>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.

Probab=94.92 E-value=0.086 Score=32.07 Aligned_cols=42 Identities=29% Similarity=0.426 Sum_probs=35.2 Q ss_pred HHCCHHHHHCCCC-CCCCCEEEEECCCCCCCHHHHHHHHHHHH Q ss_conf 4416023310111-15683365524778861158999999988 Q gi|254780617|r 146 LSTGIKAIDSLIP-IGRGQRELIIGDRKTGKTSIILDTFLNQK 187 (509) Q Consensus 146 l~TGI~~ID~l~p-igrGQR~~I~g~~g~GKt~l~~~~I~nq~ 187 (509) T Consensus 2 IpTG~~~lD~~~gGl~~G~l~vi~g~pg~GKS~~~~~~a~~~a 44 (186) T pfam03796 2 LPTGFTDLDQLTGGLQKGDLIIIAARPSMGKTAFALNIARNAA 44 (186) T ss_pred CCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHH T ss_conf 3888077886426988881799996799987999999999999

HHsearch alignment for GI: 254780617 and conserved domain: pfam03796