RPSBLAST alignment of GI: 254780614 and MMDB domain: 2ck3_H_1-100

>2ck3_H (H:1-100) ATP synthase delta chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus}Length = 100
 Score = 80.1 bits (198), Expect = 1e-16
 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 2/87 (2%)

Query: 5   NDLHFELVSPEKCVF-SGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63
             + F   SP +  F S  V+ V +P++ G   +L  H P L  ++ G+V +        
Sbjct: 14  GQMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTS 73

Query: 64  RYVVIGGICDIVP-SHCTVLSETILPM 89
           +Y V  G   +   S   +L+E  + +
Sbjct: 74  KYFVSSGSVTVNADSSVQLLAEEAVTL 100