPS  G +  L G AP+L  + +G V +         + 
Sbjct: 11  LQVRLVTPDRVLLDATAAAVELPSMSGYLEALYGAAPLLAELGAGEVRLHGGTAGEQIFF 70

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQ 116
           V  G  +++P   T+L+ET L  +   L   E  +     +L N    DQ
Sbjct: 71  VAWGFVEVLPERVTILAETALHPEEIDLAEAESELKH-SQELWNEAGDDQ 119


>gi|304322938|ref|YP_003795497.1| CF1 epsilon subunit of ATP synthase [Floydiella terrestris]
 gi|270048137|gb|ACZ58432.1| CF1 epsilon subunit of ATP synthase [Floydiella terrestris]
          Length = 136

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/125 (20%), Positives = 62/125 (49%), Gaps = 8/125 (6%)

Query: 11  LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
           +++PE+  ++G+ + +VLP+  G++ VL  HAP++T +  G + +  + E  + + ++GG
Sbjct: 7   IMTPERIFWNGQSEEIVLPTNTGEMGVLKNHAPIITGLDVGAMLVR-TKEGWNSFAIMGG 65

Query: 71  ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCL 130
              +  +   +L       +    ++ E  ++   + L +  D  Q+       V+ +C 
Sbjct: 66  FGIVGQNRVILLVNAAESSETINAESAENDLNTAKTALQDAKDPKQQ-------VEANCA 118

Query: 131 RRRIQ 135
            +R +
Sbjct: 119 FKRAK 123


>gi|315639291|ref|ZP_07894453.1| ATP synthase F1 sector epsilon subunit [Campylobacter upsaliensis
          JV21]
 gi|315480617|gb|EFU71259.1| ATP synthase F1 sector epsilon subunit [Campylobacter upsaliensis
          JV21]
          Length = 130

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 33/49 (67%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55
          ++ E+V+P   ++ GEV+SV LP   G+  VL GH  ++ ++KSG++ +
Sbjct: 5  INIEIVTPLGMIYQGEVKSVTLPGSEGEFGVLKGHTTLVASLKSGVIDV 53


>gi|108796902|ref|YP_636200.1| ATP synthase CF1 epsilon subunit [Pseudendoclonium akinetum]
 gi|122227093|sp|Q3ZJ67|ATPE_PSEAK RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName:
          Full=ATP synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|56159600|gb|AAV80624.1| CF1 epsilon subunit of ATP synthase [Pseudendoclonium akinetum]
          Length = 130

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P++  ++ E + ++LP+  G + VL  HAP++T +  GI++I  + ++     ++GG
Sbjct: 7  ILTPDRVFWNQEAEEIILPTNTGQMGVLTNHAPIITALDIGIMSIR-TQKDWTSVALMGG 65

Query: 71 ICDIVPSHCTVL 82
             +  +  TVL
Sbjct: 66 FALVKQNQVTVL 77


>gi|78184080|ref|YP_376515.1| F0F1 ATP synthase subunit epsilon [Synechococcus sp. CC9902]
 gi|119367802|sp|Q3AZK6|ATPE_SYNS9 RecName: Full=ATP synthase epsilon chain; AltName: Full=ATP
          synthase F1 sector epsilon subunit; AltName:
          Full=F-ATPase epsilon subunit
 gi|78168374|gb|ABB25471.1| H+-transporting two-sector ATPase, delta/epsilon subunit
          [Synechococcus sp. CC9902]
          Length = 136

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 7  LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
          L   +++P++ VF G    V+LPS  G + +L GH  +LT I  G++ +  +    +   
Sbjct: 3  LTLRVLAPDQNVFDGSADEVILPSTTGQLGILTGHISMLTAIDVGVLRVRANG-SWNSIA 61

Query: 67 VIGGICDIVPSHCTVL 82
          ++GG  ++     TVL
Sbjct: 62 LMGGFAEVDSDEVTVL 77


>gi|22797838|emb|CAD24005.1| ATP synthase epsilon subunit [Valeriana hirtella]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 11 LVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGG 70
          +++P + V+  EV+ ++L +  G I VL  HAP+ T +  GI+ I L+ + +    ++GG
Sbjct: 6  VLTPNRTVWDSEVKEIILATNSGQIGVLPNHAPIATAVDIGILRIRLNDQWVT-MALMGG 64

