HHsearch alignment for GI: 254780619 and conserved domain: COG4098

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair].
Probab=96.14  E-value=0.047  Score=34.79  Aligned_cols=85  Identities=21%  Similarity=0.394  Sum_probs=66.7

Q ss_pred             HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCC-EEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCHHHH---HH
Q ss_conf             9999998514684799715210013445554303897-6899623557235667899997199739994001211---00
Q gi|254780619|r  236 LEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGV-KPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF---LP  311 (731)
Q Consensus       236 l~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~rF~~-~v~v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRSAif---~P  311 (731)
T Consensus       295 ~~~lekq~~~~~P~liF~p~I~~~eq~a~~lk~~~~~~~i~~Vhs~--d~~R~EkV~~fR~G~~~lLiTTT--ILERGVT  370 (441)
T COG4098         295 KRWLEKQRKTGRPVLIFFPEIETMEQVAAALKKKLPKETIASVHSE--DQHRKEKVEAFRDGKITLLITTT--ILERGVT  370 (441)
T ss_pred             HHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECC--CCCHHHHHHHHHCCCEEEEEEEE--HHHCCCC
T ss_conf             9999998743882899925058899999999861886421565336--70178999998758638999844--0332664


Q ss_pred             HCCCEEEEEEECC
Q ss_conf             1000136774055
Q gi|254780619|r  312 FKKLGLIVIDEEH  324 (731)
Q Consensus       312 ~~nLglIIvDEEH  324 (731)
T Consensus       371 fp~vdV~Vlgaeh  383 (441)
T COG4098         371 FPNVDVFVLGAEH  383 (441)
T ss_pred             CCCCEEEEECCCC
T ss_conf             3562399954776