HHsearch alignment for GI: 254780619 and conserved domain: COG0552

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion].
Probab=94.09  E-value=0.52  Score=26.86  Aligned_cols=39  Identities=33%  Similarity=0.386  Sum_probs=33.4

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             489619984475315799999999998514684799715
Q gi|254780619|r  216 KGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP  254 (731)
Q Consensus       216 ~~f~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvP  254 (731)
T Consensus       137 ~~p~Vil~vGVNG~GKTTTIaKLA~~l~~~g~~VllaA~  175 (340)
T COG0552         137 KKPFVILFVGVNGVGKTTTIAKLAKYLKQQGKSVLLAAG  175 (340)
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             986799999348886371799999999978986999823