RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780618|ref|YP_003065031.1| F0F1 ATP synthase subunit delta [Candidatus Liberibacter asiaticus str. psy62] (186 letters) >gnl|CDD|184049 PRK13429, PRK13429, F0F1 ATP synthase subunit delta; Provisional. Length = 181 Score = 127 bits (321), Expect = 2e-30 Identities = 61/171 (35%), Positives = 100/171 (58%) Query: 14 RYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKD 73 RY+ +LF ++ E+G LD V +++ +L LL +S +LR + NP+ S +++++V++ L+ Sbjct: 9 RYAKALFQLAKEKGQLDSVYEELKQLAELLEDSPELRDALSNPVLSAEEKKAVLEKLLGK 68 Query: 74 AHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLG 133 NFL++L RL +LP I + + + V A V + LS QQ + Sbjct: 69 LKVSPEVLNFLKLLADRRRLGILPEIAARYLELADEQKGIVRATVTSAVPLSEAQQEAIR 128 Query: 134 ECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKE 184 + LEK+ GK V LD D +L+GG +V+IG +DAS+RTQL +L LK+ Sbjct: 129 QKLEKMTGKKVELDTAVDPSLIGGVVVKIGDKVLDASVRTQLRRLKETLKK 179 >gnl|CDD|180239 PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated. Length = 177 Score = 124 bits (314), Expect = 1e-29 Identities = 58/165 (35%), Positives = 97/165 (58%), Gaps = 3/165 (1%) Query: 14 RYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKD 73 Y+ +LF V+ E+G LD S++++ L A + E+ DL + +PL S + ++ ++ + K Sbjct: 10 PYAKALFEVALEKGSLDAWSEELTFL-AEVAENEDLAALLSSPLVSAEQKKKLLAAVFKS 68 Query: 74 AHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLG 133 NFL++L NGRL++LP I++ F A+ + N V A V + LS Q +KL Sbjct: 69 LS--EYVQNFLKVLAENGRLALLPEILEQFEALRAEHENIVDAEVTSAFPLSEEQLDKLK 126 Query: 134 ECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKL 178 LEK +G+ V L+ D +L+GG I+++G ID S+R +L +L Sbjct: 127 AALEKRLGRKVKLNEKVDPSLIGGVIIKVGDRVIDGSVRGKLERL 171 >gnl|CDD|130215 TIGR01145, ATP_synt_delta, ATP synthase, F1 delta subunit. This model describes the ATP synthase delta subunit in bacteria, mitochondria, and chloroplasts. It is sometimes called OSCP for Oligomycin Sensitivity Conferring Protein. F1/F0-ATP synthase is a multisubunit, membrane associated enzyme found in bacteria and organelles of higher eukaryotes, namely, mitochondria and chloroplast. This enzyme is principally involved in the synthesis of ATP from ADP and inorganic phosphate by coupling the energy derived from the proton electrochemical gradient across the biological membrane. A brief description of this multisubunit enzyme complex: F1 and F0 represent two major clusters of subunits. Delta subunit belongs to the F1 cluster or sector and functionally implicated in the overall stability of the complex. Expression of truncated forms of this subunit results in low ATPase activity. Length = 172 Score = 84.3 bits (209), Expect = 2e-17 Identities = 56/172 (32%), Positives = 90/172 (52%), Gaps = 6/172 (3%) Query: 14 RYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKD 73 Y+ +LF ++NE+ L+ + ++ ++ +L + +L+ F+ NPL S + ++ I ++ + Sbjct: 4 PYAKALFEIANEKSSLEEWGEMLNFVKEVLKNNKELKKFLSNPLISAEKKKEFIKNVFGE 63 Query: 74 AHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLL--QQNK 131 + N L +L NGRL+ LP I+ F + Y + A V S L QQ K Sbjct: 64 -QLDESSLNLLLLLAENGRLAALPDILDQFLK--LSYEAQQTADVEVISAKPLTEDQQAK 120 Query: 132 LGECLEKIVGKT-VILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCIL 182 + E LEKI G V L+ D L+GG I+ IG ID S+R QL +L L Sbjct: 