Query: 71 ICDIVPSHCTVL 82
             I  +  TVL
Sbjct: 65 FARIGNNEITVL 76


>gi|308175408|ref|YP_003922113.1| ATP synthase subunit epsilon, F1 subunit [Bacillus
           amyloliquefaciens DSM 7]
 gi|307608272|emb|CBI44643.1| ATP synthase (subunit epsilon, F1 subunit) [Bacillus
           amyloliquefaciens DSM 7]
 gi|328555386|gb|AEB25878.1| F0F1 ATP synthase subunit epsilon [Bacillus amyloliquefaciens
           TA208]
 gi|328913757|gb|AEB65353.1| ATP synthase (subunit epsilon, F1 subunit) [Bacillus
           amyloliquefaciens LL3]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +   +V+P+  V+  +++ V + +E GD+ +L GH P +  +K G V +     +     
Sbjct: 4   VKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDG-QTDLAA 62

Query: 67  VIGGICDIVPSHCTVL---SETILPMDNACLQALEKRIDEVCSDLNNICDV 114
           V GG  ++ P   T+L   +ET   +D     A +KR ++  +  ++  D+
Sbjct: 63  VSGGFLEVRPDQVTILAQAAETADSIDKERALAAKKRAEDRLNKRSDDTDI 113


>gi|297493582|gb|ADI40513.1| mitochondrial H+-transporting ATP synthase F1 complex delta subunit
           [Cynopterus sphinx]
 gi|297493584|gb|ADI40514.1| mitochondrial H+-transporting ATP synthase F1 complex delta subunit
           [Rousettus leschenaultii]
          Length = 117

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 54/115 (46%), Gaps = 2/115 (1%)

Query: 9   FELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67
           F   SP +  F+G  V+ V +P++ G   +L  H P L  ++ G+V +        +Y V
Sbjct: 2   FTFASPTQVFFNGANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFV 61

Query: 68  IGGICDI-VPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQME 121
             G   +   S   +L+E  + +D   L A +  +++  ++L+   D   R +++
Sbjct: 62  SSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELSGAADEAARAEIQ 116


>gi|332969728|gb|EGK08742.1| ATP synthase F1 sector epsilon subunit [Kingella kingae ATCC 23330]
          Length = 140

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISL--SCEEIHR 64
           +  E+VS E+ ++SGE   VV+P+  G++ +   H P+++ ++ G + ++   S EE+  
Sbjct: 4   MRVEVVSNEEHIYSGEASFVVVPTVNGELGIYPRHEPIMSLVRPGALRVTQVGSAEEVL- 62

Query: 65  YVVIGGICDIVPSHCTVLSETIL---PMDNACLQALEKRIDE 103
             V GG+ ++ P   T+L++  +    MD A  +   KR+ E
Sbjct: 63  VAVSGGVLEVRPDTITILADVAVRSSEMDQARAEEA-KRVAE 103


>gi|305672573|gb|ADM63663.1| ATP synthase CF1 epsilon subunit [Pennantia cunninghamii]
          Length = 126

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 12 VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGI 71
          ++P + V+  EV+ ++L +  G I VL  HAP+ T I  GI+ I L+ + +    ++GG 
Sbjct: 1  LTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAIDIGILRIRLNDQWLT-MALMGGF 59

Query: 72 CDIVPSHCTVL 82
            I  +  TVL
Sbjct: 60 ARIGNNEITVL 70


>gi|121534928|ref|ZP_01666747.1| ATP synthase F1, epsilon subunit [Thermosinus carboxydivorans
          Nor1]
 gi|121306527|gb|EAX47450.1| ATP synthase F1, epsilon subunit [Thermosinus carboxydivorans
          Nor1]
          Length = 136

 Score = 46.2 bits (108),