>cd03288 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.

Probab=92.19  E-value=0.095  Score=31.75  Aligned_cols=29  Identities=34%  Similarity=0.440  Sum_probs=23.4

Q ss_pred             CCCCCCCCCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             011115683365524778861158999999
Q gi|254780617|r  155 SLIPIGRGQRELIIGDRKTGKTSIILDTFL  184 (509)
Q Consensus       155 ~l~pigrGQR~~I~g~~g~GKt~l~~~~I~  184 (509)
T Consensus        40 inl~I~~Ge~vaIvG~sGsGKSTL~~-ll~   68 (257)
T cd03288          40 VKAYIKPGQKVGICGRTGSGKSSLSL-AFF   68 (257)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHH-HHH
T ss_conf             38998799999999999981999999-996