121 IAEKLEKITGAAKVKLNCKVDKDLIGGVIIRIGDRVIDGSVRGQLKRLSRQL 172 >gnl|CDD|139571 PRK13434, PRK13434, F0F1 ATP synthase subunit delta; Provisional. Length = 184 Score = 76.5 bits (188), Expect = 3e-15 Identities = 49/167 (29%), Positives = 80/167 (47%), Gaps = 4/167 (2%) Query: 9 SDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVID 68 S V Y+ +L G +N + V ++ L LL + +R F +P S +++ + Sbjct: 4 SGVSKVYASALLGAAN---SPEEVEQELGDLVQLLFKDEKIRNFFLSPTVSPEEKEQTLA 60 Query: 69 DLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQ 128 ++ IT NFL +L+ GR LP I K F + V A + ++ L Q Sbjct: 61 KNLR-GKISDITLNFLGVLLNKGRFIYLPEIQKDFTVELDKKKGRVRAQIVSYPSLEPAQ 119 Query: 129 QNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQL 175 +KLG L + IL+V ED L+GGF+V+ +I+ S+ +QL Sbjct: 120 VDKLGSILSEKFKSEFILEVSEDKNLLGGFVVQFNDLKIEKSIASQL 166 >gnl|CDD|184054 PRK13441, PRK13441, F0F1 ATP synthase subunit delta; Provisional. Length = 180 Score = 55.9 bits (135), Expect = 7e-09 Identities = 40/180 (22%), Positives = 79/180 (43%), Gaps = 19/180 (10%) Query: 8 FSDVPGRYSHSLFGVSNEEG-------VLDIVSDDISRLEALLMESADLRFFIHNPLFSM 60 +S + +Y+ +L V+ E LD+V + ESA + F NP+ Sbjct: 3 YSAIASKYARALLNVAIELEKEEEYGEFLDLVCQ--------IYESA--KEFFDNPIVKP 52 Query: 61 KDRRSVIDDLVKD--AHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFV 118 + + S+I +++K+ NFL ++ N R +LP I F + +V + Sbjct: 53 EKKVSLIKEIMKEFGQEMDEFFENFLNLVFENKRQKLLPQIRALFEYEKILSEQKVPVNL 112 Query: 119 RAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKL 178 LS + L + + K V + + + D +L+ G +VE ++D +++ +L K+ Sbjct: 113 TTAHELSDEELKLLRKFVRKYVLRDPVFEETIDESLIAGAVVEFEGKRLDVTVQGRLKKI 172 >gnl|CDD|184053 PRK13436, PRK13436, F0F1 ATP synthase subunit delta; Provisional. Length = 179 Score = 53.1 bits (128), Expect = 4e-08 Identities = 36/169 (21%), Positives = 75/169 (44%), Gaps = 1/169 (0%) Query: 7 LFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSV 66 L + Y+ +LF ++NEE ++ +++ ++ +L + DL + + +++ + Sbjct: 3 LKNKNIYNYAEALFDIANEENNVEKYINEVFKIIEILKNNKDLIKLLTSYFIDKEEKFKI 62 Query: 67 IDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSL 126 ID + A NFL+IL N + I+K F + N + LS Sbjct: 63 IDKIFS-AKIDIYLVNFLKILAKNNLFIYIKQILKKFVKLSNEKLNITYGEIYTTEPLSE 121 Query: 127 LQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQL 175 +Q ++ L K + K V L D L+ G +++ + S++++L Sbjct: 122 VQISRFESKLSKKLNKKVHLVNKIDPKLIAGIKIKVDNKVFENSIKSKL 170 >gnl|CDD|184050 PRK13430, PRK13430, F0F1 ATP synthase subunit delta; Provisional. Length = 271 Score = 49.9 bits (120), Expect = 4e-07 Identities = 37/153 (24%), Positives = 68/153 (44%), Gaps = 1/153 (0%) Query: 26 EGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLR 85 +G LD V D++ RL +L + +LR + + + +R ++ L+ +T Sbjct: 114 QGALDDVEDELFRLGRILASNPELRLALSDRAAPAEAKRELLARLLYGK-VTPVTERLAE 172 Query: 86 ILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVI 145 V R + + + R +A V LS Q+ +L L +I G+ V Sbjct: 173 QAVGRPRGRSIEEGLDELSNLAAARRGRSVATVTTAVPLSDEQKQRLAAALSRIYGRPVH 232 Query: 146 LDVMEDSALMGGFIVEIGAHQIDASLRTQLLKL 178 L+ D +++GG V++G ID S+ +L +L Sbjct: 233 LNSEVDPSVLGGMRVQVGDEVIDGSVAGRLERL 265 >gnl|CDD|181440 PRK08474, PRK08474, F0F1 ATP synthase subunit delta; Validated. Length = 176 Score = 44.6 bits (106), Expect = 2e-05 Identities = 37/136 (27%), Positives = 60/136 (44%), Gaps = 8/136 (5%) Query: 