HHsearch alignment for GI: 254780615 and conserved domain: cd03223

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=95.23  E-value=0.0085  Score=37.21  Aligned_cols=31  Identities=29%  Similarity=0.454  Sum_probs=26.5

Q ss_pred             CCCCCCCCCCCEECCCCCCCCHHHHHHHHHH
Q ss_conf             2355702154100367566662489999999
Q gi|254780615|r  141 DLISPYQKGGKIGLFGGAGVGKTVLIMELIN  171 (478)
Q Consensus       141 D~l~pig~Gqr~gIfgg~GvGKT~l~~~~i~  171 (478)
T Consensus        19 ~isl~i~~Ge~v~i~G~sGsGKSTLl~~l~G   49 (166)
T cd03223          19 DLSFEIKPGDRLLITGPSGTGKSSLFRALAG   49 (166)
T ss_pred             EEEEEECCCCEEEEECCCCCCHHHHHHHHCC
T ss_conf             4588988999999995899988999999869