PSIBLAST alignment of GI: 254780614 and protein with PDB id: 1qo1

>gi|6573687|pdb|1QO1|J Chain J, Molecular Architecture Of The Rotary Motor In Atp Synthase From Yeast Mitochondria Length = 138
>gi|157830030|pdb|1AQT|A Chain A, Epsilon Subunit Of F1f0-Atp Synthase From Escherichia Coli Length = 138
 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 63/128 (49%), Gaps = 1/128 (0%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
           +  H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I         
Sbjct: 2   STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEF 61

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDL-NNICDVDQRFQMEQL 123
             + GGI ++ P + TVL++T +   +       +   +    + ++  DVD      +L
Sbjct: 62  IYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAEL 121

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 122 AKAIAQLR 129