14 RYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRF--FIHNPLFSMKDRRSVIDDLV 71 RY+ +L + + + DI S+ + L + AD +F I +P S + + + V Sbjct: 8 RYAKALLSSLSSDELNDIYSN-LKILSSAF---ADEKFKEIISSPEISKEQKIEFLLSFV 63 Query: 72 KDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNK 131 +A+ A NF+++L N RL ++PAI K NE + V + LS K Sbjct: 64 DNAN--AKFQNFIKLLAENKRLELIPAIAKELERQIALKENEYVGVVYSNEKLSEETLKK 121 Query: 132 LGECLEKIVGKTVILD 147 L E L K + L Sbjct: 122 LEEKLSKKFNAKIKLK 137 >gnl|CDD|184048 PRK13428, PRK13428, F0F1 ATP synthase subunit delta; Provisional. Length = 445 Score = 44.3 bits (105), Expect = 2e-05 Identities = 24/67 (35%), Positives = 38/67 (56%) Query: 111 RNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDAS 170 R EV+A V A + LS Q+ +L E L +I G+ V + + D L+GG + +G ID + Sbjct: 372 RGEVVAQVSAAAELSDAQRTRLTEVLSRIYGRPVSVQLHIDPELLGGLSIAVGDEVIDGT 431 Query: 171 LRTQLLK 177 L ++L Sbjct: 432 LSSRLAA 438 >gnl|CDD|132233 TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecarbonyl-CoA hydratase. This enzyme, cyclohexa-1,5-dienecarbonyl-CoA hydratase, also called dienoyl-CoA hydratase, acts on the product of benzoyl-CoA reductase (EC 1.3.99.15). Benzoyl-CoA is a common intermediate in the degradation of many aromatic compounds, and this enzyme is part of an anaerobic pathway for dearomatization and degradation. Length = 251 Score = 29.5 bits (66), Expect = 0.48 Identities = 16/53 (30%), Positives = 23/53 (43%) Query: 73 DAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLS 125 D H ++A+ LR V RL + + V Y E+MA A GL+ Sbjct: 186 DEHPAKLSASSLRFAVRAARLGMNERVKAKIAEVEALYLEELMATHDAVEGLN 238 >gnl|CDD|149409 pfam08337, Plexin_cytopl, Plexin cytoplasmic RasGAP domain. This family features the C-terminal regions of various plexins. Plexins are receptors for semaphorins, and plexin signalling is important in path finding and patterning of both neurons and developing blood vessels. The cytoplasmic region, which has been called a SEX domain in some members of this family, is involved in downstream signalling pathways, by interaction with proteins such as Rac1, RhoD, Rnd1 and other plexins. This domain acts as a RasGAP domain. Length = 538 Score = 28.9 bits (65), Expect = 0.75 Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 5/65 (7%) Query: 6 ALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIH----NPLFSMK 61 F D PG +H L E V +++ LL + L FIH FS++ Sbjct: 15 VFFPD-PGHETHPLLRDLVPESRRPTVEQGLTQFSQLLNNKSFLLTFIHTLESQRSFSVR 73 Query: 62 DRRSV 66 DR +V Sbjct: 74 DRCNV 78 >gnl|CDD|180653 PRK06669, fliH, flagellar assembly protein H; Validated. Length = 281 Score = 28.4 bits (64), Expect = 1.0 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Query: 128 QQNKLGECLEKIVGKTVILDVMEDSAL-MGGFIVEIGAHQIDASLRTQLLKLGCILKEV 185 Q+++L L+ + ED A+ GG ++E IDA + TQL +L L E Sbjct: 223 QKDELISLLDNEEHLKIY----EDDAISKGGCVIETDFGNIDARIDTQLKQLKEKLLEN 277 >gnl|CDD|180537 PRK06348, PRK06348, aspartate aminotransferase; Provisional. Length = 384 Score = 27.4 bits (61), Expect = 2.6 Identities = 31/131 (23%), Positives = 52/131 (39%), Gaps = 19/131 (14%) Query: 40 EALLMESADLRFFIHNPL-FSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPA 98 ++ E A L + + S+ D + D+ + +A F R + G + ++ Sbjct: 15 VNIMAEIATLAKKFPDIIDLSLGDPDLITDESIINAAFEDAKKGHTRYTDSGGDVELIEE 