RPSBLAST alignment for GI: 254780614 and conserved domain: CHL00063

>gnl|CDD|177003 CHL00063, atpE, ATP synthase CF1 epsilon subunit. Length = 134
 Score = 44.5 bits (106), Expect = 1e-05
 Identities = 17/47 (36%), Positives = 30/47 (63%)

Query: 12 VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS 58
          ++P + V+  EV+ ++LP+  G I VL  HAP+ T +  G++ I L+
Sbjct: 8  LTPNRIVWDSEVEEIILPTNSGQIGVLPNHAPIATALDIGVLRIRLN 54