HHsearch alignment for GI: 254780615 and conserved domain: cd03213

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=92.58  E-value=0.065  Score=31.43  Aligned_cols=36  Identities=22%  Similarity=0.473  Sum_probs=27.4

Q ss_pred             CCCCCCC-CCCCCCCCCCEECCCCCCCCHHHHHHHHH
Q ss_conf             2311002-35570215410036756666248999999
Q gi|254780615|r  135 TGIKVID-LISPYQKGGKIGLFGGAGVGKTVLIMELI  170 (478)
Q Consensus       135 TGIkaID-~l~pig~Gqr~gIfgg~GvGKT~l~~~~i  170 (478)
T Consensus        20 ~~k~iL~~vs~~v~~Gei~~ilGpnGaGKSTLl~~l~   56 (194)
T cd03213          20 SGKQLLKNVSGKAKPGELTAIMGPSGAGKSTLLNALA   56 (194)
T ss_pred             CCCEEEECCEEEEECCEEEEEECCCCCHHHHHHHHHH
T ss_conf             9998788838899088199999899951999999985