74 Query: 99 IIKSFRAVCMYY--RNEVMAFVRAFSGLSLLQQNKLGECLEKIV---------------- 140 IIK + RNE+MA V A G+ L Q+ L E I+ Sbjct: 75 IIKYYSKNYDLSFKRNEIMATVGACHGMYLALQSILDPGDEVIIHEPYFTPYKDQIEMVG 134 Query: 141 GKTVILDVMED 151 GK +IL+ E+ Sbjct: 135 GKPIILETYEE 145 >gnl|CDD|163537 TIGR03825, FliH_bacil, flagellar assembly protein FliH. This bacillus clade of FliH proteins is not found by the Pfam FliH model pfam02108, but is closely related to the sequences identified by that model. Sequences identified by this model are observed in flagellar operons in an analogous position relative to other flagellar operon genes. Length = 255 Score = 27.1 bits (60), Expect = 3.0 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 136 LEKIVGKTVILDVMEDSALM-GGFIVEIGAHQIDASLRTQLLKL 178 L+ I+ L V D L GG VE +IDAS+ TQL +L Sbjct: 197 LQSILPACEHLAVYPDEKLPDGGCYVETNFGRIDASVDTQLEQL 240 >gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional. Length = 442 Score = 27.0 bits (60), Expect = 3.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 35 DISRLEALLMESADLRFFIHNPLFSMKDRRSVID 68 D+ E LL +A L + + L S++D VID Sbjct: 337 DLYEREGLLTRAARLAPYWEDALHSLRDAPHVID 370 >gnl|CDD|131447 TIGR02394, rpoS_proteo, RNA polymerase sigma factor RpoS. A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoS (also called sigma-38, KatF, etc.), found only in Proteobacteria. This sigma factor is induced in stationary phase (in response to the stress of nutrient limitation) and becomes the second prinicipal sigma factor at that time. RpoS is a member of the larger Sigma-70 subfamily (TIGR02937) and most closely related to RpoD (TIGR02393). Length = 285 Score = 26.6 bits (59), Expect = 3.9 Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 25 EEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDR-RSVI 67 + +LD ++D+ S L+++ DL+ I L + +R R V+ Sbjct: 188 SKSLLDTIADEQSIDPESLVQNDDLKQLIEAWLAELNERQREVL 231 >gnl|CDD|181453 PRK08508, PRK08508, biotin synthase; Provisional. Length = 279 Score = 26.5 bits (59), Expect = 4.1 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 15/73 (20%) Query: 33 SDDISRLEALLM---ESADLRFFIHNPLFSMKDRRSVIDD---LVKDAHFCAITANFL-- 84 D IS L++L S + FFI NP +K D+ +V+ A L Sbjct: 166 EDRISFLKSLASLSPHSTPINFFIPNPALPLKAPTLSADEALEIVRLAK------EALPN 219 Query: 85 -RILVANGRLSVL 96 R++VA GR V Sbjct: 220 ARLMVAGGREVVF 232 >gnl|CDD|178972 PRK00310, rpsC, 30S ribosomal protein S3; Reviewed. Length = 232 Score = 26.3 bits (59), Expect = 4.4 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 11/42 (26%) Query: 130 NKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASL 171 KL + LEK+ GK V ++ IVE+ ++DA L Sbjct: 85 EKLRKELEKLTGKPVQIN-----------IVEVKKPELDAQL 115 >gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional. Length = 460 Score = 26.4 bits (58), Expect = 4.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 7 LFSDVPGRYSHSLFGVSNEE 26 LFS +PG YSH+++ S E Sbjct: 107 LFSLLPGHYSHAIYTNSGSE 126 >gnl|CDD|182106 PRK09841, PRK09841, cryptic autophosphorylating protein tyrosine kinase Etk; Provisional. Length = 726 Score = 26.4 bits (58), Expect = 4.5 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 7 LFSDVPGR--YSHSLFGVSNEEGVLDIVS 33 LF D R YSH+LF VSNE G+ + ++ Sbjct: 564 LFIDADLRRGYSHNLFTVSNEHGLSEYLA 592 >gnl|CDD|152287 pfam11851, DUF3371, Domain of