HHsearch alignment for GI: 254780619 and conserved domain: COG4889

>COG4889 Predicted helicase [General function prediction only].
Probab=98.26  E-value=0.0002  Score=52.99  Aligned_cols=369  Identities=17%  Similarity=0.151  Sum_probs=188.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCC--CCE
Q ss_conf             666883789999999875204896199844753157999999999985146847997152100134455543038--976
Q gi|254780619|r  196 LPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRF--GVK  273 (731)
Q Consensus       196 ~~~Lt~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~rF--~~~  273 (731)
T Consensus       159 ~kk~R~hQq~Aid~a~~~F~~n~RGkLIM-AcGTGKTfTsLkisEala~--~~iL~LvPSIsLLsQTlrew~~~~~l~~~  235 (1518)
T COG4889         159 PKKPRPHQQTAIDAAKEGFSDNDRGKLIM-ACGTGKTFTSLKISEALAA--ARILFLVPSISLLSQTLREWTAQKELDFR  235 (1518)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCCEEE-ECCCCCCCHHHHHHHHHHH--HHEEEECCHHHHHHHHHHHHHHCCCCCCE
T ss_conf             78998367899999986255166775898-3378862137889999864--02365435189999999988534665512


Q ss_pred             EEEEECC----------------CCC----HHHHHHHHHHHC-CCCEEEEECCHHHH-------HHHCCCEEEEEEECCC
Q ss_conf             8996235----------------572----356678999971-99739994001211-------0010001367740553
Q gi|254780619|r  274 PAEWHSS----------------LST----SMREKIWRQVAR-GAISVIVGVRSALF-------LPFKKLGLIVIDEEHD  325 (731)
Q Consensus       274 v~v~HS~----------------ls~----~eR~~~w~~i~~-G~~~IVIGtRSAif-------~P~~nLglIIvDEEHd  325 (731)
T Consensus       236 a~aVcSD~kvsrs~eDik~sdl~~p~sT~~~~il~~~~~~~k~~~~~vvFsTYQSl~~i~eAQe~G~~~fDliicDEAHR  315 (1518)
T COG4889         236 ASAVCSDDKVSRSAEDIKASDLPIPVSTDLEDILSEMEHRQKANGLTVVFSTYQSLPRIKEAQEAGLDEFDLIICDEAHR  315 (1518)
T ss_pred             EEEEECCCCCCCCCCCCCHHCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCCEEEECCHHC
T ss_conf             57886365234441232120478887574999999998753337838999702114878999974999753797440001


Q ss_pred             CC---CHHCCCC---CCCHHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCC
Q ss_conf             21---0000244---32248999997511032100002454324677532123444124322367654332110222233
Q gi|254780619|r  326 IS---YKQEEGI---LYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQT  399 (731)
Q Consensus       326 ~s---ykq~~~p---ry~aRdvA~~Ra~~~~~~lilgSATPSles~~~~~~g~~~~~~l~~R~~~~~~P~i~ivDm~~~~  399 (731)
T Consensus       316 TtGa~~a~dd~saFt~vHs~~n------iKa~kRlYmTATPkiy~--eS~K~---------kA---kd~s~~l~SMDDe~  375 (1518)
T COG4889         316 TTGATLAGDDKSAFTRVHSDQN------IKAAKRLYMTATPKIYS--ESSKA---------KA---KDHSAELSSMDDEL  375 (1518)
T ss_pred             CCCCEECCCCCCCCEEECCCCC------HHHHHHHHCCCCCHHHC--HHHHH---------HH---HHCCCEEECCCHHH
T ss_conf             4462322577201045337641------58887666006860212--25453---------03---21143011255265


Q ss_pred             CCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCE-EHHCCCCCCCCCCCCCCCCCEEEEECCCCCCEECH----------
Q ss_conf             2224547989999998862265517997422200-00002356543431014652012113578320000----------
Q gi|254780619|r  400 IAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGY-APLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQ----------  468 (731)
Q Consensus       400 ~~~~~~lS~~l~~~i~~~l~~g~qvll~lnRrGy-a~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~----------  468 (731)
T Consensus       376 ~fGeef~rl~FgeAv~rdlLTDYKVmvlaVd~~~i~~~~~~~~~~~~-------~~L~~dd~~kIvG~wnGlakr~g~~n  448 (1518)
T COG4889         376 TFGEEFHRLGFGEAVERDLLTDYKVMVLAVDKEVIAGVLQSVLSGPS-------KGLALDDVSKIVGCWNGLAKRNGEDN  448 (1518)
T ss_pred             HHCHHHHCCCHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHCCCCC-------CCCCHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             54546621226778764010052589998317665245656306864-------34243445677777665665325536


Q ss_pred             --HHCCC---CCCC---CCCCCCCCCEECC-CCCCHHHHHHHHHHCCCCCHHHHCCCCCCCCHH---HHHHHHHHHCCCC
Q ss_conf             --21024---4655---5666787411001-354289988885204852000102321135867---8999998621257
Q gi|254780619|r  469 --CGHSA---IYSQ---SCVVCGSSGKMIA-CGFGIERIAEEVCEYFPLARISILSSDLEGGGG---RLQLQLSAIAKGE  536 (731)
Q Consensus       469 --Cg~~~---~~~~---~Cp~Cg~~~~l~~-~G~Gte~~~e~l~~~fp~~~v~~~d~d~~~~~~---~~~~~~~~~~~~~  536 (731)
T Consensus       449 ~~~~~~~d~ap~~RAIaF~k~I~tSK~i~~sFe~Vve~Y~~Elk~d~~nL~iSi~HvDGtmNal~R~~l~~l~~~~~~ne  528 (1518)
T COG4889         449 DLKNIKADTAPMQRAIAFAKDIKTSKQIAESFETVVEAYDEELKKDFKNLKISIDHVDGTMNALERLDLLELKNTFEPNE  528 (1518)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCH
T ss_conf             54367677507889999987667788788888999999999997326683688751467300888877886158899421


Q ss_pred             CCEEEEEHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC---CCEEEEEECCCC
Q ss_conf             6579870443023113452012330003443102455789999987543110256678---868999932986
Q gi|254780619|r  537 IDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGL---KSLGLIQAYQPT  606 (731)
Q Consensus       537 ~~ilvgTq~i~kg~~fp~v~lv~il~aD~~l~~pd~ra~E~~~qll~qv~gRagr~~~---~g~v~iQt~~p~  606 (731)
T Consensus       529 ckIlSNaRcLSEGVDVPaLDsViFf~pr~sm------------VDIVQaVGRVMRKa~gK~yGYIILPIalpe  589 (1518)
T COG4889         529 CKILSNARCLSEGVDVPALDSVIFFDPRSSM------------VDIVQAVGRVMRKAKGKKYGYIILPIALPE  589 (1518)
T ss_pred             HEEECCCHHHHCCCCCCCCCEEEEECCCHHH------------HHHHHHHHHHHHHCCCCCCCEEEEEECCCC
T ss_conf             0110133154237885341237986685128------------899999999987276876656998731587