>TIGR01146 ATPsyn_F1gamma ATP synthase F1, gamma subunit; InterPro: IPR000131 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , . F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis . These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. The ATPase F1 complex gamma subunit forms the central shaft that connects the F0 rotary motor to the F1 catalytic core. The gamma subunit functions as a rotary motor inside the cylinder formed by the alpha(3)beta(3) subunits in the F1 complex . The best-conserved region of the gamma subunit is its C-terminus, which seems to be essential for assembly and catalysis. More information about this protein can be found at Protein of the Month: ATP Synthases .; GO: 0046933 hydrogen ion transporting ATP synthase activity rotational mechanism, 0046961 hydrogen ion transporting ATPase activity rotational mechanism, 0015986 ATP synthesis coupled proton transport, 0016020 membrane, 0016469 proton-transporting two-sector ATPase complex.

Probab=100.00 E-value=0 Score=692.17 Aligned_cols=293 Identities=38% Similarity=0.600 Sum_probs=266.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCC-CCCC----CCCCCCC Q ss_conf 9887999999998756899999999999999999999998302369999999999973015754-4210----0024433 Q gi|254780616|r 1 MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQE-YPSP----FVRGTGK 75 (294) Q Consensus 1 M~~lk~ik~RI~sv~~~~KITkaMkmVA~skl~ka~~~~~~~~~Y~~~~~~~~~~~~~~~~~~~-~~~~----~~~~~~~ 75 (294) T Consensus 1 mA~LkeIr~RI~SVKnT~KITkAMkmVAasKlrrAq~~~~~~Rpy~~~~~~v~~~~~~~~~~~~~~~~P~Y~~~~~~~~- 79 (330) T TIGR01146 1 MASLKEIRTRIKSVKNTQKITKAMKMVAASKLRRAQERAEAARPYAEKIRAVLGNLASKLKNEDGVDHPKYFLLLKSRE- 79 (330) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC- T ss_conf 9856899877442102688879999999998799999999865778999999999998632321002775310054578- Q ss_pred CCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHH Q ss_conf 34325531146424420011479999999876532038850388870403798510233320111114776640368899 Q gi|254780616|r 76 DKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAH 155 (294) Q Consensus 76 ~~~~~~IvitSDrGLCG~~Ns~i~k~~~~~i~~~~~~~~~~~l~~vGkKg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 155 (294) T Consensus 80 ~Kk~~~~v~tsDrGLCGg~N~n~~k~~~~~~~~~~~~g~~~~l~~iG~Kg~~~f~r~~~~~~~~~~~~~~~~~P~~~~~~ 159 (330) T TIGR01146 80 VKKVGLLVITSDRGLCGGYNSNILKRVEQRAKELKAAGKEVKLVVIGRKGKSFFKRRHGINIVASVTGLGSDQPTFEEAQ 159 (330) T ss_pred CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEHHHHHHHHCCCCCCCEEEECCCCCCCCCHHHHH T ss_conf 87279998705863045788999999999987531279807998861246553104788740021215788888989999 Q ss_pred HHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCEEEEECCC-----CCHHH-------HHHHH-----------------C Q ss_conf 9997655765067875058862011344322204420478-----87354-------22110-----------------0 Q gi|254780616|r 156 GIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIP-----VDWSQ-------DLEQK-----------------Q 206 (294) Q Consensus 156 ~I~~~l~~~~~~~~~d~v~iiYn~f~s~~~q~p~~~~llP-----~~~~~-------~~~~~-----------------~ 206 (294) T Consensus 160 ~ia~~~~~~f~~g~~D~~~i~Yn~F~S~~sq~~~~~~~lPF~V~~~~~~~~~leA~~~~~~rl~t~gGkf~VeR~~v~~~ 239 (330) T TIGR01146 160 GIADKILDAFLSGEVDEVYIVYNKFVSVISQEPTVKQLLPFDVAALSEQGDELEAADDEGFRLTTKGGKFQVEREKVTEP 239 (330) T ss_pred HHHHHHHHHHHCCCCCEEEEEECCCEEEEEEEEEEEEECCCHHHCCCCHHHHCCCCCCCCCCCCCCCCCEEEEECEECCC T ss_conf 99999998655058763899883705403887676532660422232000000588643678666687347620200377 Q ss_pred CCCCCCCCCCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 365543224799---67878999998999999999999999999999999999999899999999999999989889889 Q gi|254780616|r 207 QDILSVYRYEST---LYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTE 283 (294) Q Consensus 207 ~~~~~~~~~Ep~---~~~il~~l~~~yl~~~l~~alles~aSE~aaRm~AM~~At~Na~~~i~~L~l~~Nk~RQ~~IT~E 283 (294) T Consensus 240 ~~~~~~~~fEpdG~~~~~iL~~Llp~y~~~~~y~Al~Es~ASE~aARM~AMdnAtdNA~~li~~Ltl~YNraRQA~ITqE 319 (330) T TIGR01146 240 EKLRQDYIFEPDGDSEEEILDSLLPRYLESQIYRALLESAASEQAARMTAMDNATDNAGDLIKKLTLSYNRARQAAITQE 319 (330) T ss_pred CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 55674322478989768999999899999999999999999888853258899998798888887677768888888688 Q ss_pred HHHHHHHHHCC Q ss_conf 99998525319 Q gi|254780616|r 284 LIEIIAGAEVV 294 (294) Q Consensus 284 l~EIisGaeAl 294 (294) T Consensus 320 l~EIv~GA~AL 330 (330) T TIGR01146 320 LIEIVAGASAL 330 (330) T ss_pred HHHHHHHHHCC T ss_conf 99988667419

HHsearch alignment for GI: 254780616 and conserved domain: TIGR01146