unknown function (DUF3371). This domain is functionally uncharacterized. This domain is found in eukaryotes. This presumed domain is typically between 125 to 142 amino acids in length. Length = 131 Score = 26.2 bits (58), Expect = 4.6 Identities = 10/52 (19%), Positives = 19/52 (36%) Query: 8 FSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFS 59 +D +S L + + S+L+ +LM+ +PL S Sbjct: 58 LNDGTITFSDPLSHFTGSPFSYSSPLKEESKLDDILMDDTLSPLGGSDPLLS 109 >gnl|CDD|178002 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring). Length = 433 Score = 25.7 bits (56), Expect = 7.4 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Query: 101 KSFRAVC--MYYRNEVMAFVRAFSG 123 +SF +C MYYR ++ FV ++G Sbjct: 99 RSFEDMCAQMYYRGKMFGFVHLYNG 123 >gnl|CDD|147863 pfam05941, Chordopox_A20R, Chordopoxvirus A20R protein. This family consists of several Chordopoxvirus A20R proteins. The A20R protein is required for DNA replication, is associated with the processive form of the viral DNA polymerase, and directly interacts with the viral proteins encoded by the D4R, D5R, and H5R open reading frames. A20R may contribute to the assembly or stability of the multiprotein DNA replication complex. Length = 334 Score = 25.7 bits (57), Expect = 8.1 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 8/63 (12%) Query: 37 SRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVL 96 S ++ALL + D+ F F R +++D I L++ A G L+V+ Sbjct: 111 SIIDALLADYPDIEFL----RFVYFKNRWILEDAFSKYS-SPI--EILKLASAEG-LNVV 162 Query: 97 PAI 99 P + Sbjct: 163 PYL 165 >gnl|CDD|130304 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative. This enzyme is the second of two in the degradation of proline to glutamate. This model represents one of several related branches of delta-1-pyrroline-5-carboxylate dehydrogenase. Members of this branch may be associated with proline dehydrogenase (the other enzyme of the pathway from proline to glutamate) but have not been demonstrated experimentally. The branches are not as closely related to each other as some distinct aldehyde dehydrogenases are to some; separate models were built to let each model describe a set of equivalogs. Length = 511 Score = 25.6 bits (56), Expect = 8.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 139 IVGKTVILDVMEDSALMGGFIVEI 162 + G V+L E S ++ IVEI Sbjct: 193 VTGNCVVLKPAETSTVIAAKIVEI 216 >gnl|CDD|128811 smart00538, POP4, A domain found in a protein subunit of human RNase MRP and RNase P ribonucleoprotein complexes and archaeal proteins. Length = 92 Score = 25.3 bits (56), Expect = 8.7 Identities = 8/25 (32%), Positives = 11/25 (44%) Query: 80 TANFLRILVANGRLSVLPAIIKSFR 104 T N L+I GR+ +P F Sbjct: 37 TRNTLKIETKEGRVKTVPKDGAVFE 61 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.141 0.401 Gapped Lambda K H 0.267 0.0640 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,998,865 Number of extensions: 187503 Number of successful extensions: 468 Number of sequences better than 10.0: 1 Number of HSP's gapped: 461 Number of HSP's successfully gapped: 41 Length of query: 186 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 98 Effective length of database: 4,092,969 Effective search space: 401110962 Effective search space used: 401110962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 54 (24.8 bits)