HHsearch alignment for GI: 254780615 and conserved domain: COG3451

>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion].
Probab=93.36  E-value=0.084  Score=30.70  Aligned_cols=48  Identities=21%  Similarity=0.229  Sum_probs=33.1

Q ss_pred             CEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHH
Q ss_conf             100367566662489999999885057885268762164345999999854
Q gi|254780615|r  151 KIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMI  201 (478)
Q Consensus       151 r~gIfgg~GvGKT~l~~~~i~n~~~~~~~v~V~~~iGER~rEv~e~~~e~~  201 (478)
T Consensus       438 hT~I~G~tGaGKTvLl~~lla~~~k~~-~~~iv~f--Dk~~g~~~~~~a~g  485 (796)
T COG3451         438 HTLIIGPTGAGKTVLLSFLLAQALKYG-NPQIVAF--DKDNGAYIFIEALG  485 (796)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHC-CCCEEEE--CCCCCHHHHHHHHC
T ss_conf             749988988878999999999998745-9818998--48973577888749