HHsearch alignment for GI: 254780619 and conserved domain: KOG0336

>KOG0336 consensus.
Probab=98.66  E-value=1.5e-05  Score=61.52  Aligned_cols=283  Identities=20%  Similarity=0.291  Sum_probs=147.9

Q ss_pred             EEEEECC-------CCHHHHHHHHHH-HHHHH--------HCCCCEEEEECCCHHHHHHHHHHHCC-C-CC-EEEEEECC
Q ss_conf             1998447-------531579999999-99985--------14684799715210013445554303-8-97-68996235
Q gi|254780619|r  220 VSLISGV-------TGSGKTEVYLEI-VAAVL--------HLGKQVLILLPEISLTSAILERFQKR-F-GV-KPAEWHSS  280 (731)
Q Consensus       220 ~~LL~Gv-------TGSGKTEVYl~l-i~~~L--------~~GkqvLiLvPEI~Lt~Q~~~rl~~r-F-~~-~v~v~HS~  280 (731)
T Consensus       252 PI~LQG~DliGVAQTgtgKtL~~L~pg~ihi~aqp~~~~qr~~p~~lvl~ptreLalqie~e~~kysyng~ksvc~y---  328 (629)
T KOG0336         252 PILLQGIDLIGVAQTGTGKTLAFLLPGFIHIDAQPKRREQRNGPGVLVLTPTRELALQIEGEVKKYSYNGLKSVCVY---  328 (629)
T ss_pred             CEEECCCCEEEEEECCCCCCHHHHCCCEEEEECCCHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEE---
T ss_conf             20113764477874489847787505401451461112036898549983338889988767767643584328875---


Q ss_pred             CCCHHHHHHHHHHHCCCCEEEEECCHHH---H-HHHCCC---EEEEEEECCCCCCHHCCCCCCCHHHHHHHHHHHCCCCE
Q ss_conf             5723566789999719973999400121---1-001000---13677405532100002443224899999751103210
Q gi|254780619|r  281 LSTSMREKIWRQVARGAISVIVGVRSAL---F-LPFKKL---GLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPV  353 (731)
Q Consensus       281 ls~~eR~~~w~~i~~G~~~IVIGtRSAi---f-~P~~nL---glIIvDEEHd~sykq~~~pry~aRdvA~~Ra~~~~~~l  353 (731)
T Consensus       329 -gggnR~eqie~lkrg-veiiiatPgrlndL~~~n~i~l~siTYlVlDEAD-rM--LDMgFEpqIrkilld--iRPDRqt  401 (629)
T KOG0336         329 -GGGNRNEQIEDLKRG-VEIIIATPGRLNDLQMDNVINLASITYLVLDEAD-RM--LDMGFEPQIRKILLD--IRPDRQT  401 (629)
T ss_pred             -CCCCCHHHHHHHHCC-CEEEEECCCHHHHHHHCCEEEEEEEEEEEECCHH-HH--HCCCCCHHHHHHHHH--CCCCCEE
T ss_conf             -487854689987457-4177607851765553172001125889861266-66--445662888988652--2776225


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC------CCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEE
Q ss_conf             00024543246775321234441243223676543------321102222332224547989999998862265517997
Q gi|254780619|r  354 VLVSATPSIESRVNGISRRYHSVHLSTRYRNSALP------HLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF  427 (731)
Q Consensus       354 ilgSATPSles~~~~~~g~~~~~~l~~R~~~~~~P------~i~ivDm~~~~~~~~~~lS~~l~~~i~~~l~~g~qvll~  427 (731)
T Consensus       402 vmTSATWP~~VrrLa~s--Y~Kep~~v~vGsLdL~a~~sVkQ~i~v--~~d~~k----~--~~~~~f~~~ms~ndKvIiF  471 (629)
T KOG0336         402 VMTSATWPEGVRRLAQS--YLKEPMIVYVGSLDLVAVKSVKQNIIV--TTDSEK----L--EIVQFFVANMSSNDKVIIF  471 (629)
T ss_pred             EEECCCCCHHHHHHHHH--HHHCCEEEEECCCCEEEEEEEEEEEEE--CCCHHH----H--HHHHHHHHHCCCCCEEEEE
T ss_conf             53105586689999998--640854999614343554101025884--361899----9--9999999855888618999


Q ss_pred             ECCCCEEHHCCCCCCCCCCCCCCCCCEEEEECCCCCCEECHHHCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHCCC
Q ss_conf             42220000002356543431014652012113578320000210244655566678741100135428998888520485
Q gi|254780619|r  428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFP  507 (731)
Q Consensus       428 lnRrGya~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~~~l~~~G~Gte~~~e~l~~~fp  507 (731)
T Consensus       472 v~~K~~AD~LSS---------------------------d--------------------~~l~gi~~q----~lHG---  497 (629)
T KOG0336         472 VSRKVMADHLSS---------------------------D--------------------FCLKGISSQ----SLHG---  497 (629)
T ss_pred             EECHHHHHHCCC---------------------------H--------------------HHHCCCCHH----HCCC---
T ss_conf             831032210231---------------------------0--------------------211461011----0258---


Q ss_pred             CCHHHHCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             20001023211358678999998621257657987044302311345201233000344310245578999998754311
Q gi|254780619|r  508 LARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTG  587 (731)
Q Consensus       508 ~~~v~~~d~d~~~~~~~~~~~~~~~~~~~~~ilvgTq~i~kg~~fp~v~lv~il~aD~~l~~pd~ra~E~~~qll~qv~g  587 (731)
T Consensus       498 -------~----r~Q~DrE~al~~~ksG~vrILvaTDlaSRGlDv~DiTHV--~NyDFP~nIeeY----------VHRvG  554 (629)
T KOG0336         498 -------N----REQSDREMALEDFKSGEVRILVATDLASRGLDVPDITHV--YNYDFPRNIEEY----------VHRVG  554 (629)
T ss_pred             -------C----HHHHHHHHHHHHHHCCCEEEEEEECHHHCCCCCHHCCEE--ECCCCCCCHHHH----------HHHHC
T ss_conf             -------7----224359999976415816999972234337882002035--405787559999----------98712


Q ss_pred             CCCCCCCCCEEE
Q ss_conf             025667886899
Q gi|254780619|r  588 RAGRFGLKSLGL  599 (731)
Q Consensus       588 Ragr~~~~g~v~  599 (731)
T Consensus       555 rtGRaGr~G~si  566 (629)
T KOG0336         555 RTGRAGRTGTSI  566 (629)
T ss_pred             CCCCCCCCCCEE
T ss_conf             356577776327