HHsearch alignment for GI: 254780619 and conserved domain: COG0514

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair].
Probab=93.51  E-value=0.47  Score=27.15  Aligned_cols=73  Identities=21%  Similarity=0.355  Sum_probs=56.5

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCHHHHHHH--CCCEEEE
Q ss_conf             46847997152100134455543038976899623557235667899997199739994001211001--0001367
Q gi|254780619|r  245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF--KKLGLIV  319 (731)
Q Consensus       245 ~GkqvLiLvPEI~Lt~Q~~~rl~~rF~~~v~v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRSAif~P~--~nLglII  319 (731)
T Consensus       229 ~~~~GIIYc~sRk~~E~ia~~L~~~-g~~a~~YHaGl~~~eR~~~q~~f~~~~~~iiVAT~-AFGMGIdKpdVRfVi  303 (590)
T COG0514         229 LSKSGIIYCLTRKKVEELAEWLRKN-GISAGAYHAGLSNEERERVQQAFLNDEIKVMVATN-AFGMGIDKPDVRFVI  303 (590)
T ss_pred             CCCCEEEEEEEHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHCCCCCEEEEEC-CCCCCCCCCCCEEEE
T ss_conf             6897289993377599999999977-97257751898899999999997169986899964-624776788840799