RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780618|ref|YP_003065031.1| F0F1 ATP synthase subunit delta [Candidatus Liberibacter asiaticus str. psy62] (186 letters) >gnl|CDD|143970 pfam00213, OSCP, ATP synthase delta (OSCP) subunit. The ATP D subunit from E. coli is the same as the OSCP subunit which is this family. The ATP D subunit from metazoa are found in family pfam00401. Length = 171 Score = 134 bits (341), Expect = 1e-32 Identities = 63/166 (37%), Positives = 98/166 (59%), Gaps = 1/166 (0%) Query: 13 GRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVK 72 RY+ +LF ++ E+G LD V +D+ L+A+L E+ DLR F+ NPL S +++++++ + Sbjct: 3 RRYAKALFELAKEKGSLDEVEEDLEALKAVLAENPDLREFLSNPLISAEEKKALLKAVFG 62 Query: 73 DAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKL 132 +T NFL++L NGRLS+LP I + F + +R V A V + LS Q L Sbjct: 63 G-KLSELTKNFLKLLAENGRLSLLPEIAEEFEELYNEHRGIVEATVTSAVPLSEEQLKAL 121 Query: 133 GECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKL 178 LEK GK V L+ D +L+GG +V +G ID S+R +L +L Sbjct: 122 KAALEKKTGKKVKLETKVDPSLIGGVVVRVGDKVIDGSVRGKLERL 167 >gnl|CDD|31056 COG0712, AtpH, F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Energy production and conversion]. Length = 178 Score = 112 bits (281), Expect = 7e-26 Identities = 58/173 (33%), Positives = 96/173 (55%), Gaps = 1/173 (0%) Query: 6 ALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRS 65 + S V RY+ +LF ++ E+G L+ V ++++ L +L S L+ + +P S +D++ Sbjct: 2 SELSTVARRYAKALFELAEEKGQLEEVEEELTFLAEILKNSPKLKQLLSSPAVSAEDKKE 61 Query: 66 VIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLS 125 ++ + K + NFLR+L N RL++LP I++ F + R V A V + LS Sbjct: 62 LLISIFKK-IGDPLLQNFLRLLAENKRLNLLPEILEEFLKLAAESRGIVEAEVTSAFELS 120 Query: 126 LLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKL 178 Q KL LEK GK V L+ D +L+GG I+++G ID S+R +L +L Sbjct: 121 DEQLTKLEAKLEKKFGKKVKLNNKIDPSLIGGLIIKVGDEVIDGSVRGKLKRL 173 >gnl|CDD|36875 KOG1662, KOG1662, KOG1662, Mitochondrial F1F0-ATP synthase, subunit OSCP/ATP5 [Energy production and conversion]. Length = 210 Score = 110 bits (276), Expect = 2e-25 Identities = 59/176 (33%), Positives = 101/176 (57%), Gaps = 2/176 (1%) Query: 11 VPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDL 70 + GRY+ +L+ + + LD V D+++LE +L F+ NP + + +++ IDD+ Sbjct: 33 LEGRYATALYSAAVKNSKLDQVETDLNKLEQVLKTDPKFAQFVLNPTLTREKKKTAIDDI 92 Query: 71 VKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQN 130 V+ +T NFL +L NGRL+ L I+K+F + +R EV V + L Q Sbjct: 93 VEKLKLAPLTKNFLNLLAENGRLNNLTEIVKAFETLMNAHRGEVKVEVTSAEPLDAKQLK 152 Query: 131 KLGECLEKIV--GKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKE 184 +L + L+KI+ GK + ++ D +++GG IVEIG +D S++T+L KL +L+E Sbjct: 153 QLEKALQKILGGGKKLKVENKVDPSIIGGLIVEIGDKYVDMSIKTRLQKLNKLLEE 208 >gnl|CDD|177042 CHL00119, atpD, ATP synthase CF1 delta subunit; Validated. Length = 184 Score = 85.8 bits (213), Expect = 7e-18 Identities = 50/166 (30%), Positives = 89/166 (53%), Gaps = 2/166 (1%) Query: 15 YSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDA 74 Y+ +L + E+ +++ ++ DI + L ES +L+ F+ NPL S ++ VI Sbjct: 12 YAEALLEFAKEKNIMEQITADIQLILTFLNESPELKKFLANPLISKNAKKEVIKKTFGS- 70 Query: 75 HFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGE 134 T FL +LV GR+++L AII+ + + + +A V LS Q+ L E Sbjct: 71 QINENTLKFLMVLVDRGRIALLDAIIEKYLELVYKLASIKIAEVSTAVPLSSAQEEALIE 130 Query: 135 CLEKIVG-KTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLG 179 L+++ K + L + D +L+GGF+++IG+ ID S++ QL +L Sbjct: 131 KLKEMTNAKEIKLVITVDPSLIGGFLIKIGSKVIDTSIKGQLKQLA 176 >gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.. Length = 291 Score = 26.3 bits (59), Expect = 4.7 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 4/29 (13%) Query: 47 ADLRFFIHNPLFSMKDR--RSVIDDLVKD 73 A L FF NP S+KDR +I+D K Sbjct: 21 AKLEFF--NPGGSVKDRIALYMIEDAEKR 47 >gnl|CDD|31508 COG1317, FliH, Flagellar biosynthesis/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 234 Score = 26.5 bits (58), Expect = 4.9 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 136 LEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKL 178 ++G + L V + + GG I+E IDASL TQL L Sbjct: 179 ELSLLGWRLEL-VADPALSPGGCIIETEFGIIDASLDTQLAAL 220 >gnl|CDD|111867 pfam03023, MVIN, MviN-like protein. Deletion of the mviN virulence gene in Salmonella enterica serovar. Typhimurium greatly reduces virulence in a mouse model of typhoid-like disease. Open reading frames encoding homologues of MviN have since been identified in a variety of bacteria, including pathogens and non-pathogens and plant-symbionts. In the nitrogen-fixing symbiont Rhizobium tropici, mviN is required for motility. The MviM protein is predicted to be membrane-associated. Length = 452 Score = 26.5 bits (59), Expect = 5.1 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Query: 68 DDLVKDAHFCAI-TANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGL 124 + DA A N LR L A G S A + F + ++E FVR S L Sbjct: 7 AGPLADAFNVAFRIPNLLRRLFAEGAFSS--AFVPVFAELKQADKDEAAEFVRRVSTL 62 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.141 0.401 Gapped Lambda K H 0.267 0.0742 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,158,652 Number of extensions: 109596 Number of successful extensions: 335 Number of sequences better than 10.0: 1 Number of HSP's gapped: 329 Number of HSP's successfully gapped: 16 Length of query: 186 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 98 Effective length of database: 4,362,145 Effective search space: 427490210 Effective search space used: 427490210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 54 (24.6 bits)