HHsearch alignment for GI: 254780619 and conserved domain: KOG0333

>KOG0333 consensus.
Probab=99.25  E-value=5.3e-09  Score=87.95  Aligned_cols=315  Identities=23%  Similarity=0.336  Sum_probs=165.1

Q ss_pred             EEEEECCCCHHHHHHHH-HHH---------H--HHHHCCCCEEEEECCCHHHHHHHH---HHHCCCCCEEEEEECCCCCH
Q ss_conf             19984475315799999-999---------9--985146847997152100134455---54303897689962355723
Q gi|254780619|r  220 VSLISGVTGSGKTEVYL-EIV---------A--AVLHLGKQVLILLPEISLTSAILE---RFQKRFGVKPAEWHSSLSTS  284 (731)
Q Consensus       220 ~~LL~GvTGSGKTEVYl-~li---------~--~~L~~GkqvLiLvPEI~Lt~Q~~~---rl~~rF~~~v~v~HS~ls~~  284 (731)
T Consensus       284 D~igvaETgsGktaaf~ipLl~~IsslP~~~~~en~~~gpyaiilaptReLaqqIeeEt~kf~~~lg~r~vsvigg~s~E  363 (673)
T KOG0333         284 DPIGVAETGSGKTAAFLIPLLIWISSLPPMARLENNIEGPYAIILAPTRELAQQIEEETNKFGKPLGIRTVSVIGGLSFE  363 (673)
T ss_pred             CEEEEEECCCCCCCCCHHHHHHHHHCCCCCCHHHHCCCCCEEEEECHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHH
T ss_conf             72368731677532000158899870898414442346860012033799999999999875030143289985463366


Q ss_pred             HHHHHHHHHHCCCCEEEEECCHHHHHHH-------CCCEEEEEEE---CCCCCCHHC-----C-CCCCCHH-------HH
Q ss_conf             5667899997199739994001211001-------0001367740---553210000-----2-4432248-------99
Q gi|254780619|r  285 MREKIWRQVARGAISVIVGVRSALFLPF-------KKLGLIVIDE---EHDISYKQE-----E-GILYNAR-------DM  341 (731)
Q Consensus       285 eR~~~w~~i~~G~~~IVIGtRSAif~P~-------~nLglIIvDE---EHd~sykq~-----~-~pry~aR-------dv  341 (731)
T Consensus       364 Eq---~fqls~g-ceiviatPgrLid~Lenr~lvl~qctyvvldeadrmiDmgfE~dv~~iL~~mPssn~k~~tde~~~~  439 (673)
T KOG0333         364 EQ---GFQLSMG-CEIVIATPGRLIDSLENRYLVLNQCTYVVLDEADRMIDMGFEPDVQKILEQMPSSNAKPDTDEKEGE  439 (673)
T ss_pred             HH---HHHHHCC-CEEEECCCHHHHHHHHHHHHHHCCCCEEECCCHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCHHHH
T ss_conf             53---0246415-4144247407888777788875058467624066654246667788899838763458886310218


Q ss_pred             HHHHHHHC-----CCCEECCCCC--CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-EECCCCCCCCCCCCCCCHHHHHH
Q ss_conf             99975110-----3210000245--4324677532123444124322367654332-11022223322245479899999
Q gi|254780619|r  342 SIVRGKIE-----SFPVVLVSAT--PSIESRVNGISRRYHSVHLSTRYRNSALPHL-QVIDMRGQTIAQGKSLSPEMIDG  413 (731)
Q Consensus       342 A~~Ra~~~-----~~~lilgSAT--PSles~~~~~~g~~~~~~l~~R~~~~~~P~i-~ivDm~~~~~~~~~~lS~~l~~~  413 (731)
T Consensus       440 ~~~~~~~~~~k~yrqT~mf-tatm~p~verlar~ylr~pv~vti--g~~gk~~~rveQ~v~m~~e--------d~k-~kk  507 (673)
T KOG0333         440 ERVRKNFSSSKKYRQTVMF-TATMPPAVERLARSYLRRPVVVTI--GSAGKPTPRVEQKVEMVSE--------DEK-RKK  507 (673)
T ss_pred             HHHHHHCCCCCCEEEEEEE-ECCCCHHHHHHHHHHHHCCEEEEE--CCCCCCCCCHHEEEEEECC--------HHH-HHH
T ss_conf             8887510312102578998-447876799999998527769995--4678986021117888155--------688-999


Q ss_pred             HHHHHCCC--CEEEEEECCCCEEHHCCCCCCCCCCCCCCCCCEEEEECCCCCCEECHHHCCCCCCCCCCCCCCCCEECCC
Q ss_conf             98862265--5179974222000000235654343101465201211357832000021024465556667874110013
Q gi|254780619|r  414 IRHTLARN--EQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC  491 (731)
Q Consensus       414 i~~~l~~g--~qvll~lnRrGya~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~~~l~~~  491 (731)
T Consensus       508 L~eil~~~~~ppiIIFvN~kk~--------~d~lAk--------------------------------------------  535 (673)
T KOG0333         508 LIEILESNFDPPIIIFVNTKKG--------ADALAK--------------------------------------------  535 (673)
T ss_pred             HHHHHHHCCCCCEEEEEECHHH--------HHHHHH--------------------------------------------
T ss_conf             9999984799987999831324--------899999--------------------------------------------


Q ss_pred             CCCHHHHHHHHHHCCCCCHHHHCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             54289988885204852000102321135867899999862125765798704430231134520123300034431024
Q gi|254780619|r  492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNAD  571 (731)
Q Consensus       492 G~Gte~~~e~l~~~fp~~~v~~~d~d~~~~~~~~~~~~~~~~~~~~~ilvgTq~i~kg~~fp~v~lv~il~aD~~l~~pd  571 (731)
T Consensus       536 ---------~LeK~--g~~~~tlHg--~k~qeQRe~aL~~fr~~t~dIlVaTDvAgRGIDIpnVSlV--inydmaksieD  600 (673)
T KOG0333         536 ---------ILEKA--GYKVTTLHG--GKSQEQRENALADFREGTGDILVATDVAGRGIDIPNVSLV--INYDMAKSIED  600 (673)
T ss_pred             ---------HHHHC--CCEEEEEEC--CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCEE--EECCHHHHHHH
T ss_conf             ---------98644--324799617--8527789999999871578779983221257777761214--62205565899


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCC-HHHHHHHHCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             557899999875431102566788689999329864-888999958979999999999998188880
Q gi|254780619|r  572 LRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH-PVMQALVSGDADSFYESEIRARESVNLPPF  637 (731)
Q Consensus       572 ~ra~E~~~qll~qv~gRagr~~~~g~v~iQt~~p~~-~~~~~~~~~d~~~f~~~el~~R~~~~~PPf  637 (731)
T Consensus       601 Y----------tHRIGRTgRAGk~GtaiS-flt~~dt~v~ydL---------kq~l~es~~s~~P~E  647 (673)
T KOG0333         601 Y----------THRIGRTGRAGKSGTAIS-FLTPADTAVFYDL---------KQALRESVKSHCPPE  647 (673)
T ss_pred             H----------HHHHCCCCCCCCCCEEEE-EECCCHHHHHHHH---------HHHHHHHHHCCCCHH
T ss_conf             9----------887423444666753689-8640111778999---------999998642269822