>cd03290 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.

Probab=92.63  E-value=0.078  Score=32.39  Aligned_cols=29  Identities=34%  Similarity=0.484  Sum_probs=23.6

Q ss_pred             CCCCCCCCCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             011115683365524778861158999999
Q gi|254780617|r  155 SLIPIGRGQRELIIGDRKTGKTSIILDTFL  184 (509)
Q Consensus       155 ~l~pigrGQR~~I~g~~g~GKt~l~~~~I~  184 (509)
T Consensus        20 inl~i~~Ge~~~IvG~sGsGKSTLl-~~l~   48 (218)
T cd03290          20 INIRIPTGQLTMIVGQVGCGKSSLL-LAIL   48 (218)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHH-HHHH
T ss_conf             6999869999999999998099999-9985