RPSBLAST alignment for GI: 254780615 and conserved domain: cd01133

>gnl|CDD|29999 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The beta subunit of ATP synthase is catalytic.. Length = 274
 Score =  476 bits (1227), Expect = e-135
 Identities = 209/284 (73%), Positives = 239/284 (84%), Gaps = 13/284 (4%)

Query: 82  ITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVID 141
           I+VPVG  TLGRI NV+GEP+D++G I + +   IH+ +P + EQST   IL TGIKVID
Sbjct: 2   ISVPVGPETLGRIFNVLGEPIDERGPIKTKKTWPIHREAPEFVEQSTKTEILETGIKVID 61

Query: 142 LISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMI 201
           L++PY KGGKIGLFGGAGVGKTVLIMELINN+AKAHGGYSVFAGVGERTREGNDLYHEM 
Sbjct: 62  LLAPYAKGGKIGLFGGAGVGKTVLIMELINNIAKAHGGYSVFAGVGERTREGNDLYHEMK 121

Query: 202 DSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQ-GQDVLFFV 260
           +S V             SK +L+YGQMNEPPGAR+RVALTGLT+AE+FRD+ GQDVL F+
Sbjct: 122 ESGVL------------SKTALVYGQMNEPPGARARVALTGLTMAEYFRDEEGQDVLLFI 169

Query: 261 DNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPAD 320
           DNIFRFTQA SE+SALLGR+PSAVGYQ TLA EMG LQERIT+T KGSITSVQA+YVPAD
Sbjct: 170 DNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPAD 229

Query: 321 DLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLE 364
           DLTDPAPAT+F HLDATTVLSR I+E GIYPA+DPLDS S +L+
Sbjct: 230 DLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRILD 273