HHsearch alignment for GI: 254780615 and conserved domain: cd03270

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=93.35  E-value=0.038  Score=32.92  Aligned_cols=31  Identities=19%  Similarity=0.292  Sum_probs=25.2

Q ss_pred             CCCCCCCCCCCEECCCCCCCCHHHHHHHHHH
Q ss_conf             2355702154100367566662489999999
Q gi|254780615|r  141 DLISPYQKGGKIGLFGGAGVGKTVLIMELIN  171 (478)
Q Consensus       141 D~l~pig~Gqr~gIfgg~GvGKT~l~~~~i~  171 (478)
T Consensus        13 ~Vsl~i~~Ge~~aIvG~nGsGKSTL~~~~l~   43 (226)
T cd03270          13 NVDVDIPRNKLVVITGVSGSGKSSLAFDTIY   43 (226)
T ss_pred             CEEEEECCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             7489985998999987899609898361663