BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780614|ref|YP_003065027.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter asiaticus str. psy62] (135 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780614|ref|YP_003065027.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Score = 269 bits (688), Expect = 1e-74, Method: Compositional matrix adjust. Identities = 135/135 (100%), Positives = 135/135 (100%) Query: 1 MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60 MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE Sbjct: 1 MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60 Query: 61 EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120 EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM Sbjct: 61 EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120 Query: 121 EQLLVDLSCLRRRIQ 135 EQLLVDLSCLRRRIQ Sbjct: 121 EQLLVDLSCLRRRIQ 135 >gi|254780334|ref|YP_003064747.1| DNA repair protein RadA [Candidatus Liberibacter asiaticus str. psy62] Length = 479 Score = 24.3 bits (51), Expect = 0.95, Method: Compositional matrix adjust. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 9/31 (29%) Query: 12 VSPEKCVFSG---------EVQSVVLPSELG 33 SP VF+G E+QS+V+P+ LG Sbjct: 294 TSPGTAVFAGIEGTRALLVEIQSLVVPTSLG 324 >gi|254781061|ref|YP_003065474.1| putative iron-sulfur cluster assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 428 Score = 23.9 bits (50), Expect = 1.1, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 7/56 (12%) Query: 71 ICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQ--RFQMEQLL 124 I DI P H L + + AC + E+ DLN DQ +F +E++L Sbjct: 364 ISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLN-----DQVLQFSIEEIL 414 >gi|254781018|ref|YP_003065431.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 337 Score = 23.1 bits (48), Expect = 2.0, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 8 HFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTI 55 H ++P K + SGE S+ S L + + +LTTI+ ++ I Sbjct: 10 HAHSIAPAKVILSGEYSSLYGASALA-VAITFYLRALLTTIEPSLIRI 56 >gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 22.3 bits (46), Expect = 3.6, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Query: 34 DITVLVGHAPVLTTIKSGIVTISLSCEEI 62 +++L GH PVL TI T+ ++ E+I Sbjct: 164 QLSMLYGHFPVLKTI-----TMDITFEKI 187 >gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus Liberibacter asiaticus str. psy62] Length = 346 Score = 21.9 bits (45), Expect = 4.9, Method: Compositional matrix adjust. Identities = 8/28 (28%), Positives = 18/28 (64%) Query: 37 VLVGHAPVLTTIKSGIVTISLSCEEIHR 64 V +GH +L +V++SL+ E++++ Sbjct: 108 VTIGHDGILLVSDRDMVSVSLTVEDLYK 135 >gi|255764463|ref|YP_003064765.2| delta-aminolevulinic acid dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 337 Score = 21.2 bits (43), Expect = 6.9, Method: Compositional matrix adjust. Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 3 LVNDLHFELVSPEKCVFSGEVQSVVLPSELGD 34 +VND EL+S + + ++ PSE+ D Sbjct: 149 IVNDETIELISHAAVIQADAGADIIAPSEMMD 180 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.139 0.412 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,196 Number of Sequences: 1233 Number of extensions: 3225 Number of successful extensions: 15 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 12 length of query: 135 length of database: 328,796 effective HSP length: 65 effective length of query: 70 effective length of database: 248,651 effective search space: 17405570 effective search space used: 17405570 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 34 (17.7 bits)